Successfully reported this slideshow.
We use your LinkedIn profile and activity data to personalize ads and to show you more relevant ads. You can change your ad preferences anytime.

Mejoramiento genetico del cerezo en España

29 views

Published on

Ana Wünsch

Published in: Science
  • Be the first to comment

  • Be the first to like this

Mejoramiento genetico del cerezo en España

  1. 1. El acervo genético del cerezo en España y su utilización en la mejora del cultivo Dr. Ana Wünsch Blanco
  2. 2. Unidad de Hortofruticultura
  3. 3. LÍNEAS DE INVESTIGACIÓN EN HORTOFRUTICULTURA RECURSOS GENÉTICOS RECURSOS GENÉTICOS OPTIMIZA CIÓN DE LA PRODUCC IÓN OPTIMIZA CIÓN DE LA PRODUCC IÓN POSTCOSECHA Y ENVASADO POSTCOSECHA Y ENVASADO MEJORA GENÉTICA MEJORA GENÉTICA
  4. 4. Manejo, conservación, caracterización y adaptación de Recursos Genéticos: Colecciones de variedades y patrones Recuperación, conservación y explotación del germoplasma local Material base para la certificación frutal Diversidad genética e identificación molecular de variedades Examen técnico DHE de nuevas variedades Mejora Genética: Obtención de nuevos materiales (variedades y patrones) Identificación y selección de genes de interés Genetica, Genomica, Bioinformatica Optimización de la producción. Bases fisiológicas, genéticas y moleculares: Biología reproductiva. Diferenciación floral, polinización y cuajado de frutos Autoincompatibilidad floral y relaciones de incompatibilidad Compatibilidad patrón-injerto Estreses bióticos y abióticos en patrones frutales Fenologia, calidad de fruto Envasado y postcosecha Técnicas postcosecha de conservación Envasado, cuarta gama LÍNEAS DE INVESTIGACIÓN EN FRUTICULTURA
  5. 5. Heraclea Lyncestis, Macedonia
  6. 6. LutherLutherLutherLuther BurbankBurbankBurbankBurbank (1848-1926)
  7. 7. Árbol original de Black Republican (Miliwaukie, Oregon. 1904) ‘Bing’ (1875)
  8. 8. Programas de mejora:Programas de mejora:Programas de mejora:Programas de mejora: 1911: Geneva (Nueva York, USA) 1915: Vineland (Ontario, Canadá) Vic (1959) 1924: Summerland (BC, Canadá) Van (1944), Sam (1953) 1925: John Innes (Reino Unido) Clones fundadores:Clones fundadores:Clones fundadores:Clones fundadores: Napoleón, Burlat, Black Republican Mejora Genética de Cerezo
  9. 9. Similitud 1.00 Precoce Berrnard Moreau Burlat Ramon Oliva Taleguera Brillante Tigre Cristobalina Duroni 3 Reverchon Ambrunes Pico Negro Pico Colorado Marmotte Star Napoleon Hedelfinger Belge Bing Sam Ferrovia Van Vignola Blanca de Provenza 0.50 0.60 0.70 0.80 0.90 SSRs
  10. 10. SSRs
  11. 11. H1 H2 H3 Resultados y discusión. Diversidad geográfica. Marcadores de cloroplasto
  12. 12. S I L V E S T R E S C U L T I V A D O S H1 H2 H3 Marcadores de cloroplasto
  13. 13. Caracteres de interés en material local: Autocompatibilidad Requerimientos de frio Fecha de floración Fecha de maduración Calidad fruto, firmeza, sabor, color
  14. 14. Autoincompatibilidad (Self-incompatibility)
  15. 15. (Crane & Brown, 1937)
  16. 16. (Crane & Brown, 1937)
  17. 17. LocusLocusLocusLocus SSSS S-RNasa SFB S-RNasa RNA RNA Degradación RNA Pistilo Protein Degradation SCF complex SFB Protein Ubiquitination Polen Introducción en el tubo polínico SFB reconoce y protege Rnasas propias no son degradadas- efecto citotoxico No hay crecimiento del tubo polínico
  18. 18. LocusLocusLocusLocus SSSS S-RNasa SFB S-RNasa RNA RNA Degradacion RNA Pistilo Protein Degradation SCF complex SFB Protein Ubiquitination Polen Introducción en el tubo polínico SFB reconoce RNasas ajenas y son desactivadas crecimiento del tubo polínico
  19. 19. AutocompatibilidadAutocompatibilidadAutocompatibilidadAutocompatibilidad Mutantes inducidos:Mutantes inducidos:Mutantes inducidos:Mutantes inducidos: Emperor Fancis x Napoleón (polen irradiado*) Lambert x JI2420* / JI2434* Van x Stella* (1975) Sunburst* (1983) Newstar* (1988) … Sweetheart* (1994) …
  20. 20. S6 1304 S6F1 S6R1 S3 1474 S3R1S3F1 S3CRIS MAMLKSSLSFLVLGFAFFLCFIISAGDGSYVYFQFVQQWPPTTCRVQKKCSKPRPLQNFT S3SATO MAMLKSSLSFLVLGFAFFLCFIISAGDGSYVYFQFVQQWPPTTCRVQKKCSKPRPLQNFT S3NAPO MAMLKSSLSFLVLGFAFFLCFIISAGDGSYVYFQFVQQWPPTTCRVQKKCSKPRPLQNFT ************************************************************ S3CRIS IHGLWPSNYSNPTMPSNCNGSRFKKELLSPRMQSKLKISWPNVVSSNDTKFWESEWNKHG S3SATO IHGLWPSNYSNPTMPSNCNGSRFKKELLSPRMQSKLKISWPNVVSSNDTKFWESEWNKHG S3NAPO IHGLWPSNYSNPTMPSNCNGSRFKKELLSPRMQSKLKISWPNVVSSNDTKFWESEWNKHG ************************************************************ S3CRIS TCSEQTLNQVQYFEISHEMWNSFNITDILKNASIVPHPTQTWKYSDIVSAIQSKTQRTPL S3SATO TCSEQTLNQVQYFEISHEMWNSFNITDILKNASIVPHPTQTWKYSDIVSAIQSKTQRTPL S3NAPO TCSEQTLNQVQYFEISHEMWNSFNITDILKNASIVPHPTQTWKYSDIVSAIQSKTQRTPL ************************************************************ S3CRIS LRCKTDPAHPNANTQLLHEVVFCYGYNAIKQIDCNRTAGCKNQVNILFP 229 S3SATO LRCKTDPAHPNANTQLLHEVVFCYGYNAIKQIDCNRTAGCKNQVNILFP 229 S3NAPO LRCKTDPAHPNANTQLLHEVVFCYGYNAIKQIDCNRTAGCKNQVNILFP 229 *************************************************
  21. 21. RTRTRTRT---- PCRPCRPCRPCR SFB6 S C0.00 0.01 0.02 0.03 0.04 0.05 SFB3 S C0.00 0.10 0.20 0.30 0.40 0.50
  22. 22. Brooks X Cristobalina S1S9 S3S6 SI SC S1S3 : S1S6 : S3S9 : S6S9 8 : 9 : 7 : 9 SI : SC 23 : 10 Estrategia ‘Bulk Segregant Analysis’
  23. 23. `Cristobalina´ `Brooks´ B1 B2 100 139 150 160 200 100 139 150 160 200 100 139 150 160 200 100 139 150 160 200 `Cristobalina´ `Brooks´ B1 B2 100 139 150 160 200 100 139 150 160 200 100 139 150 160 200 100 139 150 160 200 100 139 150 160 200 100 139 150 160 200 100 139 150 160 200 100 139 150 160 200 EMPaS02
  24. 24. SNP analysis of recombiant genotypes Wide Genome 6K Cherry SNP Array (RosBREED/Illumina)
  25. 25. ss490551584 ss490551593 ss490551632 ss49055163535.8 ss49055166639.1 ss490551749 ss49055173943.8 ss490551699 ss49055167845.4 ss49055186952.0 ss490548083 ss49055187853.5 ss49055192860.1 ss490551939 EMPaS05 UDP96-00861.7 ss49055196363.3 ss490551972 ss49055196964.8 ss49055197474.9 ss49055198376.4 ss490551986 ss49054813978.0 ss490548147 ss490559215 ss49055200679.5 ss49055200081.1 ss49055202389.6 ss490552038 ss49055203296.1 ss49055205099.4 ss490548178100.9 ss490552064102.5 ss490552101117.9 ss490552104 EPPCU190119.4 ss490552107121.0 EMPaS02122.5 ss490552237125.8 ss490550839 ss490550883 ss490550872 0.0 ss4905511104.8 ss490547771 ss490551171 ss4905511676.4 ss4905511999.6 ss49055123412.8 ss490551250 ss490559273 ss490547811 ss49055124614.4 ss490551254 ss490551305 ss490551309 ss490547822 ss490551321 ss490551267 ss490547819 ss490559474 ss490551337 15.9 ss490551487 ss49055136521.0 ss49054787031.1 ss490551435 ss490551446 ss490551490 ss490551462 ss490558935 ss490551450 32.7 ss490551577 ss490547960 ss490551552 ss490551623 ss490559025 34.3 ss490551584 ss490551593 ss490551632 ss490551635 35.8 ss49055166639.1 ss490551749 ss49055173943.8 ss490551699 ss49055167845.4 ss49055186952.0 ss490548083 ss49055187853.5 ss49055192860.1 ss490551939 EMPaS05 UDP96-00861.7 ss49055196363.3 ss490551972 ss49055196964.8 ss49055197474.9 ss49055198376.4 ss490551986 ss49054813978.0 ss490548147 ss490559215 ss490552006 79.5 ss49055200081.1 ss49055202389.6 ss490552038 ss49055203296.1 ss49055205099.4 ss490548178100.9 ss490552064102.5 ss490552101117.9 ss490552104 EPPCU190119.4 ss490552107121.0 EMPaS02122.5 ss490552237125.8 CXC LG3CXC LG3CXC LG3CXC LG3
  26. 26. Dr. K.Ono Dr. R. Tao
  27. 27. m-specific insertion can influence gene expression ‘Cristobalina’ ‘Brooks’ ‘Lambert’ ‘Satonishiki’ ‘Takasago’ ‘Naporeon’ ‘Benishuho’ ‘Stella’ ‘Colt’ ‘Gassannishiki’ ‘Rainier’ ‘SonMiró’ ‘TalegalAhín’ ‘Ambrunes’ ‘Ferrovia’ ‘Hedelfinger’ ‘Sam’ ‘Sue’ ‘Summit’ ‘Vic’ CultivarsF1 progenies BC1 BC3 BC5 BC7 BC9 BC13 BC18 BC21 BC28 BC31 LC6 LC8 LC9 LC10 LC11 LC1 LC2 LC3 LC4 LC5 TIR TIR 1848-bp transposable element-like insertion Rv ca 600bp Fw 280bp g340-Bg340-A PCR (Mm, MM)
  28. 28. AutocompatibilidadAutocompatibilidadAutocompatibilidadAutocompatibilidad Mutantes inducidos:Mutantes inducidos:Mutantes inducidos:Mutantes inducidos: Emperor Fancis x Napoleón (polen irradiado*) Lambert x JI2420* / JI2434* Van x Stella* (1975) Sunburst* (1983) Newstar* (1988) … Sweetheart* (1994) … Mutantes naturales:Mutantes naturales:Mutantes naturales:Mutantes naturales: Italia: Kronio* España: Cristobalina* Talegal Ahin* Son Miro*
  29. 29. S 1 S 3 S 4 S 9 S 6
  30. 30. Population Name Type N Year ‘Ambrunés’ × ‘Cristobalina’ A×C F1 40 2009 ‘Brooks’ × ‘Cristobalina’ B×C F1 29 2000 ‘Lambert’ × ‘Cristobalina’ L×C F1 14 2001 ‘Vic’ × ‘Cristobalina’ V×C F1 158 2010 ‘B×C-08’ self-pollination B×C2 F2 68 2009 ‘Cristobalina’ self-pollination C×C F2 97 2008 Total 406
  31. 31. DNA extraction SNP Genotyping GenomeStudio™ RosBREED Cherry 6K SNP array v1
  32. 32. Mapas genéticos de ‘Vic’ (V), ‘Cristobalina’ (C) y consenso de V×C.
  33. 33. Número de marcadores, distancia genética y densidad en los mapas genéticos generados.
  34. 34. Fecha de floración
  35. 35. ReferenceReferenceReferenceReference SpeciesSpeciesSpeciesSpecies LGsLGsLGsLGs ofofofof floweringfloweringfloweringflowering timetimetimetime QTLsQTLsQTLsQTLs Wang et al. (2000) Prunus cerasus 1 and 2 Dirlewanger et al. (2012) Prunus avium 1, 2, 3, 4, 5, 6, 7 and 8 Castede et al. (2014) Prunus avium 1, 2, 3, 4, 5, 6, 7 and 8 Cai et al. (2018) Prunus cerasus 1, 2, 4 and 5 Flowering time QTLs in cherries
  36. 36. (Zaragoza, Spain) 415415415415 genotypes
  37. 37. 2015201520152015 2016201620162016 2017201720172017 2018201820182018 Calendar days (CD) Growing degree hours (GDH) Richardson et al. (1974) Flowering Date January 1st PhenotypingPhenotypingPhenotypingPhenotyping
  38. 38. DNA extraction SNP Genotyping 500,000 iterations 100 effective chain samples 2lnBF (Bayes Factor) > 2: Positive > 5: Strong > 10: Decisive Linkage mapFlexQTL™ GenomeStudio™ ss490550839 ss490550872 ss490550883 ss490551110 ss490547771 ss490551167 ss490551199 ss490551234 ss490547811 ss490551246 ss490559273 ss490551309 ss490551267 ss490551365 ss490547873 ss490551435 ss490558935 ss490551490 ss490558929 ss490553068 ss490547960 ss490551623 ss490551552 ss490551577 ss490559025 ss490551584 ss490551635 ss490551678 ss490551739 ss490551699 ss490551749 ss490551869 ss490551878 ss490548083 ss490551928 ss490551939 ss490551963 ss490551974 ss490551986 ss490552006 ss490548147 ss490552023 ss490552032 ss490552064 ss490548178 ss490552101 ss490552104 ss490552237 QTLQTLQTLQTL analysisanalysisanalysisanalysis RosBREED Cherry 6K SNP array v1
  39. 39. Firmeza de fruto
  40. 40. Ambrunes Cereza del Jete Dr. Margarita Lopez-Corrales Dr. Manuel Serradilla Asociación Cooperativas Valle del Jerte Cooperativa de Navaconcejo
  41. 41. Dr. Ariana Cachi_ Self-Incompatibility Francisco Balas_Fruit Firmness Albert Martinez_SNPs diversity Jaime Abascal_Chloroplast Diversity Alejandro Calle_Genetic mapping, QTL analysis, Flowering date, Fruit quality

×