Successfully reported this slideshow.
We use your LinkedIn profile and activity data to personalize ads and to show you more relevant ads. You can change your ad preferences anytime.

Comunicación y uso de la literatura científica en biomedicina

1,331 views

Published on

Charla impartida en el II Seminario EC3 sobre evaluación y comunicación de la ciencia

http://ec3.ugr.es/seminario2009/

Published in: Technology
  • Be the first to comment

  • Be the first to like this

Comunicación y uso de la literatura científica en biomedicina

  1. 1. Comunicación y uso de la literatura científica en biomedicina II Seminario EC3 sobre evaluación y comunicación de la ciencia Alberto Labarga [email_address] http://ec3.ugr.es/seminario2009/
  2. 2. La generación de información es un aspecto clave de la investigación biomédica
  3. 4. No sólo es importante la cantidad sino la complejidad de las interacciones
  4. 5. Applied Biosystems ABI 3730XL Illumina / Solexa Genetic Analyzer Applied Biosystems SOLiD Roche / 454 Genome Sequencer 1 Mb/day 100 Mb/run 3000 Mb/run La tecnología ha aumentado recientemente esta capacidad de generación de datos
  5. 6. Lo que se traduce en un incremento en la producción científica PubMed statistics http://www.ncbi.nlm.nih.gov/entrez >17 million citations >400,000 added/year ~70 million searches/month PubMedCentral statistics http://www.pubmedcentral.nih.gov > 500 journals >2 million full text papers ~20 million retrievals/month
  6. 7. Scientific information available in 2010 will double every 72 hours
  7. 8. Tradicionalmente, las bases de datos (Uniprot, EMBLbank) son el nodo central del conocimiento científico
  8. 9. y las referencias son material de soporte
  9. 10. pero eso está cambiando
  10. 11. A contest created to improve the way scientific information is communicated and used .  The contest invites members of the scientific community to describe and prototype a tool to improve the interpretation and identification of meaning in (online) journals and text databases relating to the life sciences. 
  11. 12. hay tres formas básicas de explicitar el conocimiento almacenado en las publicaciones científicas
  12. 13. 1. capturar el conocimiento explicitamente
  13. 14. <ul><li>Structured Digital Abstracts Experiment </li></ul><ul><ul><li>To develop and fine tune simple tools to facilitate data entries and the authors selection of terms from controlled vocabularies. </li></ul></ul><ul><ul><li>To propose a text layout for a structured abstract to be appended to the traditional abstract. </li></ul></ul><ul><ul><li>To investigate and estimate the authors' degree of interest (and competence) in a project implicating them as active players in this &quot;editorial revolution&quot;. </li></ul></ul>
  14. 17. 2. extraer el conocimiento usando minería de textos
  15. 18. http://www.ihop-net.org
  16. 20. http://www.knewco.com/
  17. 22. generar conocimiento colectivamente
  18. 23. <ul><li>web 1.0: Acceder el conocimiento </li></ul><ul><li>web 2.0: Recoger conocimiento </li></ul>
  19. 24. redes sociales
  20. 26. wikis científicas
  21. 27. http://www.wikigenes.org
  22. 28. http://www.wikiproteins.org
  23. 29. blogs
  24. 30. I was lost but now I live here http://shirleywho.wordpress.com/ Shirley Wu
  25. 31. What You’re Doing Is Rather Desperate http://nsaunders.wordpress.com Neil Saunders
  26. 32. Public Rambling http://pbeltrao.blogspot.com Pedro Beltrao
  27. 33. HubLog Alf Eaton http://hublog.hubmed.org/
  28. 34. Open Reading Frame http://www.sennoma.net/ Bill Hooker
  29. 35. Nodalpoint http://www.nodalpoint.org/
  30. 36. microblogging
  31. 38. <ul><li>web 1.0: Acceder conocimiento </li></ul><ul><li>web 2.0: Recoger conocimiento </li></ul><ul><li>web 3.0: Aplicar conocimiento </li></ul><ul><li>web 4.0: G enerar conocimiento </li></ul>
  32. 39. living document
  33. 40. <ul><li>El Living Document no es uno que se (re)escribe continuamente como en le enfoque wiki, sino un que actúa como node de interconexión entre otros documentos y bases de datos, mediante el uso de etiquetado colaborativo y ontologías </li></ul>
  34. 41. arquitectura
  35. 42. retrieval SPI annotation SPI Elsevier Pubmed BMC Custom whatizit reflect knewco ihop XSLT+DHTML +CSS user management (FOAF) tag management (MOAT) document management (POAP) web application
  36. 45. interfaces
  37. 46. Antileukoproteinase, Secretory leukocyte protease inhibitor, P03973 uniprot: http://www.uniprot.org/uniprot/ P03973 genecards: http://www.genecards.org/cgi-bin/carddisp.pl?id= P03973 dasty: http://www.ebi.ac.uk/dasty/client/ebi.php?q=P03973 >sp|P03973|SLPI_HUMAN Antileukoproteinase OS=Homo sapiens GN=SLPI MKSSGLFPFLVLLALGTLAPWAVEGSGKSFKAGVCPPKKSAQCLRYKKPECQSDWQCPGK KRCCPDTCGIKCLDPVDTPNPTRRKPGKCPVTYGQCLMLNPPNFCEMDGQCKRDLKCCMG MCGKSCVSPVKA
  38. 47. For a given annotation you can define links and ways to retrieve information. Links will be shown in the tag popup so you can visit the site Retrieval links will be used to download information in a given format, for example, all protein sequences mentioned in the text. Links uniprot: http://www.uniprot.org/uniprot/$ID$ genecards: http://www.genecards.org/cgi-bin/carddisp.pl?id=$ID$ Add new Retrieve uniprot: http://www.uniprot.org/uniprot/$ID$.txt uniprotXML : http://www.uniprot.org/uniprot/$ID$.xml fasta: http://www.uniprot.org/uniprot/$ID$.fasta Add new fasta Download ALP Antileukoproteinase       Secretory leukocyte protease inhibitor      WAP4 HUSI-1          BLPI    
  39. 48. http://www.wired-marker.org
  40. 49. http://www.shiftspace.org/
  41. 57. web services high thoughput text visualization integration mining data analysis ontologies
  42. 58. muchas gracias! Para saber más: http://www.scientifik.info

×