Imunologi; sist imun nonspesifik

4,292 views

Published on

Imunologi; sist imun nonspesifik

Published in: Education, Technology
0 Comments
5 Likes
Statistics
Notes
  • Be the first to comment

No Downloads
Views
Total views
4,292
On SlideShare
0
From Embeds
0
Number of Embeds
613
Actions
Shares
0
Downloads
0
Comments
0
Likes
5
Embeds 0
No embeds

No notes for slide

Imunologi; sist imun nonspesifik

  1. 1. SISTEM IMUN NONSPESIFIK<br />Lisa andina, S.farm, Apt.<br />
  2. 2. pendahuluan<br />Sistemimunadalahsuatusistempertahantubuh yang kompleks yang memberikanperlindunganterhadapadanyainvasizat-zatasingkedalamtubuh.<br />Berbagaisenyawaorganikdananorganik, baik yang hidupmaupunmati yang berasaldarihewan, tumbuhan, jamur, bakteri, virus, parasit, debu, polusi, uap, asap, danbahaniritanlainnya<br />Selainitusel-seltubuh yang matiatausel yang bermutasi yang tumbuhtidakterkendali, merupakanbahan yang tidakdiinginkandanharusdikeluarkanataudimusnahkan.<br />
  3. 3. Kemampuantubuhuntukmenyingkirkanbahanasing yang masukkedalamtubuhtergantungpadakemampuansistemimununtukmengenalmolekul-molekulasingatau antigen yang terdapatpadapermukaanbahanasingtersebutdankemampuanuntukmelakukanreaksi yang tepatuntukmenyingkirkan antigen.<br />Kemampuaninidimilikiolehkomponensistemimun yang terdapatdalamjaringanlimfoid yang tersebardiseluruhtubuh.<br />
  4. 4. Sistemimunmerupakansistem yang rumit<br />Strategidasarnyasangatsederhana, yaitu:<br />Mengenalisenyawaasingbagitubuh<br />Mengerahkankekuatantubuhuntukmemusnahkansenyawaasing yang masukkedalamtubuh.<br />Perlumemahamimengenaianatomidankomponensistemimununtukmemahamimekanismekerjasistemimun.<br />
  5. 5. Elemensistemimunnonspesifik<br />
  6. 6. Anatomitubuhsebagaibarier(faktorfisik)<br />Lapisanluardanlapisanepitel internal kulit<br />Kulitmerupakanpertahananlinipertamaterhadapmikroorganisme<br />Kulitterdiridaridualapisan<br />Epidermis, yang mengalamikeratinisasidantidakmemilikipembuluhdarah, terdiridarimelanosit, keratinosid, sellangerhans, selgranstein.<br />Melanositmenghasilkanpigmencoklat-hitam (melanin), melanin melindungikulitdenganmenyerapsinar UV ygmerugikantubuh.<br />Keratinosidmenghasilkan keratin kuat yang membentuklapisanprotektifkulitdilapisansebelahluar, danmemproduksi interleukin-1 (pematangan pre sel T ditimus) <br />
  7. 7. Sawarfisikinimenghalangimasuknyamikroorganismedanbahanatausenyawa lain yang merugikanbagitubuh<br />Sellangerhansdanselgransteinjugaberfungsidalamimunitasspesifikmasing-masingdenganmenyajikanagkesel T helper dansel T supressor<br />Lapisan dermis disebelahdalamkulit<br />Lapisan dermis mengandungpembuluhdarah yang memberikannutrisikulitdanberperanpentingdalammengatursuhubadan.<br />Ujung syarafsensorik yang memberiinformasimengenailingkunganeksternaldanbeberapakelenjareksokrindanfolikelrambut yang terbentukolehepiteldiatasnya.<br />Anatomitubuhsebagaibarier(faktorfisik)<br />
  8. 8. Anatomitubuhsebagaibarier(faktorfisik)<br />Kelenjaresokrinkulitterdiridarikelenjarsebasea yang sebum, suatubahanberminyak yang melunakkandanmembuatkulitkedap air dankelenjarkeringat<br />deskuamasidarilapisanepitelkulitjugamembantumenghalaubakteridanparasitlainnya yang dapatmenempelpadalapisanepitelkulit<br />
  9. 9. Anatomitubuhsebagaibarier(faktorfisik)<br />Selainkulit, pintuutamalainnya yang dapatdilaluiolehmikroorganismepatogen, adalah:<br />Sistempencernaan<br />Berbagaienzim yang terdapatdi air liur, sekresilambung yang bersifatasam, gut associated lymphoid tissue (GALT) dan flora normal padasaluranpencernaan yang dapatmempertahankandiridariinvasimikroorganismepatogen.<br />Sistemurogenitalia<br />Dilindungiolehsekresi mucus penangkappartikeldansekresiasam yang bersifatdestruktifbagiorganismepatogen.<br />
  10. 10. Anatomitubuhsebagaibarier(faktorfisik)<br />Sistempernafasan<br />Pertahanannyatergantungpadaaktivitasmakrofag alveolus danpadasekresi mucus yang lengketdapatmenjeratsenyawaasing yang masukkemudiandisapukeluarolehpergerakansilia.<br />Pertahanansaluranpernafasanlainnyaadalahbuluhidung yang dapatmenyaringpartikelukuranbesar.<br />Mekanismerefleksbatukdanbersin, masing-masingmampumengeluarkaniritandaritrakeadanhidung.<br />
  11. 11. Anatomitubuhsebagaibarier(faktor KIMIA)<br />Lisozimdanfosfolipase yang terdapatdidalam air mata,<br />Saliva dansekrethidung yang mampumelisiskandindingselbakteridanmerusakmembranselbakteri<br />Asamlemak yang terdapatdalamkeringatdan,<br />pH yang rendahpadalambungdapatmenghambatpertumbuhanbakteri<br />Senyawadefensin yang terdapatdalamparu-parudan gastrointestinal bersifatantimikroba.<br />Senyawasurfaktandalamparu-paruberfungsisebagaiopsonin yang merupakansenyawa yang mampumemacusel-selfagositosisuntukmenelanpartikel-partikel yang tidakdiinginkan.<br />
  12. 12. Anatomitubuhsebagaibarier(faktor KIMIA)<br />Cairanlambung yang terdiridariasamklorida, enzimdanlendirbersifatasamdengan pH yang sangatrendah (pH 1,2 - 3,0) dapatmerusaksebagianbesarbakteridantoksinbakterikecualibakteriClostridium botulinumdanStaphylococcus aureus<br />BakteriHelicobacter pylori dapatmenetralkanasamlambungsehinggabakteriinidapatberkembangdidalam gastrointestinal<br />Cairan vagina jugabersifatasamsehinggadapatmenghambatpertumbuhanbakteri<br />Darahmengandung iron-binding protein (transferin) yang dapatmenghambatpertumbuhanbakteridengancaramengurangiketersediaanzatbesi yang sangatdiperlukanuntukpertumbuhanbakteri<br />
  13. 13. Anatomitubuhsebagaibarier(faktor BIOLOGI)<br />Flora normal padakulitdansaluranpencernaandapatmencegahkolonisasibakteripatogendengancara:<br />Mensekresisenyawatoksik<br />Bersaingdenganbakteripatogendalammemanfaatkannutrisi yang ada<br />Bersaingdenganbakteripatogendalamperlekatannyapadalapisan sel.<br />Contoh:<br />Flora normal dalam vagina dapatmenghambatpertumbuhancandidaalbicans<br />Keberadaan Escherichia collidalamlambungmampumenghambatpertumbuhan Salmonella danShigella<br />
  14. 14. BARIER HUMORAL TERHADAP INFEKSI<br />Anatomitubuhkitamerupakanbarier yang sangatefektifuntukmencegahkolonisasimikroorganismepadajaringantubuh.<br />Jikaterjadikerusakanpadajaringantersebutmakaakanterjadikerentananpadapenghalangmasuknyamikroorganismesehinggadapatterjadiprosesinfeksi<br />Sekalimikroorganismedapatmenembusbarierfisikmakasistemimunnonspesifiklainnyaakanbekerja, antara lain adalahinflamasiakut.<br />Faktor-faktorhumoralberperanpentingpadaprosesinflamasi, yang ditandaidenganadanya edema danmobilisasisel-selfagosit<br />
  15. 15. BARIER HUMORAL TERHADAP INFEKSI<br />Faktor-faktorhumoral yang terlibat<br />Sistemkomplemen<br />Faktorutamapadamekanismepertahananhumoral yang nonspesifik. <br />Aktifasisistemkomplemenmeningkatkanpermeabilisasipembuluhdarah<br />Merangsangmobilisasisel-selfagositdanmampumelisiskanataumelakukanopsonisasisel-selbakteri.<br />
  16. 16. BARIER HUMORAL TERHADAP INFEKSI<br />Sistemkoagulasi<br />Aktifasisistemkoagulasibergantungpadakeparahandarikerusakanjaringan yang terinfeksi.<br />Beberapaprodukdapatberperankarenakemampuannyadalammeningkatkanpermeabilitaspembuluhdarah<br />bekerjasebagaizatkemotaksisuntukmerangsangsel-selfagosit<br />Bersifatantimikroba, misalnya beta-lisin, yaitusuatu protein yang diproduksiolehsel platelet selamaproseskoagulasi yang mampumelisiskanbakteri gram positif<br />
  17. 17. BARIER HUMORAL TERHADAP INFEKSI<br />Laktoferindantransferin. Protein inidapatmenghambatpertumbuhanbakteri<br />Interferon, merupakan protein yang dapatmenghambatreplikasidari virus didalamselhospes.<br />Lisozim, suatuenzim yang dapatmerusakdindingselbakteri<br />Interleukin-1, selainbersifatsebagaiantimikrobajugadapatmenginduksidemamdanmerangsangproduksiberbagai protein faseakut.<br />
  18. 18. BARIER SELULER TERHADAP INFEKSI<br />Salahsatuprosespentingdalaminflamasiadalahmemobilisasiselpolimorfonuklear (PMN) danmakrofagketempatinfeksi.<br />Beberapaseldibawahinimerupakanliniutamadalamsistemimun non spesifik<br />neutrofil, merupakanselpolimorfonuklear (PMN) yang dibutuhkanberadapadasitusinfeksidimanamerekamenelandanmembunuhmikroorganismesecaraintraseluler.<br />
  19. 19. BARIER SELULER TERHADAP INFEKSI<br />Basofildapatmengeluarkanhistamindan heparin yang jugaterlibatdalammanifestasireaksialergi.<br />Makrofag, fungsi :<br />memfagositosisjugamembunuhmikroorganisme. Makrofag<br />membunuhbaiksecaraintraselulermaupunsecaraekstraseluler.<br />Berperandalamperbaikanjaringan<br />Antigen precenting cells untukmenginduksiresponimunspesifik<br />
  20. 20. BARIER SELULER TERHADAP INFEKSI<br />Monosit, seliniakanmenjadimakrofagdanbersifatfagositik yang berukuranbesardanterikatpadajaringan.<br />Natural killer (NK) danLymphokine Activated Killer (LAK) <br />Dinamakanselpembnuuhkarenamembunuh virus, mikrobadansel-sel tumor/kankertertentu.<br />Ukurannyalebihbesardaripadalimfosit B danlimfosit T.<br />Menghasilkanbeberapasenyawasitokin yang membawapesan yang mengaturfungsilimfosit B, limfosit T danmakrofag<br />
  21. 21. RESPON IMUN NONSPESIFIK<br />TO BE CONTNUED…<br />

×