SlideShare a Scribd company logo

Yesterday & Today: King Street Station in Photos

A
alliegerWeb Manager at Seattle Department of Transportation

King Street Station, located on Jackson Street between Third and Fourth Avenue S., is a brick and granite three-story building with a twelve-story clock tower. The ground floor, accessed from King Street, is clad in granite. The walls of the second and third floors, as well as the clock tower, are faced in pressed brick with decorative terra cotta elements such as cornices and window lintels.

Yesterday & Today: King Street Station in Photos

A
alliegerWeb Manager at Seattle Department of Transportation

King Street Station, located on Jackson Street between Third and Fourth Avenue S., is a brick and granite three-story building with a twelve-story clock tower. The ground floor, accessed from King Street, is clad in granite. The walls of the second and third floors, as well as the clock tower, are faced in pressed brick with decorative terra cotta elements such as cornices and window lintels.

Yesterday & Today: King Street Station in Photos

1 of 38

Recommended

Apartments in sarjapur road-Peopletree Realty Solutions @ Bren Imperia
Apartments in sarjapur road-Peopletree Realty Solutions @ Bren ImperiaApartments in sarjapur road-Peopletree Realty Solutions @ Bren Imperia
Apartments in sarjapur road-Peopletree Realty Solutions @ Bren ImperiaPeopletreerealty Solutions
 
King Street Station 7.5.10 website update
King Street Station 7.5.10 website updateKing Street Station 7.5.10 website update
King Street Station 7.5.10 website updateallieger
 
150930 frith street boards
150930 frith street boards150930 frith street boards
150930 frith street boardsoliver_preece
 
Reference list ferrous and non ferrous metals
Reference list   ferrous and non ferrous metalsReference list   ferrous and non ferrous metals
Reference list ferrous and non ferrous metalsLuciano Paparcura
 
Literature review exhibtion center
Literature review exhibtion centerLiterature review exhibtion center
Literature review exhibtion centerkaleabsenay
 
150708 plmh-public exhib-crop
150708 plmh-public exhib-crop150708 plmh-public exhib-crop
150708 plmh-public exhib-cropoli_ver1
 
Triangle Group, Dover St, Mayfair
Triangle Group, Dover St, MayfairTriangle Group, Dover St, Mayfair
Triangle Group, Dover St, Mayfairclive yorath
 

More Related Content

Viewers also liked

#Iranelection Fitzroy Amsterdam
#Iranelection Fitzroy Amsterdam#Iranelection Fitzroy Amsterdam
#Iranelection Fitzroy AmsterdamFitzroy BV
 
Web 2.0 for Schools/ Education Institution
Web 2.0 for Schools/ Education InstitutionWeb 2.0 for Schools/ Education Institution
Web 2.0 for Schools/ Education InstitutionVenkatesh Iyer
 
12027 讀書心得
12027 讀書心得12027 讀書心得
12027 讀書心得mno123456
 
Earth Has Its Faults
Earth Has Its FaultsEarth Has Its Faults
Earth Has Its FaultsChristie Lee
 
Natural Disasters Topic 4 (Earthquakes)
Natural Disasters Topic 4 (Earthquakes)Natural Disasters Topic 4 (Earthquakes)
Natural Disasters Topic 4 (Earthquakes)William W. Little
 

Viewers also liked (6)

#Iranelection Fitzroy Amsterdam
#Iranelection Fitzroy Amsterdam#Iranelection Fitzroy Amsterdam
#Iranelection Fitzroy Amsterdam
 
Web 2.0 for Schools/ Education Institution
Web 2.0 for Schools/ Education InstitutionWeb 2.0 for Schools/ Education Institution
Web 2.0 for Schools/ Education Institution
 
12027 讀書心得
12027 讀書心得12027 讀書心得
12027 讀書心得
 
Building A City
Building A CityBuilding A City
Building A City
 
Earth Has Its Faults
Earth Has Its FaultsEarth Has Its Faults
Earth Has Its Faults
 
Natural Disasters Topic 4 (Earthquakes)
Natural Disasters Topic 4 (Earthquakes)Natural Disasters Topic 4 (Earthquakes)
Natural Disasters Topic 4 (Earthquakes)
 

More from allieger

Seattle's Protected Bike Lanes
Seattle's Protected Bike LanesSeattle's Protected Bike Lanes
Seattle's Protected Bike Lanesallieger
 
Cycletracks
CycletracksCycletracks
Cycletracksallieger
 
2.11.2013 King Street Station
2.11.2013 King Street Station 2.11.2013 King Street Station
2.11.2013 King Street Station allieger
 
5.9.12 King Street Station powerpoint update
5.9.12 King Street Station powerpoint update5.9.12 King Street Station powerpoint update
5.9.12 King Street Station powerpoint updateallieger
 
King Street Station 7.28.11 slide show
King Street Station 7.28.11 slide showKing Street Station 7.28.11 slide show
King Street Station 7.28.11 slide showallieger
 
King Street Station 7.16.11 slide show
King Street Station 7.16.11 slide showKing Street Station 7.16.11 slide show
King Street Station 7.16.11 slide showallieger
 
071611 slideshow phase2a
071611 slideshow phase2a071611 slideshow phase2a
071611 slideshow phase2aallieger
 
7.8.11 Grand Staircase & Under Jackson Plaza
7.8.11 Grand Staircase &  Under Jackson Plaza7.8.11 Grand Staircase &  Under Jackson Plaza
7.8.11 Grand Staircase & Under Jackson Plazaallieger
 
7.6.11 West Canopy & Interior Work
7.6.11 West Canopy & Interior Work7.6.11 West Canopy & Interior Work
7.6.11 West Canopy & Interior Workallieger
 
King Street Station Update 6.3.11
King Street Station Update 6.3.11King Street Station Update 6.3.11
King Street Station Update 6.3.11allieger
 
King Street Station 5.18.11 slide show
King Street Station 5.18.11 slide showKing Street Station 5.18.11 slide show
King Street Station 5.18.11 slide showallieger
 
King Street Station Update 4.27.11
King Street Station Update 4.27.11King Street Station Update 4.27.11
King Street Station Update 4.27.11allieger
 
King Street Station 4.11.11 slide show
King Street Station 4.11.11 slide showKing Street Station 4.11.11 slide show
King Street Station 4.11.11 slide showallieger
 
King Street Station 3.31.11 slide show
King Street Station 3.31.11 slide showKing Street Station 3.31.11 slide show
King Street Station 3.31.11 slide showallieger
 
King Street Station 3.30.11 slide show
King Street Station 3.30.11 slide showKing Street Station 3.30.11 slide show
King Street Station 3.30.11 slide showallieger
 
King Street Station Utilities Installation 2.20.11 slide show
King Street Station Utilities Installation 2.20.11 slide showKing Street Station Utilities Installation 2.20.11 slide show
King Street Station Utilities Installation 2.20.11 slide showallieger
 
King Street Station Jackson Plaza's Salvaged Granit Balustrade3.15.11 slide show
King Street Station Jackson Plaza's Salvaged Granit Balustrade3.15.11 slide showKing Street Station Jackson Plaza's Salvaged Granit Balustrade3.15.11 slide show
King Street Station Jackson Plaza's Salvaged Granit Balustrade3.15.11 slide showallieger
 
King Street Station Marble Wall Installation3.3.11 slide show
King Street Station Marble Wall Installation3.3.11 slide showKing Street Station Marble Wall Installation3.3.11 slide show
King Street Station Marble Wall Installation3.3.11 slide showallieger
 
Gardening for Birds: Vision Greenwood Park Presentation
Gardening for Birds: Vision Greenwood Park PresentationGardening for Birds: Vision Greenwood Park Presentation
Gardening for Birds: Vision Greenwood Park Presentationallieger
 
Greenwood 2
Greenwood 2Greenwood 2
Greenwood 2allieger
 

More from allieger (20)

Seattle's Protected Bike Lanes
Seattle's Protected Bike LanesSeattle's Protected Bike Lanes
Seattle's Protected Bike Lanes
 
Cycletracks
CycletracksCycletracks
Cycletracks
 
2.11.2013 King Street Station
2.11.2013 King Street Station 2.11.2013 King Street Station
2.11.2013 King Street Station
 
5.9.12 King Street Station powerpoint update
5.9.12 King Street Station powerpoint update5.9.12 King Street Station powerpoint update
5.9.12 King Street Station powerpoint update
 
King Street Station 7.28.11 slide show
King Street Station 7.28.11 slide showKing Street Station 7.28.11 slide show
King Street Station 7.28.11 slide show
 
King Street Station 7.16.11 slide show
King Street Station 7.16.11 slide showKing Street Station 7.16.11 slide show
King Street Station 7.16.11 slide show
 
071611 slideshow phase2a
071611 slideshow phase2a071611 slideshow phase2a
071611 slideshow phase2a
 
7.8.11 Grand Staircase & Under Jackson Plaza
7.8.11 Grand Staircase &  Under Jackson Plaza7.8.11 Grand Staircase &  Under Jackson Plaza
7.8.11 Grand Staircase & Under Jackson Plaza
 
7.6.11 West Canopy & Interior Work
7.6.11 West Canopy & Interior Work7.6.11 West Canopy & Interior Work
7.6.11 West Canopy & Interior Work
 
King Street Station Update 6.3.11
King Street Station Update 6.3.11King Street Station Update 6.3.11
King Street Station Update 6.3.11
 
King Street Station 5.18.11 slide show
King Street Station 5.18.11 slide showKing Street Station 5.18.11 slide show
King Street Station 5.18.11 slide show
 
King Street Station Update 4.27.11
King Street Station Update 4.27.11King Street Station Update 4.27.11
King Street Station Update 4.27.11
 
King Street Station 4.11.11 slide show
King Street Station 4.11.11 slide showKing Street Station 4.11.11 slide show
King Street Station 4.11.11 slide show
 
King Street Station 3.31.11 slide show
King Street Station 3.31.11 slide showKing Street Station 3.31.11 slide show
King Street Station 3.31.11 slide show
 
King Street Station 3.30.11 slide show
King Street Station 3.30.11 slide showKing Street Station 3.30.11 slide show
King Street Station 3.30.11 slide show
 
King Street Station Utilities Installation 2.20.11 slide show
King Street Station Utilities Installation 2.20.11 slide showKing Street Station Utilities Installation 2.20.11 slide show
King Street Station Utilities Installation 2.20.11 slide show
 
King Street Station Jackson Plaza's Salvaged Granit Balustrade3.15.11 slide show
King Street Station Jackson Plaza's Salvaged Granit Balustrade3.15.11 slide showKing Street Station Jackson Plaza's Salvaged Granit Balustrade3.15.11 slide show
King Street Station Jackson Plaza's Salvaged Granit Balustrade3.15.11 slide show
 
King Street Station Marble Wall Installation3.3.11 slide show
King Street Station Marble Wall Installation3.3.11 slide showKing Street Station Marble Wall Installation3.3.11 slide show
King Street Station Marble Wall Installation3.3.11 slide show
 
Gardening for Birds: Vision Greenwood Park Presentation
Gardening for Birds: Vision Greenwood Park PresentationGardening for Birds: Vision Greenwood Park Presentation
Gardening for Birds: Vision Greenwood Park Presentation
 
Greenwood 2
Greenwood 2Greenwood 2
Greenwood 2
 

Recently uploaded

some Gesture Sketches done with Charcoal
some Gesture Sketches done with Charcoalsome Gesture Sketches done with Charcoal
some Gesture Sketches done with Charcoalranasermet
 
Ayodhya Ram Mandir (5).pdf
Ayodhya Ram Mandir (5).pdfAyodhya Ram Mandir (5).pdf
Ayodhya Ram Mandir (5).pdfa18205752
 
Mindful art exercises
Mindful art exercisesMindful art exercises
Mindful art exercisesArchanaA26
 
GoodLittleRabbitXiaoTuziGuaiGuaiStoryboard
GoodLittleRabbitXiaoTuziGuaiGuaiStoryboardGoodLittleRabbitXiaoTuziGuaiGuaiStoryboard
GoodLittleRabbitXiaoTuziGuaiGuaiStoryboardolin110
 
PRE Campaigns 2018 A 360 Degree Campaign.
PRE Campaigns 2018 A 360 Degree Campaign.PRE Campaigns 2018 A 360 Degree Campaign.
PRE Campaigns 2018 A 360 Degree Campaign.digital381041
 
They Cloned Tyrone_NIXON_Storyboards.pdf
They Cloned Tyrone_NIXON_Storyboards.pdfThey Cloned Tyrone_NIXON_Storyboards.pdf
They Cloned Tyrone_NIXON_Storyboards.pdfFergusonDraperWinsto
 
Client research final .pptxtsdhdhdddghgg
Client research final .pptxtsdhdhdddghggClient research final .pptxtsdhdhdddghgg
Client research final .pptxtsdhdhdddghggLeonBraley
 
A Reaffirmation of Materiality in Contemporary Ceramics
A Reaffirmation of Materiality in Contemporary CeramicsA Reaffirmation of Materiality in Contemporary Ceramics
A Reaffirmation of Materiality in Contemporary CeramicsMakoto Hatori
 
The MSME Trade Fair has been organized annually since 2013.
The MSME Trade Fair has been organized annually since 2013.The MSME Trade Fair has been organized annually since 2013.
The MSME Trade Fair has been organized annually since 2013.digital381041
 
Proposal for XYZ.com.pdf hgjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjj
Proposal for XYZ.com.pdf hgjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjProposal for XYZ.com.pdf hgjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjj
Proposal for XYZ.com.pdf hgjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjsakibimamme
 
Wildrivers2storyboardbydanishdavidkhan.pdf
Wildrivers2storyboardbydanishdavidkhan.pdfWildrivers2storyboardbydanishdavidkhan.pdf
Wildrivers2storyboardbydanishdavidkhan.pdfdanishkhan798905
 
Monster Calendar aaaaaaaaaaaaaaaaaaaaaaa
Monster Calendar aaaaaaaaaaaaaaaaaaaaaaaMonster Calendar aaaaaaaaaaaaaaaaaaaaaaa
Monster Calendar aaaaaaaaaaaaaaaaaaaaaaanoahgonz
 
The Wolf - Storyboard Assignment , 2023.
The Wolf - Storyboard Assignment , 2023.The Wolf - Storyboard Assignment , 2023.
The Wolf - Storyboard Assignment , 2023.madelynkieh
 
Action Sequence_INDIVIDUALFRAMES, FOR WEBSITE
Action Sequence_INDIVIDUALFRAMES, FOR WEBSITEAction Sequence_INDIVIDUALFRAMES, FOR WEBSITE
Action Sequence_INDIVIDUALFRAMES, FOR WEBSITERheaSajit
 
Winter and June
Winter and JuneWinter and June
Winter and Junecwang48
 
a Sequence for Outside the Box Short Film
a Sequence for Outside the Box Short Filma Sequence for Outside the Box Short Film
a Sequence for Outside the Box Short Filmranasermet
 
On ground registration management with all infrastructures, Anchor, ushers an...
On ground registration management with all infrastructures, Anchor, ushers an...On ground registration management with all infrastructures, Anchor, ushers an...
On ground registration management with all infrastructures, Anchor, ushers an...digital381041
 

Recently uploaded (20)

some Gesture Sketches done with Charcoal
some Gesture Sketches done with Charcoalsome Gesture Sketches done with Charcoal
some Gesture Sketches done with Charcoal
 
Ayodhya Ram Mandir (5).pdf
Ayodhya Ram Mandir (5).pdfAyodhya Ram Mandir (5).pdf
Ayodhya Ram Mandir (5).pdf
 
Mindful art exercises
Mindful art exercisesMindful art exercises
Mindful art exercises
 
GoodLittleRabbitXiaoTuziGuaiGuaiStoryboard
GoodLittleRabbitXiaoTuziGuaiGuaiStoryboardGoodLittleRabbitXiaoTuziGuaiGuaiStoryboard
GoodLittleRabbitXiaoTuziGuaiGuaiStoryboard
 
PRE Campaigns 2018 A 360 Degree Campaign.
PRE Campaigns 2018 A 360 Degree Campaign.PRE Campaigns 2018 A 360 Degree Campaign.
PRE Campaigns 2018 A 360 Degree Campaign.
 
They Cloned Tyrone_NIXON_Storyboards.pdf
They Cloned Tyrone_NIXON_Storyboards.pdfThey Cloned Tyrone_NIXON_Storyboards.pdf
They Cloned Tyrone_NIXON_Storyboards.pdf
 
Client research final .pptxtsdhdhdddghgg
Client research final .pptxtsdhdhdddghggClient research final .pptxtsdhdhdddghgg
Client research final .pptxtsdhdhdddghgg
 
A Reaffirmation of Materiality in Contemporary Ceramics
A Reaffirmation of Materiality in Contemporary CeramicsA Reaffirmation of Materiality in Contemporary Ceramics
A Reaffirmation of Materiality in Contemporary Ceramics
 
The MSME Trade Fair has been organized annually since 2013.
The MSME Trade Fair has been organized annually since 2013.The MSME Trade Fair has been organized annually since 2013.
The MSME Trade Fair has been organized annually since 2013.
 
Proposal for XYZ.com.pdf hgjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjj
Proposal for XYZ.com.pdf hgjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjProposal for XYZ.com.pdf hgjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjj
Proposal for XYZ.com.pdf hgjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjj
 
Wildrivers2storyboardbydanishdavidkhan.pdf
Wildrivers2storyboardbydanishdavidkhan.pdfWildrivers2storyboardbydanishdavidkhan.pdf
Wildrivers2storyboardbydanishdavidkhan.pdf
 
KOI process
KOI processKOI process
KOI process
 
Monster Calendar aaaaaaaaaaaaaaaaaaaaaaa
Monster Calendar aaaaaaaaaaaaaaaaaaaaaaaMonster Calendar aaaaaaaaaaaaaaaaaaaaaaa
Monster Calendar aaaaaaaaaaaaaaaaaaaaaaa
 
The Wolf - Storyboard Assignment , 2023.
The Wolf - Storyboard Assignment , 2023.The Wolf - Storyboard Assignment , 2023.
The Wolf - Storyboard Assignment , 2023.
 
Process Book.pptx
Process Book.pptxProcess Book.pptx
Process Book.pptx
 
Action Sequence_INDIVIDUALFRAMES, FOR WEBSITE
Action Sequence_INDIVIDUALFRAMES, FOR WEBSITEAction Sequence_INDIVIDUALFRAMES, FOR WEBSITE
Action Sequence_INDIVIDUALFRAMES, FOR WEBSITE
 
New Years Eve
New Years EveNew Years Eve
New Years Eve
 
Winter and June
Winter and JuneWinter and June
Winter and June
 
a Sequence for Outside the Box Short Film
a Sequence for Outside the Box Short Filma Sequence for Outside the Box Short Film
a Sequence for Outside the Box Short Film
 
On ground registration management with all infrastructures, Anchor, ushers an...
On ground registration management with all infrastructures, Anchor, ushers an...On ground registration management with all infrastructures, Anchor, ushers an...
On ground registration management with all infrastructures, Anchor, ushers an...
 

Yesterday & Today: King Street Station in Photos