D1_EstructProt_02

1,261 views

Published on

Universidad Nacional de Quilmes Curso Bioinformatica Estructural de Proteinas 2007 Dia 1 - Estructura de Proteinas - 02

0 Comments
1 Like
Statistics
Notes
  • Be the first to comment

No Downloads
Views
Total views
1,261
On SlideShare
0
From Embeds
0
Number of Embeds
35
Actions
Shares
0
Downloads
45
Comments
0
Likes
1
Embeds 0
No embeds

No notes for slide

D1_EstructProt_02

  1. 1. Estructura de Proteínas Aspectos prácticos
  2. 2. http://www.rcsb.org
  3. 4. HEADER ACYLTRANSFERASE 07-OCT-95 1LXA TITLE UDP N-ACETYLGLUCOSAMINE ACYLTRANSFERASE COMPND MOL_ID: 1; COMPND 2 MOLECULE: UDP N-ACETYLGLUCOSAMINE O-ACYLTRANSFERASE; COMPND 3 CHAIN: NULL; COMPND 4 SYNONYM: LPXA; COMPND 5 EC: 2.3.1.129; COMPND 6 ENGINEERED: YES; COMPND 7 MUTATION: S64Q, V65F, D125H SOURCE MOL_ID: 1; SOURCE 2 ORGANISM_SCIENTIFIC: ESCHERICHIA COLI; SOURCE 3 STRAIN: K12; SOURCE 4 EXPRESSION_SYSTEM: MC1061; SOURCE 5 EXPRESSION_SYSTEM_PLASMID: PSR1; SOURCE 6 EXPRESSION_SYSTEM_GENE: LPXA KEYWDS 2 LIPID SYNTHESIS EXPDTA XRAY DIFFRACTION - SINGLE CRYSTAL AUTHOR S.L.RODERICK REMARK 2 REMARK 2 RESOLUTION. 2.6 ANGSTROMS. REMARK 290 REMARK 290 CRYSTALLOGRAPHIC SYMMETRY REMARK 290 SYMMETRY OPERATORS FOR SPACE GROUP:P213 REMARK 290 CRYST1 99.000 99.000 99.000 90.00 90.00 90.00 P 1 1 SCALE1 0.010101 0.000000 0.000000 0.00000 SCALE2 0.000000 0.010101 0.000000 0.00000 SCALE3 0.000000 0.000000 0.010101 0.00000 ATOM 1 N MET A 1 88.077 94.618 63.411 1.00 77.61 ATOM 2 CA MET A 1 87.915 95.650 64.419 1.00 75.36 ATOM 3 C MET A 1 86.517 95.664 65.029 1.00 59.38 ATOM 4 O MET A 1 85.616 95.027 64.492 1.00 60.53 ATOM 5 CB MET A 1 88.320 97.030 63.876 1.00 81.46 ATOM 6 CG MET A 1 88.928 97.940 64.937 1.00 90.73 ATOM 7 SD MET A 1 88.279 99.634 64.871 1.00100.00 ATOM 8 CE MET A 1 87.314 99.554 63.336 1.00 96.83 ATOM 9 N ILE A 2 86.335 96.385 66.151 1.00 38.83 ATOM 10 CA ILE A 2 85.048 96.441 66.828 1.00 33.63 ATOM 11 C ILE A 2 84.476 97.800 67.176 1.00 40.90 ATOM 12 O ILE A 2 85.112 98.600 67.855 1.00 41.85 ATOM 13 CB ILE A 2 85.132 95.721 68.140 1.00 35.31 ATOM 14 CG1 ILE A 2 85.453 94.275 67.899 1.00 37.35 ATOM 15 CG2 ILE A 2 83.799 95.853 68.856 1.00 32.19 ATOM 16 CD1 ILE A 2 85.370 93.526 69.210 1.00 53.60 ATOM 17 N ASP A 3 83.226 97.987 66.777 1.00 41.11 ATOM 18 CA ASP A 3 82.469 99.207 67.004 1.00 42.45 ATOM 19 C ASP A 3 82.283 99.669 68.426 1.00 42.41 Archivo de coordenadas Formato PDB
  4. 5. http://www.ebi.ac.uk/thornton-srv/databases/pdbsum/
  5. 6. Importancia del conocimiento de la estructura nativa ????
  6. 7. Estructura Básica
  7. 10. Dinámica
  8. 11. Superficie y cavidades
  9. 15. Dominios
  10. 19. http://www.sanger.ac.uk/Software/Pfam/iPfam/
  11. 20. Estructura cuaternaria: obligómeros
  12. 21. Estructura cuaternaria: Oligómero transitorio
  13. 24. Clasificación de plegamientos
  14. 28. Comparación de la estructura de proteínas Cambios conformacionales (ligandos, inhibidores) Detección de relaciones evolutivas lejanas Variación estructural en una familia por adaptación funcional Identificación de estructuras nativas comunes. Super plegamientos
  15. 29. Cambios conformacionales (ligandos, inhibidores)
  16. 30. Detección de relaciones evolutivas lejanas
  17. 31. Variación estructural en una familia por adaptación funcional ( embellishments )
  18. 32. Identificación de estructuras nativas comunes. Super plegamientos
  19. 33. Métodos de comparación de estructuras <ul><li>Superposición de estructuras y medición de distancias intermoleculares basados principalmente en características geométricas </li></ul><ul><li>Comparación de medidas intramoleculares </li></ul><ul><li>Combinación de ambas </li></ul>
  20. 34. <ul><li>Uso de métodos intermoleculares </li></ul><ul><li>Rossman y Argos 1970s. Superposición de cuerpo rígido </li></ul><ul><li>Aplicación directa para proteínas con mas de 35% I </li></ul><ul><li>Descartar regiones de loops (no da alineamientos seguros) </li></ul><ul><li>Dividir las proteínas en fragmentos </li></ul><ul><li>Uso de métodos de optimización ( Dynamic programming ) </li></ul><ul><li>STAMP (Russell and Barton) </li></ul>
  21. 36. 2. Uso de métodos intramoleculares Matrices de distancias
  22. 38. 1LXA_model_de 1 ---------------------------MIDKSAFVHPTAIVEEGASIGAN 23 :||.:|::.|.|.|....:|||| 1THJ_model_de 1 MQEITVDEFSNIRENPVTPWNPEPSAPVIDPTAYIDPEASVIGEVTIGAN 50 1LXA_model_de 24 AHIGPFC----------IVGPHVEIGEGTVLKSHVVVNGHTKIGRDNEIY 63 ..:.|.. .||....:.:|.||.:...:|...:...|| 1THJ_model_de 51 VMVSPMASIRSDEGMPIFVGDRSNVQDGVVLHALETINEEGEPIEDN--- 97 1LXA_model_de 64 QFASIGEVNQDLKYAGEPTRVEIGDRNRIRESVTIHRGTVQGGGLTKVGS 113 |.||: |:...|.||:...:.....:| |...||. 1THJ_model_de 98 ----IVEVD------GKEYAVYIGNNVSLAHQSQVH-------GPAAVGD 130 1LXA_model_de 114 DNLLMINAHIAHDCTVGNRCILANNATLAGHVSVDDFAIIGGMTAVHQFC 163 |..:.:.|.: ....|||.|:|...:...|....|...|..||....| 1THJ_model_de 131 DTFIGMQAFV-FKSKVGNNCVLEPRSAAIGVTIPDGRYIPAGMVVTSQ– 177 1LXA_model_de 164 IIGAHVMVGGCSGVAQDVP----PYVIAQGNHATPFGVNI---EGLKRRG 206 ..|..:| .|..:..|.|..: ||: ||.|.. 1THJ_model_de 178 ------------AEADKLPEVTDDYAYSHTNEAVVY-VNVHLAEGYKET- 213 1LXA_model_de 207 FSREAITAIRNAYKLIYRSGKTLDEVKPEIAELAETYPEVKAFTDFFARS 256 1THJ_model_de 214 -------------------------------------------------- 213 1LXA_model_de 257 TRGLIR 262 1THJ_model_de 214 ------ 213 1150 1150 824 206 Atoms 15.76 15.76 15.79 15.73 RMSD All Heavy Back Bone Alpha Carbons 0-27, 28-61, 62-106, 107-170, 171-183, 191-212, 214-214 1THJ chain 'A' 1-28, 32-65, 80-124, 127-190, 193-205, 206-227, 228-228 1LXA Residues Structure
  23. 39. 2. Uso de métodos intramoleculares Uso de fragmentos DALI y SSAP
  24. 40. 3. Uso de métodos intramoleculares e intermoleculares COMPARER
  25. 41. http://www.cathdb.info/latest/index.html
  26. 45. El número de plegamientos posibles es limitado Se estima que en la PDB existe un 20% del total de plegamientos posibles en proteínas
  27. 46. Superfolds
  28. 49. http://scop.mrc-lmb.cam.ac.uk/scop/ 2845 1539 945 Total 171 108 75 Small proteins 99 88 47 Membrane and cell surface proteins 61 46 46 Multi-domain proteins 717 409 279 Alpha and beta proteins (a+b) 629 222 136 Alpha and beta proteins (a/b) 560 290 144 All beta proteins 608 376 218 All alpha proteins Number of families Number of superfamilies Number of folds Class
  29. 50. http://www.molmovdb.org/
  30. 52. http://www.ebi.ac.uk/msd-srv/prot_int/pistart.html
  31. 53. http://pqs.ebi.ac.uk/
  32. 54. http://www.supfam.org/elevy/3dcomplex/Home.cgi
  33. 55. http://i.moltalk.org/

×