Successfully reported this slideshow.
We use your LinkedIn profile and activity data to personalize ads and to show you more relevant ads. You can change your ad preferences anytime.

2017 02 apan

22 views

Published on

APAN, India Feb 2017

Published in: Internet
  • Be the first to comment

  • Be the first to like this

2017 02 apan

  1. 1. Big data changes science, radical transparency is necessary Delhi, 2017-02-17Johannes Keizer, GODAN Secretariat
  2. 2. • GODAN Secretariat Partnerships Lead • Before: Team Leader at FAO for open Access and open Science • Background: Research, Pesticide Chemistry Johannes Keizer, PhDTHE PRESENTER johannes.keizer@godan.info
  3. 3. http://www.godan.info GODAN advocates that important datasets in agriculture and nutrition should be considered global public goods and made be available to everyone
  4. 4. ●Doubling food production for feeding 9 billion ●Knowledge Economy ●Data Intensive Science ●Open Access ●Key words !!
  5. 5. “… research suggests that seven sectors alone could generate more than $3 trillion a year in additional value as a result of open data, which is already giving rise to hundreds of entrepreneurial businesses and helping established companies to segment markets …” Source: McKinsey Global Institute "Making these data public will allow people to make their own assessments of the progress of our Good Growth Plan. It is also blurring the traditional roles of business, government and NGOs by highlighting our collective responsibility to address acute global challenges. Above all, the data will be of value to farmers, enabling them to increase productivity sustainably and to enhance their livelihoods." "Open data has the power to solve our most challenging sustainability problems. … Agri- tech businesses have a big role to play in finding novel solutions to these problems. … Syngenta is taking a step that puts them at the forefront of the open data movement in their sector. We look forward to working with them to unlock benefits for farmers and consumers worldwide." Mike Mack, CEO of Syngenta (2015, for 1st GGP data release) Jeni Tennison, Deputy CEO and CTO of the Open Data Institute There is Hype
  6. 6. Internet usage: 40% of global population – 2.26 billion Developing countries: from 0-30% in 16 years On linear trend, 100% in just 22 years. Goal of UN to have 50% by 2015. Achieved 34% Philippines ranked above US in 2015 A game changer?
  7. 7. Daunting challenges - impressive opportunities: • The life science revolution is changing our understanding of the fundamental biology of plants, animals and people. It is transforming agriculture. • Information revolution approaches are critically transforming the retail end of food value chains- radical transparency.
  8. 8. New tools allow us to look in new places for sources of variation – including wildlife Comparative gene network and sequence analysis allows to ask new kinds of questions about genomes – eg “what is different about this (group of) species compared to all other mammals” “traditional” linkage mapping requires crosses – so initial discovery is limited to variants within a species Cow NDama KFITRRPSLKTLQEKGLIKDQIFGSPLHTLCEREKSTVPRFVKQCIEAVEK Cow Boran KFITRRPSLKTLQEKGLIKDQIFGSHLHTLCEREKSTVPRFVKQCIEAVEK Human KFISRRPSLKTLQEKGLIKDQIFGSHLHTVCEREHSTVPWFVKQCIEAVEK Pig KFITRRPSLKTLQEKGLIKDQIFGSHLHTVCERENSTVPRFVKQCIEAVEK Chicken KFISRRPSLKTLQEKGLIKDQIFGSHLHLVCEHENSTVPQFVRQCIKAVER Salmon KFISRRPSMKTLQEKGIIKDRVFGCHLLALCEREGTTVPKFVRQCVEAVEK
  9. 9. Data against death • Discovering patterns of gene expression during aging • Craig Venter and others sift through genomic data on a vast scale • Matching genetic expression with physiologica patterns
  10. 10. Sequencing machines + Gene editing + Big data analysis Drones &satellites + AI picture processing + Big data analysis Revolutionary processes, examples
  11. 11. Paradigm Shift for research • In the past – 80% data production, 20% data evaluation • In the future – 20% data production, 80% data evaluation
  12. 12. If networked science is to reach its potential, scientists will have to embrace and reward the open sharing of all forms of scientific knowledge, not just traditional journal publication. Networked science must be open science.’ Michael Nielsen (OKI)
  13. 13. WHAT DOES OPEN DATA MEAN?
  14. 14. The FAIRprinciple In 2016 endorsed by the G20 Summit in Hangzhou
  15. 15. THE FAIR PRINCIPLE resources need to be Findable Accessible Interoperable Reusable = FAIR FAIR principle by Barend Mons, EC, EOSC
  16. 16. Data Issues http://www.nature.com/ng/journal/v43/n4/full/ng0411-281.html
  17. 17. Challenges • “Open data is good only for the big players” • “Open data will create more data monopolies and divides” • “This research data is only meaningful in specific context [and only I understand that…]” • “Somebody has to pay!”
  18. 18. What is GODAN • Advocacy • Think Tank • Knowledge Network
  19. 19. GODAN addresses Issues through working groups • i.e. data rights and responsibilities • i.e. data infrastructure • i.e. better technical, semantic and legal interoperability • i.e data gaps in nutrition
  20. 20. “I went through this Responsible Data in Agriculture brochure that’s online and it strikes me how much it applies, in concrete terms, to the data revolution that is part and parcel of the 2030 agenda for sustainable development.” Thomas Gass, UN-DESA
  21. 21. 450 partners 16. february 8 Donors in the GODAN steering group
  22. 22. Our network
  23. 23. We want APAN to support GODAN!
  24. 24. It is worthwhile to become GODAN partner !!!!! We have to be thousands to make enough pressure on opening data! (list to be revised) ● Participate to discuss and resolve open questions ● Learn from successes (and failures of others) ● Bring your issues to the broader community ● Become a GODAN champion and influence the community ● Use the GODAN context to find new Grants for open data
  25. 25. Join GODAN! ● Sign up means you agree to our principles in our Statement of Purpose http://www.godan.info/about/statement-of- purpose/ ● Easy to complete forms online http://www.godan.info/partners/become-a- godan-partner/ ● Talk to us about how you can get involved in our events, publications and working groups
  26. 26. www.godan.info

×