IDX: KLBFwww.kalbe.co.idLAPORAN TAHUNAN 2012 ANNUAL REPORTLEBIH DEKAT DENGAN ANDACLOSER TO YOU
Profil PerusahaanCompany Profile30 Informasi PerseroanCorporate Information32 Sekilas KALBE FARMAKALBE FARMA at a Glance34...
Tata Kelola PerusahaanCorporate Governance168Analisis dan Diskusi ManajemenManagement Discussion and Analysis6870 Tinjauan...
PT Kalbe Farma Tbk. • Laporan Tahunan 20122Performance HighlightsManagement ReportCompany ProfileManagement Discussion and...
PT Kalbe Farma Tbk. • 2012 Annual Report 3Lebih Dekat dengan AndaDari tahun ke tahun, Kalbe telah membangun reputasi sebag...
PT Kalbe Farma Tbk. • Laporan Tahunan 20124Performance HighlightsManagement ReportCompany ProfileManagement Discussion and...
PT Kalbe Farma Tbk. • 2012 Annual Report 5Memperluas dan Memperdalam Penetrasi PasarWidening and Deepening Market Penetrat...
PT Kalbe Farma Tbk. • Laporan Tahunan 20126Performance HighlightsManagement ReportCompany ProfileManagement Discussion and...
PT Kalbe Farma Tbk. • 2012 Annual Report 7Penjualan Bersih Divisi Obat ResepPrescription Pharmaceuticals Division Net Sale...
PT Kalbe Farma Tbk. • Laporan Tahunan 20128Performance HighlightsManagement ReportCompany ProfileManagement Discussion and...
PT Kalbe Farma Tbk. • 2012 Annual Report 97,8779,08710,22710,91213,6362008 2009 2010 2011 2012Penjualan Bersih (Rp miliar)...
PT Kalbe Farma Tbk. • Laporan Tahunan 201210Performance HighlightsManagement ReportCompany ProfileManagement Discussion an...
PT Kalbe Farma Tbk. • 2012 Annual Report 11Kinerja Saham Tahun 2012				Stock Performance 2012				BulanTertinggiHighest (Rp...
Performance HighlightsManagement ReportCompany ProfileManagement Discussion and AnalysisCorporate GovernanceCorporate Soci...
PT Kalbe Farma Tbk. • 2012 Annual Report 13Yang Terhormat Para Pemegang Saham,Menengok ke belakang, tahun 2012 merupakan t...
Performance HighlightsManagement ReportCompany ProfileManagement Discussion and AnalysisCorporate GovernanceCorporate Soci...
PT Kalbe Farma Tbk. • 2012 Annual Report 15Guna mengantisipasi pertumbuhan usaha di masa mendatang,makin tumbuhnya permint...
Performance HighlightsManagement ReportCompany ProfileManagement Discussion and AnalysisCorporate GovernanceCorporate Soci...
PT Kalbe Farma Tbk. • 2012 Annual Report 17Tata Kelola Perusahaan dan Kegiatan DewanKomisarisSelain meraih kinerja keuanga...
Performance HighlightsManagement ReportCompany ProfileManagement Discussion and AnalysisCorporate GovernanceCorporate Soci...
PT Kalbe Farma Tbk. • 2012 Annual Report 19Wahjudi PrakarsaKomisaris IndependenIndependent CommissionerFerdinand AryantoKo...
Performance HighlightsManagement ReportCompany ProfileManagement Discussion and AnalysisCorporate GovernanceCorporate Soci...
PT Kalbe Farma Tbk. • 2012 Annual Report 21Pemegang Saham Yang Terhormat,Puji syukur dan ucapan terima kasih kami haturkan...
Performance HighlightsManagement ReportCompany ProfileManagement Discussion and AnalysisCorporate GovernanceCorporate Soci...
PT Kalbe Farma Tbk. • 2012 Annual Report 23pelaksanaan jaminan kesehatan nasional pada tahun 2014. Kamimendukung keputusan...
Performance HighlightsManagement ReportCompany ProfileManagement Discussion and AnalysisCorporate GovernanceCorporate Soci...
PT Kalbe Farma Tbk. • 2012 Annual Report 25ke 3 dan ke 2, serta terus menjaring kepesertaan dari pemimpin-pemimpin masa de...
Performance HighlightsManagement ReportCompany ProfileManagement Discussion and AnalysisCorporate GovernanceCorporate Soci...
PT Kalbe Farma Tbk. • 2012 Annual Report 27Minuman, Minuman Energi untuk Extra Joss dari MarkPlus Inc.,Reader’s Choice Awa...
Performance HighlightsManagement ReportCompany ProfileManagement Discussion and AnalysisCorporate GovernanceCorporate Soci...
PT Kalbe Farma Tbk. • 2012 Annual Report 29Bernadette Ruth Irawati SetiadyPresiden DirekturPresident DirectorBudi Dharma W...
Performance HighlightsManagement ReportCompany ProfileManagement Discussion and AnalysisCorporate GovernanceCorporate Soci...
PT Kalbe Farma Tbk. • 2012 Annual Report 31Nama dan Alamat Lembaga dan/atau Profesi Penunjang Pasar ModalNames and Address...
Performance HighlightsManagement ReportCompany ProfileManagement Discussion and AnalysisCorporate GovernanceCorporate Soci...
PT Kalbe Farma Tbk. • 2012 Annual Report 33Di Indonesia, Kalbe mampu menjangkau 70% dokter umum, 90%dokter spesialis, 100%...
Performance HighlightsManagement ReportCompany ProfileManagement Discussion and AnalysisCorporate GovernanceCorporate Soci...
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
KALBE Annual Report 2012
Upcoming SlideShare
Loading in …5
×

KALBE Annual Report 2012

12,889 views

Published on

KALBE Annual Report 2012

Published in: Investor Relations
0 Comments
3 Likes
Statistics
Notes
  • Be the first to comment

No Downloads
Views
Total views
12,889
On SlideShare
0
From Embeds
0
Number of Embeds
7
Actions
Shares
0
Downloads
313
Comments
0
Likes
3
Embeds 0
No embeds

No notes for slide

KALBE Annual Report 2012

  1. 1. IDX: KLBFwww.kalbe.co.idLAPORAN TAHUNAN 2012 ANNUAL REPORTLEBIH DEKAT DENGAN ANDACLOSER TO YOU
  2. 2. Profil PerusahaanCompany Profile30 Informasi PerseroanCorporate Information32 Sekilas KALBE FARMAKALBE FARMA at a Glance34 Divisi UsahaBusiness Divisions36 Struktur OrganisasiOrganization Structure37 Struktur Kepemilikan Perseroandan Entitas AnakShareholding Structure of the Companyand Subsidiaries38 Visi, Misi, Moto dan NilaiVission, Mission, Motto and Values40 Profil Dewan KomisarisBoard of Commissioners Profile43 Profil DireksiBoard of Directors Profile46 Profil Komite AuditAudit Committee Profile47 Profil Komite NominasiNomination Committee Profile48 Profil Komite RemunerasiRemuneration Committee Profile49 Profil Komite Risiko UsahaBusiness Risk Committee Profile50 Profil Komite GCGGCG Committee Profile51 Profil Kepala Unit Audit InternalHead of Internal Audit Unit Profile51 Profil Sekretaris PerusahaanCorporate Secretary Profile52 Informasi Pemegang SahamShareholders Information56 Entitas AnakSubsidiaries58 Daftar PrinsipalPrincipals List60 Prestasi dan PenghargaanRecognition and Awards62 Jejak LangkahMilestones64 Peristiwa Penting 2012Event Highlights 201230Daftar IsiContents4 Strategi 20122012 Strategy6 Kinerja 20122012 Performance8 Ikhtisar KeuanganFinancial Highlights10 Ikhtisar SahamStock Highlights12 Laporan Dewan KomisarisReport from the Board ofCommissioners20 Laporan DireksiReport from the Board of Directors68Analisis dan Diskusi ManajemenManagement Discussion and Analysis228Tanggung Jawab SosialPerusahaanCorporate SocialResponsibilityTanggung Jawab Pelaporan TahunanResponsibility for Annual Reporting246
  3. 3. Tata Kelola PerusahaanCorporate Governance168Analisis dan Diskusi ManajemenManagement Discussion and Analysis6870 Tinjauan IndustriIndustrial Review76 Tinjauan UsahaBusiness Review76 Portofolio Bisnis yang Disempurnakan Enhanced Business Portfolio80 Divisi Obat Resep Prescription Pharmaceuticals Division86 Divisi Produk Kesehatan Consumer Health Division92 Divisi Nutrisi Nutritionals Division96 Divisi Distribusi & Logistik Distribution & Logistics Division104 Tinjauan OperasionalOperational Review104 Riset dan Pengembangan Research and Development110 Pengelolaan Rantai Pasokan Supply Chain Management114 Sumber Daya Manusia Human ResourcesTata Kelola PerusahaanCorporate GovernanceReferensi Peraturan Bapepam-LK No.X.K.6Bapepam-LK Regulation No.X.K.6 Cross Reference168126 Teknologi Informasi Information Technology130 Pemasaran Marketing136 Tinjauan KeuanganFinancial Review136 Kinerja Keuangan di Tahun 2012 Financial Performance in 2012144 Laporan Posisi Keuangan Konsolidasian Consolidated Statements of FinancialPosition149 Likuiditas dan Struktur Permodalan Liquidity and Capital Structure150 Laporan Arus Kas Konsolidasian Consolidated Statements of Cash Flows151 Pemasaran Marketing152 Produksi Production152 Investasi Barang Modal Capital Expenditure153 Ikatan Material untuk Investasi BarangModal Material Ties for Investment of CapitalGoods Investment153 Kebijakan Dividen Dividend Policy153 Realisasi Penggunaan Dana HasilPenawaran Umum Usage of Proceeds from Rights Issue154 Transaksi Material dan Kejadian LuarBiasa Material Transactions and ExtraordinaryEvents154 Transaksi yang Mengandung BenturanKepentingan Material Transactions Containing Conflictof Interest154 Kejadian Setelah Tanggal Neraca Subsequent Event154 Perubahan Peraturan Perundang-undangan Changes in Laws and Regulations156 Perubahan Kebijakan Akuntansi Changes in Accounting Policies170 Prinsip dan Komitmen Terhadap TataKelola Perusahaan yang Baik (GCG)Principles and Commitment to GoodCorporate Governance (GCG)172 Inisiatif Peningkatan Praktik GCGSelama 2012GCG Practice Improvement Initiatives in2012173 Mekanisme GCGGCG Mechanism174 Rapat Umum Pemegang SahamGeneral Meeting of Shareholders180 Dewan KomisarisBoard of Commissioners185 DireksiBoard of Directors191 Komite-KomiteCommittees199 Audit Internal danPengendalian InternalInternal Audit and Internal Control204 Audit EksternalExternal Audit205 Manajemen RisikoRisk Management209 Aksi KorporasiCorporate Actions209 Sekretaris PerusahaanCorporate Secretary212 Hubungan InvestorInvestor Relations214 Akses Informasi dan Data PerseroanAccess to Corporate Information and Data215 Opsi SahamShare Option215 Perkara LitigasiLitigation217 Benturan KepentinganConflict of Interest217 Pemberian Dana untuk Kegiatan Politikdan SosialFunding for Political and Social Activities217 Komitmen pada KonsumenCommitment to Consumers218 Etika dan Sosialisasi Etika PerusahaanEthics and Socialization of the Company’sEthics219 Whistleblowing SystemWhistleblowing System221 Pengembangan GCG di Tahun 2013GCG Development in the Year 2013Laporan Keuangan KonsolidasiConsolidated Financial Statements249
  4. 4. PT Kalbe Farma Tbk. • Laporan Tahunan 20122Performance HighlightsManagement ReportCompany ProfileManagement Discussion and AnalysisCorporate GovernanceCorporate Social ResponsibilityCloser to YouOver the years, Kalbe has built a reputation forits innovative culture and dedication to highquality and well-trusted healthcare products.Our product range has grown significantly, frompharmaceuticals, nutritions, to health foodsand beverages, medical devices and healthcareservices.OuroperationnetworkservestheentireIndonesian’s archipelago, with well establishedpresence in Southeast Asia and several Africancountries.In line with our mission of improving health fora better life, we continuously touch the lives ofour consumers, everyday as they walk the pathof their lives.3,000700Morinaga DuniaGenerasi PlatinumEventsZee ComputerCompetitionSeminar “How toLive with Cancer”Hydro CocoFun Bike!Participantsin 40 CitiesParticipantsin 11 Major CitiesParticipantsin 6 Major CitiesParticipants200,000 110,000
  5. 5. PT Kalbe Farma Tbk. • 2012 Annual Report 3Lebih Dekat dengan AndaDari tahun ke tahun, Kalbe telah membangun reputasi sebagaiperusahaan yang inovatif, serta berdedikasi pada produk-produkkesehatan berkualitas dan terpercaya. Ragam produk kami telahberkembang secara signifikan, dari produk obat-obatan, nutrisi,suplemen, hingga makanan dan minuman kesehatan, alat-alatkesehatan dan layanan kesehatan. Jaringan operasional kamimelayani seluruh kepulauan Indonesia, serta juga hadir di kawasanAsia Tenggara dan beberapa negara di Afrika.Sejalan dengan misi kami meningkatkan kesehatan untukkehidupan yang lebih baik, kami terus berupaya menyentuhkehidupan setiap individu, setiap hari, dan sepanjang hidupmereka.
  6. 6. PT Kalbe Farma Tbk. • Laporan Tahunan 20124Performance HighlightsManagement ReportCompany ProfileManagement Discussion and AnalysisCorporate GovernanceCorporate Social ResponsibilityMeningkatkan Efektivitas PemasaranIncreasing Marketing EffectivenessMeningkatkan efektivitas pemasaran dan penjualan, melaluibranding management, program pemasaran dan penjualan& distribusi yang terfokus dan terintegrasi sehingga dapatmemperluas ketersediaan dan visibility produk.Improving marketing and sales effectiveness, through brandingmanagement, focused and integrated marketing and selling &distribution to spread product availability and visibilityStrategi 20122012 StrategyMemperkuat Portofolio BisnisStrengthening Business PortfolioMemperkuat portofolio bisnis melalui inovasi dalampengembangan produk baru, business model baru danmerger & acquisitions.Strengthening its business portfolio, through innovation inproduct development, new business model and mergers &acquisitions.PT Kalbe Farma Tbk. • Laporan Tahunan 20124
  7. 7. PT Kalbe Farma Tbk. • 2012 Annual Report 5Memperluas dan Memperdalam Penetrasi PasarWidening and Deepening Market PenetrationMemperluas dan memperdalam penetrasi pasar melalui penunjukan 84 sub-distributor tambahan diIndonesia pada tahun 2012.Widening and deepening market penetration through appointment of 84 additional sub-distributors inIndonesia in 2012.PembelajaranTerus MenerusContinuous LearningMemastikan pelaksanaan yang primamelalui pembelajaran yang terus menerussehingga menghasilkan orang-orangKalbe yang kolaboratif, tegas, passionate,kompeten dan berjiwa Panca SradhaKalbe.Ensuring excellence in execution throughcontinuous learning to create Kalbepersonnel who are collaborative,assertive,passionate, competent and embody thespirit of Panca Sradha Kalbe.PePeKalimantanSulawesiJakartaSurabayaPapuaSumatraRDC JakartaRDC SurabayaCabang | BranchesSub-DistributorsPT Kalbe Farma Tbk. • 2012 Annual Report 5
  8. 8. PT Kalbe Farma Tbk. • Laporan Tahunan 20126Performance HighlightsManagement ReportCompany ProfileManagement Discussion and AnalysisCorporate GovernanceCorporate Social ResponsibilityPT Kalbe Farma Tbk. (“Kalbe” atau “Perseroan”) menutup tahun 2012 dengan kinerja yang positif,membukukan peningkatan penjualan bersih sebesar 25,0% mencapai Rp13.636 miliar di akhir tahun.Divisi Obat Resep meraih penjualan bersih sebesar Rp3.288 miliar, sedangkan Divisi Produk Kesehatan,Nutrisi serta Divisi Distribusi dan Logistik membukukan penjualan bersih masing-masing sebesar Rp2.149miliar, Rp3.012 miliar dan Rp5.188 miliar. Laba tahun berjalan tumbuh 17,0% dari Rp1.482 miliar di tahun2011 menjadi Rp1.734 miliar di tahun 2012, serta membukukan peningkatan nilai pemegang saham yangberkelanjutan dengan laba per saham dasar mencapai Rp37,0 tahun 2012 dari Rp31,7 di tahun sebelumnyasetelah memperhitungkan pengaruh pemecahan saham.Tahun 2012 juga tahun yang penuh pencapaian bagi Kalbe, seiring keberhasilan Perseroan dalammeningkatkan kapasitas produksi dan distribusinya melalui inisiatif organik maupun anorganik, dengan totalbelanja modal mencapai Rp783 miliar di akhir tahun. Kegiatan pemasaran langsung ke konsumen berhasilmenjaring partisipasi yang luas, dengan lebih dari 500.000 peserta di tahun 2012.Karyawan kami telah membuktikan semangat sosialnya dengan dukungan aktif pada program-programtanggung jawab sosial Kalbe dengan melibatkan sekitar 2.350 karyawan sebagai relawan selama tahun2012.Pencapaian tahun 2012 telah memperkuat posisi strategis Kalbe untuk memanfaatkan berbagai peluang diIndonesia serta mendukung upaya Perseroan untuk terus mengembangkan usahanya dalam membangunkehadirannya di pasar regional.PT Kalbe Farma Tbk. (“Kalbe” or “the Company”) closed 2012 with solid performance, booking a record netsales increase of 25.0% to Rp13,636 Billion by the end of the year. The Prescription Pharmaceuticals Divisionrecorded net sales of Rp3,288 billion, while Kalbe’s Consumer Health, Nutritionals as well as Distribution andLogistics Divisions delivered Rp2,149 billion, Rp3,012 billion and Rp5,188 billion net sales respectively. Incomefor the year grew by 17.0%, from Rp1,482 billion to Rp1,734 billion in 2012, generating steady enhancementsto shareholders’ value with earnings per share booked at Rp37.0 in 2012 from Rp31.7 a year earlier after takinginto account the effect of the Company’s stock split.Last year was also a remarkable year for Kalbe as the Company continued to increase its manufacturing anddistribution capacities through organic and inorganic initiatives, with total capital expenditure spending of Rp783billion during the year. Our direct-to-consumer activities have successfully attracted widespread participation,with over 500,000 participants in 2012.Last but not least, our employees have manifested a high degree of volunteerism by actively supporting Kalbe’ssocial responsibility programs, with roughly 2,350 employees participation as volunteers in 2012 alone.The set of performance delivered in 2012 puts Kalbe at a better strategic position to capture the abundance ofopportunities Indonesia has to offer, and allow the Company to continue expanding its horizon to build strongerpresence in the regional market.Kinerja 20122012 Performance
  9. 9. PT Kalbe Farma Tbk. • 2012 Annual Report 7Penjualan Bersih Divisi Obat ResepPrescription Pharmaceuticals Division Net SalesPenjualan Bersih Divisi Produk KesehatanConsumer Health Division Net SalesPenjualan Bersih Divisi NutrisiNutritionals Division Net SalesPenjualan Bersih Divisi Distribusi & LogistikDistribution & Logistics Division Net SalesTriliun TrillionTriliun TrillionTriliun TrillionTriliun TrillionPenjualan BersihNet SalesRp TriliunRp Trillion25.0%Pertumbuhan penjualanbersih di tahun 2012Net sales growth in 2012berpartisipasi dalam pemeriksaankesehatan gratis “SahabatPuskesmas” di 33 kota di Indonesiaparticipated in free health consultation“Sahabat Puskesmas” in 33 citiesacross Indonesiaambil bagian dalam kegiatan-kegiatan pemasaran langsung kepadakonsumenparticipated in Direct-to-Consumeractivities7.99.110.210.913.62008 2009 2010 2011 2012Aktivitas Pemasaran Langsung kepada KonsumenDirect-to-Consumer Marketing ActivitiesTanggung Jawab SosialCorporate Social Responsibilities18.4%16.7%24.5%34.0%2,350employeesover500,000participantsRp 3.29Rp 2.15Rp 3.01Rp 5.19
  10. 10. PT Kalbe Farma Tbk. • Laporan Tahunan 20128Performance HighlightsManagement ReportCompany ProfileManagement Discussion and AnalysisCorporate GovernanceCorporate Social ResponsibilityIkhtisar KeuanganFinancial HighlightsDalam jutaan Rupiah, kecuali dinyatakan lain 2012 2011 2010 2009 2008 In million of Rupiah, unless otherwise statedLaporan Laba Rugi KomprehensifKonsolidasianConsolidated Statements ofComprehensive IncomePenjualan Bersih 13,636,405 10,911,860 10,226,789 9,087,348 7,877,366 Net SalesLaba Kotor 6,533,434 5,551,173 5,166,386 4,511,940 3,803,640 Gross ProfitLaba Sebelum Beban Pajak 2,308,017 1,987,259 1,770,435 1,471,072 1,178,022 Income Before TaxLaba Tahun Berjalan 1,775,099 1,522,957 1,343,799 1,049,667 825,504 Income for the YearLaba Tahun Berjalan yang Dapat DiatribusikanKepada:Income for the Year Attributable to:Pemilik Entitas Induk 1,733,928 1,482,237 1,286,330 929,004 706,822 Equity Holders of the Parent CompanyKepentingan Non-pengendali 41,171 40,720 57,469 120,663 118,682 Non-controlling InterestLaba Komprehensif Tahun Berjalan* 1,772,035 1,539,721 1,346,098 n/a n/a Comprehensive Income for the Year*Laba Komprehensif Tahun Berjalan* yang DapatDiatribusikan Kepada:Comprehensive Income for the Year* Attributable to:Pemilik Entitas Induk 1,730,864 1,498,877 1,288,629 n/a n/a Equity Holders of the Parent CompanyKepentingan Non-pengendali 41,171 40,844 57,469 n/a n/a Non-controlling InterestRata-rata Tertimbang Jumlah Saham yang Beredar(dalam jutaan saham)46,875 9,375 9,374 9,577 9,755 Weighted Average Number of Shares Outstanding(in million of shares)Laba Bersih per Saham (Rp)** 37 158 137 97 72 Earnings per Share (Rp)*** Penyajian Laba Komprehensif Tahun Berjalan berdasarkan Pernyataan Standar Akuntansi (PSAK) No. 1 (Revisi 2009) yang mulai diterapkan tanggal 1 Januari 2011 Presentation of Comprehensive Income for the Year based on the Statement of Financial Acccounting Standards (PSAK) No. 1 (Revised 2009) adopted on January 1, 2011** Pemecahan nilai nominal saham pada bulan Oktober 2012 Stock split in October 2012Laporan Posisi KeuanganKonsolidasianConsolidated Statements of FinancialPositionJumlah Aset 9,417,957 8,274,554 7,032,497 6,482,447 5,703,832 Total AssetsInvestasi pada Entitas Asosiasi 48,951 53,708 48,429 37,404 -901 Investment in Associated EntitiesJumlah Aset Lancar 6,441,711 5,956,123 5,037,270 4,701,893 4,168,055 Current AssetsJumlah Liabilitas 2,046,314 1,758,619 1,260,361 1,691,512 1,358,990 Total LiabilitiesPinjaman 204,625 140,706 25,344 340,678 405,504 Total DebtsJumlah Liabilitas Lancar 1,891,618 1,630,589 1,146,489 1,574,137 1,250,372 Current LiabilitiesModal Kerja Bersih 4,550,093 4,325,535 3,890,781 3,127,756 2,917,683 Net Working CapitalJumlah Ekuitas* 7,371,643 6,515,935 5,771,917 4,790,672 3,622,399 Total Equity** Sesuai dengan PSAK No. 1 (Revisi 2009) yang mulai diterapkan tanggal 1 Januari 2011, Kepentingan Non-pengendali pada tanggal 31 Desember 2010 dan 2009 telah direklasifikasi sebagaibagian dari Ekuitas Based on PSAK No. 1 (Revised 2009) effective January 1, 2011, Non-controlling Interest as of December 31, 2010 and 2009 has been reclassified as part of the EquityRasio-rasio Keuangan (%) Financial Ratios (%)Marjin Laba Kotor 47.91 50.87 50.52 49.65 48.29 Gross Profit MarginMarjin Laba Bersih 12.72 13.58 12.58 10.22 8.97 Net Income MarginRasio Laba terhadap Aset 18.41 17.91 18.29 14.33 12.39 Return on AssetsRasio Laba terhadap Ekuitas 23.52 22.75 22.29 19.39 19.51 Return on EquityRasio Lancar 340.54 365.27 439.36 298.70 333.35 Current RatioRasio Pinjaman terhadap Aset 2.17 1.70 0.36 5.26 7.11 Debt to Assets RatioRasio Pinjaman terhadap Ekuitas 2.77 2.15 0.44 7.10 11.19 Debt to Equity RatioAngka-angka pada seluruh tabel dan grafik dalam Laporan Tahunan ini menggunakan notasi Bahasa InggrisNumerical notations in all tables and graphs in this Annual Report are in English
  11. 11. PT Kalbe Farma Tbk. • 2012 Annual Report 97,8779,08710,22710,91213,6362008 2009 2010 2011 2012Penjualan Bersih (Rp miliar)Net Sales (Rp billion)3,8044,5125,1665,5516,5332008 2009 2010 2011 2012Laba Kotor (Rp miliar)Gross Profit (Rp billion)19.5119.3922.29 22.7523.522008 2009 2010 2011 2012Rasio Laba terhadap Ekuitas (%)Return on Equity Ratio (%)7079291,2861,4821,7342008 2009 2010 2011 2012Laba Bersih (Rp miliar)Net Income (Rp billion)11.197.100.442.152.772008 2009 2010 2011 2012Rasio Pinjaman terhadap Ekuitas (%)Debt to Equity Ratio (%)141927322008 2009 2010 2011 2012Laba Bersih Per Saham (Rp)*Earnings Per Share (Rp)*37* Disesuaikan dengan jumlah lembar saham setelah pemecahan nilai nominal saham (stock split) pada tahun 2012.Adjusted to number of shares after stock split in 2012.
  12. 12. PT Kalbe Farma Tbk. • Laporan Tahunan 201210Performance HighlightsManagement ReportCompany ProfileManagement Discussion and AnalysisCorporate GovernanceCorporate Social ResponsibilityIkhtisar SahamStock HighlightsGrafik Harga Saham dalam 10 Tahun Terakhir* 10-year Historical Stock Price Chart*Kalbe di Bursa Efek Indonesia Kalbe on the Indonesia Stock ExchangeHarga Saham Stock Price (Rp) Volume Perdagangan Transaction Volume (Unit)Jan400,000,000 1,200350,000,000 1,050300,000,000 900250,000,000 750200,000,000 600150,000,000 450100,000,000 30050,000,000 1500 0Feb Mar Apr May Jun Jul Aug Sep Oct Nov DecPemecahan Nilai Nominal SahamPerseroan melakukan pemecahan nilai nominal saham denganrasio 1:5 dari Rp50 menjadi Rp10 pada tanggal 2 Oktober2012. Jumlah saham meningkat dari 10.156.014.422 menjadi50.780.072.110 setelah pemecahan nilai nominal saham.Stock SplitThe Company conducted a 1:5 stock split from Rp50 per share toRp10 per share in October 2012. The number of shares increasedfrom 10,156,014,422 to 50,780,072,110 adter the stock split.1,2001,00080060040020002003100 110198238 25280260650 6801,0602004 2005 2006 2007 2008 2009 2010 2011 2012Harga Saham Stock Price (Rp)* Disesuaikan dengan jumlah lembar saham setelah pemecahan nilai nominal saham (stock split) pada tahun 2012.Adjusted to number of shares after stock split in 2012.
  13. 13. PT Kalbe Farma Tbk. • 2012 Annual Report 11Kinerja Saham Tahun 2012 Stock Performance 2012 BulanTertinggiHighest (Rp)TerendahLowest (Rp)PenutupanClosing (Rp)Volume Rata-rata TransaksiAverage Trading VolumeMonthJanuari 730 675 705 26,900,119 JanuaryFebruari 720 680 700 39,684,881 FebruaryMaret 710 675 710 53,917,976 MarchApril 810 680 805 108,070,500 AprilMei 805 750 775 87,132,023 MayJuni 800 740 755 69,600,833 JuneJuli 780 735 765 72,197,500 JulyAgustus 800 750 775 64,228,158 AugustSeptember 940 780 940 64,931,500 SeptemberOktober 1,050 875 970 43,932,591 OctoberNovember 1,040 960 1,030 67,046,774 NovemberDesember 1,150 980 1,060 78,838,695 DecemberKronologis Pencatatan ObligasiChronological Bonds OverviewTanggal PenerbitanListing DateJumlah (Rp)Amount (Rp)Bunga / Jangka WaktuInterest / PeriodTanggal Jatuh TempoMaturity DateObligasi Kalbe Farma June 28, 2006 Rp300,000,000,000 13,625% p.a. / 3 years June 28, 2009 Kalbe Farma BondsHarga Saham, Volume Perdagangan dan Nilai Kapitalisasi Pasar per Triwulan 2011 - 2012 2011-2012 Quarterly Share Price, Trading Volume and Market Capitalization 2011 2012Q1 Q2 Q3 Q4 Q1 Q2 Q3 Q4Tertinggi (Rp) 680 745 745 720 730 810 940 1,150 Highest (Rp)Terendah (Rp) 490 645 530 595 675 680 735 875 Lowest (Rp)Penutupan (Rp) 680 675 650 680 710 755 940 1,060 Closing (Rp)Volume Rata-rataTransaksi Harian(saham)82,048,468 64,639,057 63,633,833 30,883,672 40,167,659 87,948,387 67,332,951 62,109,150 Average Daily TradingVolume (shares)Kapitalisasi Pasar(dalam jutaan rupiah)34,530,449 34,276,549 33,007,047 34,530,449 36,053,851 38,338,954 47,733,268 53,826,876 Market Capitalization(in million of Rupiah)Catatan | Note:Disesuaikan dengan dampak pemecahan nilai nominal saham (stock split) pada tahun 2012.Adjusted for the impact of stock split in 2012.
  14. 14. Performance HighlightsManagement ReportCompany ProfileManagement Discussion and AnalysisCorporate GovernanceCorporate Social ResponsibilityPT Kalbe Farma Tbk. • Laporan Tahunan 201212Laporan Dewan KomisarisReport from the Board of CommissionersJohannes SetijonoPresiden KomisarisPresident CommissionerPerformance HighlightsManagement ReportCompany ProfileManagement Discussion and AnalysisCorporate GovernanceCorporate Social ResponsibilityPT Kalbe Farma Tbk. • Laporan Tahunan 201212
  15. 15. PT Kalbe Farma Tbk. • 2012 Annual Report 13Yang Terhormat Para Pemegang Saham,Menengok ke belakang, tahun 2012 merupakan tahun penuhtantangan bagi ekonomi dunia, yang ditandai dengan masihberlanjutnyaperlambatanekonomi,terutamadiEropadanAmerikaSerikat. Di semester kedua tahun 2012, perlambatan ekonomidunia mulai mempengaruhi pertumbuhan di Cina dan India, duapasar negara berkembang terbesar dan pendorong pertumbuhanekonomi dunia, yang berakibat meningkatnya tekanan padaekspor komoditas Indonesia. Kekhawatiran penurunan eksporIndonesia, serta terus meningkatnya permintaan mata uang asinguntuk memenuhi kebutuhan impor, telah mendorong terjadinyapelemahan nilai Rupiah, yang mengalami depresiasi sebesar6,6% menjadi senilai Rp9.670 per 1 US$ di akhir tahun, dengandisertai dengan gejolak yang cukup berarti.Namun demikian, momentum pertumbuhan Indonesia terusberlanjut di tahun 2012, bukti ketangguhan dari ekonomidomestik. Indonesia menutup tahun 2012 dengan pertumbuhanekonomi sebesar 6,2%, sedikit lebih rendah dari pencapaiantahun sebelumnya sebesar 6,5%. Kinerja ini terutama didukungoleh terus meningkatnya permintaan domestik, rekor peningkataninvestasi baru dan pertumbuhan belanja pemerintah. Inflasidi tahun 2012 tetap terjaga di tingkat 4,3%, yang memberikandukungan positif untuk meraih kondisi makro ekonomi yangkondusif.Respected Shareholders,As we look back, 2012 was quite a challenging year for theglobal economy, marked with prolonged economy slowdown,particularly in Europe and the United States. During the secondterm of the year, we also experienced signs that the worldeconomic slowdown has dampened growth in China and India,two of the world’s largest emerging markets and growth drivers,which put increased pressure to Indonesia’s commodity exports.Concerns over Indonesia’s lower exports, coupled with ever-risingdemand for foreign exchange to finance import requirements,have triggered the weakening of Rupiah, which depreciated by6.6% to close at Rp9,670 per 1 US$ by the end of the year withsome notable volatility.However, Indonesia’s growth momentum continued in 2012,reflecting the resilience of the domestic economy. Indonesiaclosed the year with a growth rate of 6.2%, just slightly lower thanthe previous year’s figure of 6.5%. This performance was mainlyattributed to ongoing strong domestic demand, all-time highinflux of new investments and growth in government spending.Inflation in 2012 remained under control at 4.3%, providing furtherpositive support to the conducive macro environment.“Along with delivering strong financial results, theyear 2012 was marked with a set of capabilitybuilding initiatives to ensure Kalbe’s sustainablegrowth for the long term.”“Selain berhasil meraih kinerja keuanganyang solid, tahun 2012 juga ditandaidengan berbagai inisiatif peningkatankapabilitas untuk memastikankeberlanjutan pertumbuhan Kalbe dalamjangka panjang.”
  16. 16. Performance HighlightsManagement ReportCompany ProfileManagement Discussion and AnalysisCorporate GovernanceCorporate Social ResponsibilityPT Kalbe Farma Tbk. • Laporan Tahunan 201214Kami menilai bahwa kestabilan kondisi ekonomi domestik telahmenjadi landasan bagi kinerja yang menggembirakan di industrifarmasi dan produk konsumen kesehatan Indonesia tahun 2012.Pertumbuhan ekonomi Indonesia yang berkelanjutan dalambeberapa tahun terakhir telah menciptakan golongan ekonomikelas menengah yang besar dengan pendapatan yang terusmeningkat. Didukung peningkatan daya beli konsumen danmasih relatif rendahnya penetrasi sektor kesehatan, industri iniberhasil meraih pertumbuhan sebesar 15,9% di tahun 2012.Tingkat pertumbuhan ini diprediksi akan meningkat seiringrencana Pemerintah untuk melaksanakan jaminan kesehatannasional tahun 2014, yang diantisipasi secara positif oleh industrifarmasi. Kami percaya bahwa dengan adanya asuransi kesehatannasional, pelayanan kesehatan yang sangat dibutuhkan akandiperoleh masyarakat Indonesia secara lebih luas, terutama untukmereka yang berasal dari golongan ekonomi lemah.Namun demikian, kami mengamati terjadinya peningkatanvolatilitas kurs nilai tukar Rupiah pada tahun 2012. Gejolak nilaimata uang yang terjadi akhir-akhir in menjadi faktor yang perludiperhatikan dengan seksama, mengingat kondisi strukturalindustri farmasi yang masih tinggi tingkat ketergantungannyapada impor bahan baku.Evaluasi Kinerja 2012Didukung oleh kondisi ekonomi yang menguntungkan, Kalbeberhasil meraih kinerja yang menggembirakan di tahun 2012,dengan pertumbuhan penjualan sebesar 25,0% mencapaiRp13.636 miliar di akhir tahun. Laba bersih Setelah Pajakmeningkat menjadi Rp1.734 miliar, 17,0% lebih tinggi dibandingpencapaian tahun 2011 sebesar Rp1.482 miliar. Laba bersih persaham meningkat menjadi Rp37 dibandingkan Rp32 di tahunsebelumnya.Para pemegang saham telah menyetujui pembayaran dividensebesar Rp95 per saham, atau ekuivalen dengan total sebesarRp891 miliar untuk tahun buku 2011, yang telah dibayarkanpada tanggal 17 Juli 2012. Rapat Umum Pemegang Saham LuarBiasa di tahun 2012 juga telah menyetujui pemecahan saham1:5 dari Rp50 menjadi Rp10 per saham untuk meningkatkanpartisipasi investor ritel. Dividen untuk tahun buku 2012 akandiputuskan pada Rapat Umum Pemegang Saham Tahunan yangdiselenggarakan pada bulan Mei 2013.Selain berhasil meraih kinerja keuangan yang solid, tahun 2012juga ditandai dengan berbagai inisiatif peningkatan kapabilitasuntuk memastikan keberlanjutan pertumbuhan Kalbe dalamjangka panjang.We noted how the overall stable domestic economic environmentunderpinned a year of strong performance for Indonesia’spharmaceuticals and consumer health industry. Indonesia’scontinuous economic growth in recent years has created amassive middle income population with rising disposableincome. Backed by rising consumer purchasing power and thestill relatively low healthcare penetration, the industry registered a15.9 % y-o-y growth in 2012. This growth is expected to acceleratewith the Government’s plan to implement the mandated universalhealthcare by 2014, generating positive anticipation withinthe industry. We believe that through this national healthcareinsurance system, the much-needed healthcare service will bemade available for more Indonesians, especially those from thelower income group.Nevertheless, we observed the growing volatility of the Rupiahexchange rate in 2012. Recent exchange rate volatility is a factorthat needs to be closely monitored, given the structural conditionof the pharmaceuticals industry that still relies on import foralmost all of its raw materials.2012 Performance ReviewWith the favorable operating environment, Kalbe achieved a strongperformance in 2012, booking a record sales increase of 25.0%to Rp13,636 billion by the end of the year. Net profit after tax roseto Rp1,734 billion, which is 17.0% higher versus Rp1,482 billionachieved in 2011. Earnings per share grew to Rp37 compared toRp32 in the previous year.Shareholders had approved the payment of dividend of Rp95per share, or equivalent to Rp891 billion in total for financialyear 2011, which was paid on July 17, 2012. The ExtraordinaryGeneral Meeting of Shareholders held in 2012 has also approveda 1:5 stocksplit from Rp50 to Rp10 per share to encourage moreparticipation from retail investors. The dividend for financialyear 2012 will be determined at the Annual General Meeting ofShareholders in May 2013.Along with delivering strong financial results, the year 2012 wasmarked with a set of capability building initiatives to ensureKalbe’s sustainable growth for the long term.
  17. 17. PT Kalbe Farma Tbk. • 2012 Annual Report 15Guna mengantisipasi pertumbuhan usaha di masa mendatang,makin tumbuhnya permintaan dari masyarakat menengahIndonesia, serta pelaksanaan jaminan kesehatan nasional,manajemen telah meningkatkan nilai belanja modalnya menjadisebesar Rp783 miliar, jauh meningkat dari nilai di tahunsebelumnya sebesar Rp469 miliar.Direksi melanjutkan berbagai inisiatif untuk mempersiapkanKalbe dalam menyambut pelaksanaan asuransi kesehatan secaranasional pada tahun 2014. Belanja modal digunakan, antara lain,untuk meningkatkan kapasitas manufaktur melalui renovasi danpembangunan fasilitas baru, serta untuk memperluas jaringandistribusi Kalbe agar dapat menjangkau area pemasaran barudan meningkatkan ketersediaan produk di seluruh Indonesia.Fasilitasproduksibaru,yangkhususdibangununtukmemproduksiobat generik tanpa merek, telah mulai beroperasi di bulan Februari2012 sebagai persiapan untuk mengantisipasi pelaksanaansistem jaminan kesehatan nasional pada tahun 2014. Kami jugaberinisiatif memperkuat portofolio produk Kalbe melalui akuisisiPT Hale International, produsen minuman jus buah, serta aliansiuntuk membentuk PT Kalbe Milko Indonesia, untuk memproduksiproduk susu dalam bentuk cair.Sepanjang tahun 2012, Klinik Mitrasana, bidang usaha layanankesehatan Kalbe yang menawarkan layanan kesehatan satuatap, juga berhasil meraih kemajuan menggembirakan. Kamiterus melakukan penyempurnaan model bisnis agar dapatmemformulasikan produk dan layanan yang terbaik bagi segmentersebut. Mengingat besarnya peluang di sektor layanankesehatan, kami telah merencanakan untuk secara bertahapmemperkuat kehadiran Kalbe di pasar ini.Kegiatan penelitian dan pengembangan selalu menjadi bagiandari keunggulan Kalbe, mengingat kegiatan penelitian adalahfaktor penentu agar dapat bersaing di industri farmasi yangberbasis pengetahuan serta juga di sektor produk konsumenyang cepat berubah. Inovasi terus menjadi faktor pendorongyang mendukung pertumbuhan yang berkelanjutan.Di bidang produk kesehatan dan nutrisi, perluasan portofolioproduk dilaksanakan melalui pengembangan produk secaraorganik dan peluncuran produk yang dilaksanakan secaraseksama, guna menciptakan nilai tambah berupa manfaatkesehatan dan kenyamanan bagi konsumen. Di sektor obat resep,kami terus didukung oleh tim penelitian dan pengembangan yangberjumlah lebih dari 100 staf, untuk mengeksekusi strategi Kalbemenjadi perusahaan farmasi pertama yang meluncurkan versigenerik dari produk-produk yang habis masa patennya. Kami jugaterus membangun kompetensi di bidang kegiatan riset mutakhirTo anticipate future business growth, strong demand fromIndonesia’s growing middle class as well as the universalhealthcare implementation, management has raised its capitalexpenditure spending to Rp783 billion, a significant increase fromRp469 billion a year earlier.The Board of Directors continued the initiatives to prepare Kalbe towelcome the implementation of the national healthcare insurancesystem in 2014. Investment spending was used, among others,to raise manufacturing capacity by upgrading and adding newplants, as well as to expand Kalbe’s distribution network thatwill allow the Company to reach new market areas and improveproduct availability across the country.Our new production facility, dedicated for unbranded genericdrugs, has commenced operation in February 2012, providing uswith a considerable headway in the preparation of the nationalhealthcare insurance system roll-out in 2014. We took theinitiatives to strengthen our product portfolio with the acquisitionof PT Hale International, a fruit juice producer, and a joint ventureto establish PT Kalbe Milko Indonesia, set to introduce milk-based beverages in liquid format.The year 2012 also saw encouraging development in Kalbe’sretail health service venture, Mitrasana Clinics, an integratedclinic network providing healthcare service. We continued tofine tune the business model in the hope to formulate the bestproduct and service offering for the targeted segment. Given thehuge opportunity in the health service market, plans are alreadyin place to gradually develop the Company’s presence in thissector.Research and development activities have always been part ofKalbe’s leading edge, a key element to win in this knowledge-intensive pharmaceutical industry, and just as well in the fast-changing consumer sector. Innovation continued to be the maindriving force to support continuous growth.In the consumer health and nutritionals, product portfolioexpansion is conducted through organic product developmentand diligent product launching to always create value addedfor customers in terms of health benefits and convenience. Inthe prescription pharmaceuticals, we continue to rely on ourmore than 100-staff strong research and development team,to implement our strategy to become the first pharmaceuticalscompany to formulate the generic version of products enteringpatent expiration. We also strive to build our competence in moreadvanced research activities as an initiative to prepare for future
  18. 18. Performance HighlightsManagement ReportCompany ProfileManagement Discussion and AnalysisCorporate GovernanceCorporate Social ResponsibilityPT Kalbe Farma Tbk. • Laporan Tahunan 201216sebagai bagian perseiapan untuk terapi masa depan. Melaluifokus pada kegiatan penelitian bioteknologi yang mutakhir,Perseroan terus mengembangkan produk-produk inovatif sertamenawarkan nilai tambah bagi konsumen. Pada tahun 2012,melalui salah satu anak perusahaan, Innogene Kalbiotech Pte.Ltd. (Innogene), Kalbe berhasil meraih penghargaan sebagai theFastest Growing Home Grown Company for Oncology Care dariFrost & Sullivan Asia Pacific, sebuah pengakuan internasionalatas upaya terus menerus kami untuk membangun hidup yanglebih baik.Pengembangan sumber daya manusia ditetapkan sebagaisalah satu prioritas penting oleh Direksi, suatu bukti bahwabagi Kalbe, sumber daya manusia adalah asetnya yang palingutama. Investasi pelatihan dan pengembangan terus berlanjut,bekerjasama dengan berbagai institusi pendidikan terkemuka,untuk menumbuhkan pemimpin-pemimpin masa depan Kalbe.Selain itu, Direksi telah bekerja keras untuk menanamkan nilai-nilai Panca Sradha Kalbe di seluruh organisasi, guna memastikankepatuhan pada standar etika profesional yang tertinggi olehseluruh jajaran karyawan Perseroan.Akhirnya, inisiatif usaha Kalbe di pasar internasional terus meraihhasil positif, terutama dengan memfokuskan pada potensi ekspordi pasar Asia Tenggara dan Afrika. Ke depan, kinerja yang telahdicapai akan menjadi landasan bagi cita-cita Kalbe untuk menjadiperusahaan kesehatan Indonesia terkemuka dengan kinerjausaha yang solid di pasar regional.Secara keseluruhan, Dewan Komisaris menyetujui danmendukung strategi yang ditempuh Direksi untuk mencapaipertumbuhan penjualan yang berkelanjutan baik secara organikmaupun anorganik. Kami mendukung inisiatif manajemen untukmengembangkan portofolio produk melalui peluncuran danpengembangan produk yang menawarkan manfaat kesehatandan kemudahan bagi konsumen.Pencapaian di tahun 2012 merupakan bukti keunggulan strategijangka panjang Kalbe, kemampuan eksekusi yang fokus danpenuh disiplin, serta keunggulan kepemimpinan dan kontribusiDireksi dan seluruh karyawan untuk mendorong Kalbe ke tingkatyang lebih tinggi. Dewan Komisaris berpendapat bahwa jajaranmanajemen telah berhasil meraih kinerja keseluruhan yang positifsejalan dengan inisiatif dan target strategis yang telah ditetapkanuntuk tahun 2012.therapy. With a focus on state-of-the-art biotechnology research,the Company continued to develop innovative products andcreate added value for the consumers. In 2012, through one of itssubsidiaries, Innogene Kalbiotech Pte. Ltd. (Innogene), Kalbe wasrecognized as the Fastest Growing Home Grown Company forOncology Care from Frost & Sullivan Asia Pacific, an internationalrecognition to our persistent scientific pursuit to build a betterlife.Human capital development is considered as one of the Boardof Directors’ top priorities, a clear testament of our recognitionthat people are Kalbe’s most important asset. Training anddevelopment investments continue in partnership with prominenteducation institutions to nurture Kalbe’s future leaders. Moreimportantly, the Board of Directors has put a lot of work to establishorganization-wide adoption of Panca Sradha Kalbe values,ensuring adherence to the highest standards of professionalethics by the entire workforce.Finally, Kalbe’s endeavor in the international market continuedto book positive results, targeting in particular export potentialsin Southeast Asia and Africa markets. Going forward, theperformance delivered will pave the way for Kalbe’s aspirationto become Indonesia’s premier healthcare company with strongbusiness presence in the regional market.Overall, the Board of Commissioners commend and support theBoard of Directors’ strategies to sustain revenue growth throughorganic and inorganic ways. We support the management’sinitiatives to expand product portfolio through diligent productlaunching and improvements to provide health benefits andconvenience to consumers.The achievements delivered in 2012, clearly confirm therobustness of Kalbe’s long-term strategy, our focused anddisciplined execution, as well as the leadership and contributionsof the Board of Directors and employees in advancing the standingof the Company to a new, higher level. It is to the opinion of theBoard of Commissioners that management has successfullydelivered an overall strong performance against the strategicinitiatives and targets set for 2012.
  19. 19. PT Kalbe Farma Tbk. • 2012 Annual Report 17Tata Kelola Perusahaan dan Kegiatan DewanKomisarisSelain meraih kinerja keuangan dan pelaksanaan strategi untukpertumbuhan yang berkelanjutan, kami senantiasa memberikanperhatian pada aspek tata kelola perusahaan guna menjamintercapainya penciptaan nilai tambah yang berkelanjutan.Dewan Komisaris aktif terlibat dalam implementasi tata kelolaperusahaan. Melalui rapat-rapat Dewan Komisaris dan Komite,kami memastikan bahwa Perseroan mematuhi standar tertinggidi bidang kepatuhan, transparansi, akuntabilitas dan etikaprofesional.Di tahun 2012, Komite Audit telah secara resmi menerbitkanPiagam Komite Audit sesuai dengan ketentuan Bapepam-LK. Ditahun yang sama, Komite Audit juga menyelenggarakan rapat-rapat rutin dengan Unit Audit Internal guna mengawasi danmengevaluasi mekanisme kontrol internal Perseroan. Secaraperiodik, Komite Nominasi dan Komite Remunerasi melakukanpenelaahan dan penyempurnaan atas kebijakan nominasi danremunerasi Kalbe, untuk memastikan tercapainya keselarasandengan kebutuhan usaha Kalbe serta perkembangan terakhirdi industri farmasi. Komite Risiko Usaha bertanggung jawabmenangani risiko-risiko Perseroan dan memastikan tersedianyalandasan manajemen risiko yang solid. Akhirnya, Komite GCGterus memfokuskan pada pengawasan pelaksanaan tata kelolaperusahaan yang baik di seluruh organisasi.Total, sebanyak 4 rapat Dewan Komisaris dan 14 rapat komitetelah diselenggarakan di tahun 2012, frekuensi rapat yang cukupbagi kami untuk melakukan pengawasan menyeluruh atas kinerjaKalbe dan jajaran manajemennya. Laporan lengkap kegiatanDewan Komisaris dan Komite diuraikan lebih lanjut di bagian tatakelola perusahaan di dalam laporan tahunan ini.Perubahan ManajemenDi tahun 2012, Bapak Johanes Berchman Apik Ibrahim telahmengundurkan diri dari jabatannya sebagai Wakil PresidenDirektur Perseroan. Mewakili jajaran Dewan Komisaris, sayasampaikan ucapan terima kasih kepada Bapak JohanesBerchman Apik Ibrahim atas berbagai sumbangan pentingnyabagi Perseroan selama masa tugasnya.Terdapat beberapa perubahan pada susunan anggota Komite-komite di bawah Dewan Komisaris. Di akhir tahun 2012, KomiteNominasi dan Komite Remunerasi beranggotakan BapakJohannes Setijono sebagai ketua dan Ibu Bernadette Ruth IrawatiSetiady sebagai anggota Komite. Selain itu, susunan anggotaKomite Risiko Usaha kini terdiri atas Bapak Johannes Setijonosebagai ketua, serta Bapak Budi Dharma Wreksoatmodjo danBapak Vidjongtius sebagai angota Komite. Komite GCG kinidiketuai oleh Bapak Vidjongtius, dengan Bapak Johannes Setijonodan Bapak Budi Dharma Wreksoatmodjo sebagai penasihat.Corporate Governance and Board ofCommissioners ActivitiesIn addition to delivering financial strength and a sound strategyto maintain a steady growth, we continue to place a strongemphasis on good corporate governance to ensure sustainablevalue creation.The Board of Commissioners actively participate in theimplementation of good corporate governance. ThroughBoard and Committee meetings, we ensure that the Companyadheres to the highest standards of compliance, transparency,accountability and professional ethics.During the year, the Audit Committee has formally issued its AuditCommittee Charter in compliance with Bapepam-LK regulation.In 2012, the Committee also held regular meetings with theCompany’s Internal Audit Unit to monitor and evaluate Kalbe’sinternal control mechanism. The Nomination Committee andRemuneration Committee periodically review and revise Kalbe’snomination and remuneration policies to ensure alignment withKalbe’s business requirements and latest development in thepharmaceutical industry. Kalbe’s Business Risk Committee is incharge of addressing the Company’s risks and ensuring a properrisk management platform is in place within the Company. Finally,the GCG Committee continues to focus on overseeing GCGimplementation within the entire organization.A total of 4 Board of Commissioners’ meetings and 14 committeemeetings were held during 2012, a frequency that allows us toconduct thorough examination of the performance of Kalbe andits management team. A full account of the work of the Board andCommittees are fully described in the good corporate governancesection of this annual report.Board ChangesIn 2012, Johanes Berchman Apik Ibrahim has retired from hisposition as the Company’s Vice President Director. On behalf ofthe Board of Commissioners, I wish to thank Johanes BerchmanApik Ibrahim for his invaluable contribution to the Companyduring his tenure.There were also a few changes in the composition of the Boardof Commissioners’ Committees. By end of 2012, the NominationCommittee and Remuneration Committee comprise of JohannesSetijono as chairman and Bernadette Ruth Irawati Setiadyas member of the Committee. Meanwhile, the Business RiskCommittee now comprise of Johannes Setijono as chairman,with Budi Dharma Wreksoatmodjo and Vidjongtius as committeemembers. The GCG Committee is now led by Vidjongtius,with Johannes Setijono and Budi Dharma Wreksoatmodjo asadvisors.
  20. 20. Performance HighlightsManagement ReportCompany ProfileManagement Discussion and AnalysisCorporate GovernanceCorporate Social ResponsibilityPT Kalbe Farma Tbk. • Laporan Tahunan 201218Johannes SetijonoPresiden Komisaris President CommissionerPandangan ke DepanKondisi makro ekonomi Indonesia yang positif diproyeksikanakan terus berlanjut di tahun 2013. Kondisi ekonomi dunia akanmembaik, di mana Cina dan Amerika Serikat telah memberikantanda-tandapemulihanyangpositif,dandapatmenjadipendukungpenting bagi kegiatan ekonomi global. Ke depan, prospek sektorkesehatan tetap sangat menjanjikan, terutama mengingat masihrendahnya tingkat pengeluaran untuk kebutuhan kesehatan diIndonesia.Dewan Komisaris telah melakukan penelaahan atas rencana usahaKalbe tahun 2013 yang diajukan oleh pihak manajemen. DewanKomisaris berpendapat, bahwa target-target pertumbuhan telahsejalan dengan prospek industri serta cita-cita Kalbe untuk terustumbuh dan mengembangkan pangsa pasarnya. Kami meyakinibahwa Direksi dapat kembali meraih kinerja yang positif di tahun-tahun mendatang.PenutupMewakili Dewan Komisaris, saya ingin menyampaikan ucapanterima kasih kepada seluruh pemangku kepentingan ataskerjasama dan kepercayaannya kepada kami. Kami jugasampaikan penghargaan kepada jajaran manajemen dan seluruhkaryawan, yang telah menunjukan dedikasinya kepada misi danvisi Perseroan. Penghargaan setinggi-tingginya kami sampaikankepada para konsumen setia kami, yang terus memberikankepercayaan kepada Kalbe. Bersama, kami berharap dapat terusmembangun hidup yang lebih baik.OutlookIndonesia’s positive operating environment is expected tocontinue in 2013. The global economy is definitely improving withChina and the U.S. showing encouraging recovery, giving someimportant support to global economic activity. In the long run,the outlook for the healthcare sector is very promising, especiallygiven the still relatively low healthcare spending in Indonesia.The Board of Commissioners has reviewed Kalbe’s businessplans for 2013 as formulated by management. In our opinion, thegrowth targets represent a fair indication of both the prospectsin the industry as well as our aspirations to grow and expand ourmarket share, and we are confident of the ability of the Directorsin achieving another excellent year going forward.ClosingOn behalf of the Board of Commissioners, I would like to thank allour stakeholders for their cooperation and confidence in us. Weapplaud the management and our employees who have showntremendous dedication to our mission and vision. But moreimportantly we recognize our loyal customers who continue toput their trust in Kalbe. Together, we hope to continue making adifference in building a better life.
  21. 21. PT Kalbe Farma Tbk. • 2012 Annual Report 19Wahjudi PrakarsaKomisaris IndependenIndependent CommissionerFerdinand AryantoKomisarisCommissionerJohannes SetijonoPresiden KomisarisPresident CommissionerJozef Darmawan AngkasaKomisarisCommissionerFarid Anfasa MoeloekKomisaris IndependenIndependent CommissionerSantoso OenKomisarisCommissionerDuduk, kiri ke kananSeated, left to rightBerdiri, kiri ke kananStanding, left to right
  22. 22. Performance HighlightsManagement ReportCompany ProfileManagement Discussion and AnalysisCorporate GovernanceCorporate Social ResponsibilityPT Kalbe Farma Tbk. • Laporan Tahunan 201220Performance HighlightsManagement ReportCompany ProfileManagement Discussion and AnalysisCorporate GovernanceCorporate Social ResponsibilityBernadette Ruth Irawati SetiadyPresiden DirekturPresident DirectorLaporan DireksiReport from the Board of DirectorsPT Kalbe Farma Tbk. • Laporan Tahunan 201220
  23. 23. PT Kalbe Farma Tbk. • 2012 Annual Report 21Pemegang Saham Yang Terhormat,Puji syukur dan ucapan terima kasih kami haturkan kepadaTuhan Yang Maha Esa, yang telah memberikan bimbingan danperlindungan, sehingga Kalbe dapat terus meraih pertumbuhandi tahun 2012. Mewakili Direksi, dengan gembira saya laporkanberbagai pencapaian usaha positif selama tahun 2012.Kinerja Keuangan yang PositifTotal penjualan bersih mencapai Rp13.636 miliar di tahun 2012,meningkat 25,0% dari Rp10.912 miliar di 2011,serta berhasilmencapai 102,5% dari target penjualan yang ditetapkan di awaltahun.Pertumbuhan penjualan di tahun 2012 didorong oleh antaralain pertumbuhan penjualan signifikan sebesar 34,0% dariDivisi Distribusi dan Logistik mencapai Rp5.188 miliar, terutamaseiring bergabungnya prinsipal baru, PT Abbott Indonesia,yang meningkatkan kontribusi Divisi ini menjadi 38% dari totalpenjualan Kalbe. Divisi Obat Resep berhasil meraih pertumbuhanpenjualan sebesar 18,4% mencapai Rp3.288 miliar denganpangsa pasar terbesar yaitu 13% (sumber : IMS Health 2012),serta menyumbang sebesar 24% dari total penjualan bersih Kalbe.Divisi Produk Kesehatan Kalbe juga berkinerja positif, denganpertumbuhan penjualan sebesar 16,7% mencapai Rp2.149 miliardan menyumbang 16% dari total penjualan Perseroan. Penjualanbersih Divisi Nutrisi mencapai sebesar Rp3.012 miliar di tahun2012, tumbuh 24,5% dari pencapaian tahun sebelumnya danmenyumbang 22% dari total penjualan Kalbe.Distinguished Shareholders,Let us give praise and thanks to God Almighty who providedus with His guidance and protection, allowing Kalbe to deliversustained growth in 2012. On behalf of the Board of Directors, Iam pleased to report an excellent set of business performanceachieved in 2012.Solid Financial PerformanceIn 2012, Kalbe’s net sales reached Rp13,636 billion, rising by25.0% from Rp10,912 billion in 2011 and reaching 102.5% of thesales target set at the beginning of the year.Sales growth in 2012 was supported, among other things, byconsiderable 34.0% net sales growth to Rp5,188 billion bookedby Kalbe’s Distribution and Logistics Division, largely fromthe arrival of a new principal, PT Abbott Indonesia, boostingthe Division’s contribution to Kalbe’s total sales to 38%. TheCompany’s Prescription Pharmaceuticals Division booked a18.4% sales growth to Rp3,288 billion, commanding the largestmarket share of 13% (source : IMS Health 2012) and accounting24% of Kalbe’s total net sales. Kalbe’s Consumer Health Divisionalso enjoyed a good year, with 16.7% sales growth to Rp2,149billion and contributing 16% of the Company’s total sales. TheNutritionals Division’s net sales amounted to Rp3,012 billionin 2012, growing 24.5% from the previous year’s result andaccounting 22% of Kalbe’s total sales.“Efforts to improve sales and marketing effectivenesswill continue to be our priority, as well as developingstronger distribution network to expand productavailability.”“Upaya peningkatan efektivitas penjualandan pemasaran akan terus menjadiprioritas kami, disertai penguatan jaringandistribusi untuk memperluas ketersediaanproduk.”
  24. 24. Performance HighlightsManagement ReportCompany ProfileManagement Discussion and AnalysisCorporate GovernanceCorporate Social ResponsibilityPT Kalbe Farma Tbk. • Laporan Tahunan 201222Pada tahun 2012 Perseroan mencatat pertumbuhan penjualanyang tinggi, sehingga terjadi perbaikan efisiensi biaya operasionalkarena biaya tidak bertumbuh secepat pertumbuhan penjualan.Rasio Biaya Operasional terhadap Nilai Penjualan Bersih jugamembaik 1,2%, dari 32,8% menjadi 31,6% di tahun 2012,terutama didorong oleh pertumbuhan penjualan yang signifikan.Di akhir 2012, laba operasional mencapai Rp2.218 miliar, 12,7%lebih tinggi dari pencapaian tahun sebelumnya, sedangkan lababersih mencapai Rp1.734 miliar, tumbuh 17,0% dibanding kinerja2011.Pencapaian Penting 2012Sebagaimana dijelaskan sebelumnya, Kalbe mencatat kinerjakeuangan yang kuat pada tahun 2012. Kami berpendapat hal inijuga didukung oleh kondisi makroekonomi Indonesia dan profildemografis yang kondusif. Didukung pertumbuhan ekonomiIndonesia secara konsisten sejak pulih pasca krisis keuangan Asiatahun 1997, telah terbentuk golongan ekonomi kelas menengahyang terus bertumbuh dengan daya beli yang semakin kuat.Dengan rasio penduduk usia produktif terhadap total pendudukyang meningkat, Indonesia tengah menikmati kondisi demografisyang kondusif yang akan mendukung pertumbuhan ekonomidi masa mendatang. Ditambah dengan perbaikan pendidikandan arus informasi, masyarakat Indonesia menunjukkan tingkatkesadaran kesehatan yang semakin tinggi. Dalam situasi yangpositif ini, kami yakin Kalbe akan mampu mempertahankanpertumbuhan penjualan yang sehat.Memperkuat portofolio bisnis tetap menjadi perhatian utama kami.Kami secara konsisten melaksanakan strategi untuk memperkuatportofolio bisnis melalui pengembangan produk yang inovatif dansecara anorganik melalui penggabungan usaha dan akuisisi.Kami tetap mempertahankan semangat inovasi dankewirausahaan seiring peluncuran produk-produk baru olehDivisi-divisi Obat Resep, Produk Kesehatan dan Nutrisi. Sejalandengan semangat kami mendorong inovasi untuk kehidupanyang lebih baik, unit pengembangan produk dan penelitian kamiterus menjadi pendorong utama peluncuran produk-produk baruyang menawarkan manfaat kesehatan dan kemudahan bagikonsumen.Pada Divisi Obat Resep, kami berupaya memastikan bahwakami mampu meluncurkan produk generik dari obat yang telahhabis masa perlindungan patennya. Dengan demikian, kamimemperoleh keunggulan sebagai pemain pertama dan mampumenguasai pasar. Dalam menghadapi pelaksanaan jaminankesehatan secara nasional, kami ingin memperkuat posisi kamipada segmen obat generik tidak bermerek. Sepanjang tahun2012, kami melanjutkan upaya persiapan untuk mengantisipasiIn 2012 the Company recorded strong sales growth, resulting inefficiency improvements of operating expenses, as the expensesdid not grow at the same rate as the top line. Operating Expensesto Net Sales Ratio also improved by 1.2% from 32.8% to 31.6%in 2012, mainly due to strong sales growth. By the end of the year,operating profit was recorded at Rp2,218 billion, 12.7% highercompared to the previous year, while net profit was registered atRp1,734 billion, growing 17.0% against 2011 performance.2012 Important HighlightsAs outlined above, Kalbe booked a strong set of financial resultsin 2012. We believe this is supported by Indonesia’s conducivemacroeconomic setting and demographic profile. As Indonesiahas been growing consistently after recovering from the Asianfinancial crisis in 1997, a huge middle income group has beenformed and continued to increase in size and spending power.With the ratio of working age population to the rest of thepopulation on the uptrend, Indonesia is enjoying a demographicdividend that will support further economic growth. Coupled withimproving education and information flow, Indonesians are alsoshowing rising health awareness. In this favorable setting, webelieve Kalbe will be able to sustain strong top line growth.Enhancing business portfolio continued to be one of our keyfocuses. We consistently execute the strategy to strengthen ourbusiness portfolio through innovative product development andinorganically through merger and acquisitions.We retain our spirit of innovation and entrepreneurship asevidenced by the number of new products launched by thePrescription Pharmaceuticals, Consumer Health and NutritionalsDivisions during the year. In line with our spirit to promoteinnovation for a better life, our research and business developmentunit continues to serve as the major driver behind Kalbe’s newproduct launching that offers health benefits and convenience tothe consumers.In the Prescription Pharmaceuticals Division, we strive to ensurethat we are able to introduce the first generic version of a productthat has reached patent expiry. This will provide us with a firstmover advantage and early market dominance. In light of theupcoming national healthcare insurance system, we target tostrengthen our presence in the unbranded generic segment.During 2012, we continued our preparation to anticipate the roll-out of the implementation of the national healthcare insurance
  25. 25. PT Kalbe Farma Tbk. • 2012 Annual Report 23pelaksanaan jaminan kesehatan nasional pada tahun 2014. Kamimendukung keputusan Pemerintah untuk menjalankan programjaminan kesehatan nasional agar semakin banyak masyarakatIndonesiayangdapatmemanfaatkanlayanankesehatan,terutamagolongan ekonomi lemah. Untuk menyediakan obat dengan hargaterjangkau, kami terus memperkuat kemampuan produksi kamiagar mampu bersaing di segmen obat generik tidak bermerek.Di bulan Februari 2012, kami telah meresmikan fasilitas produksibaru khusus untuk memproduksi obat-obat generik, agar Kalbedapat memenuhi meningkatnya permintaan seiring implementasiprogram jaminan kesehatan nasional. Lebih lanjut, kami jugamemperkuat pengelolaan rantai pasokan dari awal sampaiakhir, dari pengadaan bahan baku hingga ketersediaan produkbagi konsumen, termasuk dengan melakukan investasi untukmengembangkan jaringan distribusi kami. Untuk memperkuatportofolio produk pada Divisi Obat Resep, saat ini kami tengahmenyelesaikan konstruksi pabrik obat kanker yang diharapkanakan mampu menyediakan produk obat kanker di Indonesiadengan harga lebih terjangkau. Pembangunan fasilitas produksibaru untuk obat-obat kanker berjalan sesuai rencana dandiharapkan dapat selesai pada tahun 2013.Di tahun 2012, Divisi Obat Resep meluncurkan 18 produk baru,yang terdiri dari 6 produk berlisensi, 9 produk generik bermerekdan 3 produk generik tanpa merek. Peluncuran produk barumerupakan hasil aktivitas riset dan pengembangan secara terusmenerus pada Divisi Obat Resep kami. Selain pengembanganproduk, riset dan pengembangan juga mencakup kegiatan risetdengan teknologi canggih untuk mempersiapkan pengembanganterapi masa depan.Di bulan Juli 2012, kami telah melakukan akuisisi 100 persensaham PT Hale International, produsen minuman kesehatan lokal,yang merupakan langkah strategis untuk dapat segera mengaksesfasilitas produksi siap pakai untuk mendukung ekspansi usahaDivisi Produk Kesehatan di segmen produk minuman. Selain itu,akuisisi PT Hale International telah menambah ragam pilihanproduk Divisi Produk Kesehatan dengan merek-merek produkminuman Original Love Juice dan Pomerama, yang memperkuatkehadiran kami di segmen minuman siap saji. Pada segmenminuman energi, kami melengkapi rangkaian produk Extra Jossdengan meluncurkan Nitros – minuman energi dalam bentukkonsentrat cair dengan kemasan yang inovatif. Divisi ProdukKesehatan aktif menghadirkan produk baru ke pasar, antara laindengan peluncuran produk Komix DT, varian baru obat batukKalbe yang menggunakan kemasan yang praktis.Guna mendukung perluasan usaha Divisi Nutrisi, pada bulanJuni 2012 kami telah menjalin kerjasama untuk membentukPT Kalbe Milko Indonesia yang akan menjadi basis produksiproduk-produk susu dalam bentuk cair. Langkah tersebut akansystem starting in 2014. We support the Government’s move toimplement the national healthcare insurance program, as moreIndonesians will benefit from healthcare service, particularly thosefrom the lower income group. To provide drugs at more affordableprice, we continue to strengthen our manufacturing capability tobe able to compete in the unbranded generics space. In February2012, we have inaugurated our new manufacturing facilitydedicated for generic drug production, which will allow Kalbe totap surging market demand following the universal healthcareimplementation. Further, we will also strengthen our supply chainmanagement from end-to-end, from procurement up to productavailability for consumers, including by investing to expand ourdistribution network. To strengthen our product portfolio in thePrescription Pharmaceuticals, we are in the process of finalizingthe construction of our new oncology factory, which is aimed atproviding oncology drugs at more affordable prices in Indonesia.The construction of the oncology facility goes according to planand set to be completed by 2013.In 2012, the Prescription Pharmaceuticals Division introduced18 new products, consisting of 6 licensed products, 9 brandedgeneric products and 3 unbranded generic products. New productlaunches are the result of continuous research and developmentactivities at our Prescription Pharmaceuticals Division. Asidefrom product development, research and development activitiesalso include state-of-the-art research works in anticipation of thedevelopment of future advanced therapies.In July 2012, we acquired a 100 percent stake in PT HaleInternational, a local health drink producer, which is a strategicmove to gain immediate access to a ready-to-use productionfacility to support the Consumer Health Division’s expansion inthe ready-to-drink segment. In addition, the acquisition bringsprominent ready-to-drink brands such as Original Love Juice andPomerama into the Consumer Health Division’s product selection,further strengthening our position in the ready-to-drink segment.In the energy drink segment, we further extended the Extra Jossproduct line by introducing Nitros – energy drink in concentratedliquid format with an innovative packaging. The Consumer HealthDivision was also active in bringing new products to the market,such as the launching of Komix DT, a new variant of Kalbe’s wellknown cough syrup that now features a convenient packaging.To support the Nutritionals Division’s business expansion, in June2012 we have forged an alliance to establish PT Kalbe MilkoIndonesia, which wil serve as production basis for liquid dairyproducts. This will enhance our product range in the Nutritionals
  26. 26. Performance HighlightsManagement ReportCompany ProfileManagement Discussion and AnalysisCorporate GovernanceCorporate Social ResponsibilityPT Kalbe Farma Tbk. • Laporan Tahunan 201224memperkuat rangkaian produk pada Divisi Nutrisi yang sekarangterutama terdiri dari produk susu bubuk. Pada tahun 2012, kamijuga meluncurkan Fitbar, makanan ringan sehat yang rendahkalori dan tidak mengandung lemak trans maupun kolesterol,untuk memenuhi kebutuhan akan alternatif makanan ringan yanglebih sehat. Untuk memenuhi kebutuhan terhadap produk susubayi khusus, kami menambahkan seri Morinaga Soya dan P-HPbagi penderita alergi laktosa dan protein susu.Kami percaya distribusi adalah daya saing utama untukmempertahankan kepemimpinan pasar. Untuk memperkuatposisi kepemimpinan distribusi Kalbe, sebagai bagian darirencana ekspansi yang dimulai pada tahun 2011, kami telahmeningkatkan kapasitas pada cabang-cabang di 5 kota yaituBanjarmasin, Jember, Surakarta, Banda Aceh dan Denpasardi tahun 2012. Kami terus memperluas cakupan area distribusibekerja sama dengan para sub-distributor strategis di seluruhIndonesia. Klinik Mitrasana, jaringan klinik satu atap dari Kalbe,telah memperkenalkan model bisnis baru serta menambah 12outlet baru di area Jabodetabek, serta menutup tahun 2012dengan sebanyak 39 klinik dari 27 klinik di tahun sebelumnya.Untuk mendukung salah satu prioritas strategi yang ditetapkanuntuk 2012, sepanjang tahun Kalbe juga telah melaksanakanupaya-upaya untuk menyempurnakan kinerja pemasaran danpenjualannya. Kami telah meluncurkan berbagai kegiatanpemasaran above-the-line dan below-the-line yang kreatifsepanjang tahun 2012. Kami telah memperkenalkan kartu KalbeFamily Rewards Card di tahun 2012, yang menawarkan berbagaimanfaat bagi para pemegang kartu. Inisiatif Corporate Brandingjuga terus berlanjut, antara lain dengan menampilkan logo Kalbedi setiap iklan TV, untuk memposisikan merek korporat Kalbesebagai produsen terpercaya untuk produk-produk berkualitas.Kami telah meresmikan pembentukan Corporate Marketing Officedi tahun 2011, yang bertanggung jawab sebagai pusat seluruhkegiatan pemasaran di Grup Kalbe.Program pengembangan aset kami yang terpenting, sumber dayamanusia, tetap menjadi salah satu prioritas sepanjang tahun 2012.Kami sepenuhnya menyadari, bahwa untuk mendukung sasaranpertumbuhan usaha Perseroan yang tinggi, kami tidak sajaharus mengembangkan sumber daya manusia yang kompeten,melainkan juga insan-insan dengan nilai Panca Sradha Kalbeyang unggul, sebagai identitas korporasi yang mempersatukanseluruh karyawan Grup Kalbe. Pusat pelatihan kami yang baru,Kalbe Learning Center, telah diresmikan di tahun 2012 sebagaibukti komitmen Perseroan pada pengembangan sumber dayamanusia. Program-program pengembangan kepemimpinanKalbe General Management dan Kalbe Middle ManagementProgram, yang dirancang bersama institusi-institusi terkemuka diIndonesia maupun Asia, telah memasuki masing-masing tahunDivision which currently mostly consists of powdered milkproducts. In 2012, we introduced Fitbar, a healthy snack bar withlow calories, zero trans fat and cholesterol to meet the demandfor healthier snacking alternatives. To cater to the needs for morespecialized infant formula products, we have added MorinagaSoya and P-HP lines for lactose intolerance and milk proteinallergy.We believe that distribution is a key competitive edge to maintainour dominance in the market. To strengthen Kalbe’s distributionleadership, as part of the expansion plan started in 2011, we haveconsiderably upgraded the capacity of our branches in 5 citiesin Banjarmasin, Jember, Surakarta, Banda Aceh and Denpasarin 2012. We continued to widen coverage through cooperationwith strategic sub-distributors across the nation. MitrasanaClinics, Kalbe’s integrated clinic network, introduced a newbusiness model and added 12 new outlets in Greater Jakarta(Jabodetabek), closing 2012 with a total of 39 clinics from 27clinics a year earlier.In line with one of the strategic priorities set for 2012, theyear also witnessed Kalbe’s targeted efforts to enhance theCompany’s marketing and sales performance. We launched aseries of creative above-the-line and below-the-line activitiesduring the year. We launched the Kalbe Family Rewards Card in2012, which offers various benefits to the card holders for thepurchase of Kalbe products through our previously launchedonline store, Kalbe e-store. Combined with a home deliveryservice, we aim to provide more convenience for our consumers.Corporate Branding initiatives also continued, among others byflashing Kalbe logo in all TV ads, to position Kalbe’s corporatebrand as a leading trusted producer of high quality products.We have formally launched Kalbe’s Corporate Marketing Officesince 2011, tasked as the hub of all marketing activities withinthe Kalbe Group.Programs for the development of our most important asset,Kalbe’s human capital, remained one of our top prioritiesthroughout 2012. We recognize that to support the Company’srapid business growth objectives, we need to develop notjust highly competent human resources, but also people withstrong Panca Sradha Kalbe values as our corporate personalitythat unifies Kalbe Group’s entire workforce. A new trainingcenter, Kalbe Learning Center, was established during the year,underscoring our commitment to people development. KalbeGeneral Management and Kalbe Middle Management Programs,our leadership development program designed in associationwith leading institutions in Indonesia and Asia, has entered its3rd and 2nd year respectively, and continued to be attended byKalbe’s future leaders. By the end of the year, we organized 1
  27. 27. PT Kalbe Farma Tbk. • 2012 Annual Report 25ke 3 dan ke 2, serta terus menjaring kepesertaan dari pemimpin-pemimpin masa depan Kalbe. Hingga akhir tahun 2012, kamitelah menyelenggarakan 1 kelas Kalbe General ManagementProgram dan 2 kelas Kalbe Middle Management Program dengandurasi 10 hari pelatihan untuk masing-masing kelas. Programdiikuti oleh 68 peserta dari berbagai anak perusahaan, denganinvestasi lebih dari Rp4 miliar untuk pengembangan sumber dayamanusia khususnya di level eksekutif. Secara keseluruhan, padatahun 2012 kami telah menginvestasikan sebanyak Rp20,6 miliaruntuk pengembangan sumber daya manusia.Kami senantiasa berupaya untuk mengoptimalkan nilai bagipemegang saham, termasuk melalui pembayaran dividen.Komitmen kami untuk meningkatkan nilai bagi pemegang sahamtercermin dari pembayaran dividen pada tahun 2012 sebesarRp95 rupiah per lembar saham atau sebesar Rp891 miliar untuktahun fiskal 2011, setara dengan rasio pembayaran dividensebesar 60%.Tantangan - TantanganPelemahan dan fluktuasi nilai Rupiah di tahun 2012, yangmengalami depresiasi hingga ke level Rp9.670 di akhir tahun,telah memberikan tekanan kepada industri farmasi, mengingatindustri ini masih sangat tergantung kepada impor untukmemenuhi sebagian besar bahan bakunya.Berkat praktik pengelolaan risiko yang berhati-hati, Kalbe berhasilmengatasi tekanan tersebut, tanpa pengaruh berarti kepadakinerja keseluruhan Perseroan di tahun 2012. Namun demikian,ke depan kami harus terus mencermati gejolak mata uang ini, danmengatasinya secara hati-hati di tengah kondisi ekonomi globalyang masih rapuh dan tidak menentu.Tata Kelola Perusahaan dan Tanggung JawabSosialWalaupun kinerja usaha yang solid merupakan elemen pentingdari keberhasilan kami, Perseroan senantiasa membangunkeseimbangan antara kinerja usaha dan praktik tata kelolaperusahaan yang baik.Kami berkomitmen pada standar transparansi dan akuntabilitasyang tertinggi kepada seluruh pemangku kepentingan yangmeliputi para pemegang saham/investor, konsumen, karyawan,regulator, mitra usaha, pemasok dan seluruh masyarakat.Perseroan percaya, bahwa budaya tata kelola yang baik dan sehatmemiliki manfaat besar bagi kegiatan usaha, mengingat budayatersebut dapat membangun nilai-nilai kepercayaan, percaya diridan profesionalisme dalam jangka panjang dalam hubungan kamidengan berbagai pemangku kepentingan.Tata kelola perusahaan yang baik harus didukung oleh tanggungjawab sebagai warga masyarakat yang baik, seiring upaya Kalbeuntuk membantu seluruh pemangku kepentingan meningkatkankesehatan menuju hidup yang lebih baik.Kalbe General Management Program class and 2 Kalbe MiddleManagement Program classes with a 10-day duration for each.The Programs were attended by 68 participants from varioussubsidiaries with an investment of Rp4 billion for human resourcesdevelopment in the executive level. In total, we have invested overRp20.6 billion for people development in year 2012.We strive to enhance shareholders’ value, including throughdividend payment. In 2012, our commitment to increase value forshareholders was evident from the dividend payment of Rp95 pershare or equivalent to Rp891 billion for fiscal year 2011, whichequals a 60% dividend payout ratio.Key ChallengesThe weakening and volatility of Rupiah in 2012, which depreciatedto Rp9,670 level by year end, has put some pressures to thepharmaceuticals industry, given the industry’s high dependenceon imports for most of its raw materials.Thankstoprudentriskmanagementpractices,Kalbehasbeenableto address this issue successfully, without significantly impactingthe Company’s overall performance in 2012. Nevertheless, goingforward we must closely monitor this exchange rate volatility,and exercise caution in dealing with the still uncertain and fragileworld economy.Corporate Governance and Corporate SocialResponsibilityWhile strong business performance is a key element of oursuccess, we never cease to balance business results with goodcorporate governance.We are committed to the highest standards of transparency andaccountability to all our stakeholders – shareholders/investors,customers, employees, regulators, business partners, vendorsand the public community at large. We believe that a strong andhealthy corporate governance culture makes good businesssense at all times as this culture builds trust, confidence andprofessionalism over the long term in our relationships with ourvarious stakeholders.Good corporate governance is complemented by good corporatecitizenship, as Kalbe strives to help all stakeholders to improvetheir health for a better life.
  28. 28. Performance HighlightsManagement ReportCompany ProfileManagement Discussion and AnalysisCorporate GovernanceCorporate Social ResponsibilityPT Kalbe Farma Tbk. • Laporan Tahunan 201226Gerakan Kalbe Berbagi merupakan payung dari empat pilartanggungjawabsosialPerseroandibidangkesehatan,pendidikan,kesehatan, lingkungan, serta sarana & prasarana.Di bidang pendidikan, khususnya riset & teknologi, kami telahmeluncurkan program-program untuk menarik minat padapendidikan ilmu pengetahuan, antara lain melalui kegiatan KalbeJunior Scientist Award bagi para ilmuwan muda Indonesia, sertaRistek Kalbe Science Awards, kompetisi dua tahunan di bidangilmu pengetahuan yang diselenggarakan bersama KementerianRiset & Teknologi, sebagai penghargaan kepada para ilmuwanyang menyumbangkan manfaat riset nyata di bidang life sciencedan teknologi kesehatan. Program kesehatan Kalbe menawarkanakses gratis kelayanan kesehatan kepada masyarakatprasejahtera dan aktif menyebarluaskan manfaat hidup sehat,serta memberikan bantuan medis bagi para korban bencana alam.Di bidang perlindungan lingkungan, Kalbe telah memiliki sertifikasiISO 14001:2004, standar internasional manajemen lingkungan,untuk hampir semua fasilitas produksinya. Selain itu secara rutinkami menyelenggarakan program-program ramah lingkunganyang mengikutsertakan partisipasi aktif dari masyarakat di sekitarfasilitas kami. Akhirnya, kegiatan Kalbe di bidang pembangunansarana terus mendorong pengembangan fasilitas kesehatan danpendidikan, sejalan dengan sasaran kami untuk mengambil peranaktif dalam mendorong tercapainya hidup yang lebih baik.Sepanjang tahun 2012, lebih dari 100.000 orang telah menerimamanfaat dari program-program Kalbe Berbagi. Selain itu, sekitar2.350 relawan Kalbe di seluruh Indonesia turut berperan sertadalam kegiatan Kalbe Berbagi, bukti komitmen karyawan kamiterhadap misi sosial Kalbe.Penghargaan dan PengakuanBerkat dukungan banyak pihak, dengan gembira saya laporkanbahwa di tahun 2012 kami telah berhasil meraih berbagaipenghargaan domestik dan internasional. Antara lain, Perseroanberhasil meraih penghargaan sebagai the Most AdmiredEnterprise for Innovation category dalam ASEAN BusinessAwards 2012 dari ASEAN untuk 2 tahun berturut-turut, the BestManaged Companies Award dari Finance Asia, the Asia PacificFastest Growing Homegrown Company in Oncology CareAward dari Frost and Sullivan untuk Innogene, salah satu anakperusahaan Perseroan, serta penghargaan sebagai Indonesia’s2nd Best Investor Relations dari Asia Money. Produk-produk kamijuga menerima penghargaan antara lain Top Brand Awards 2012untuk Promag, Fatigon, Neo Entrostop dan Mixagrip, IndonesiaBest Brand Award untuk empat tahun berturut-turut 2009 – 2012untuk Komix pada Kategori Obat Batuk dari Swa dan Mars sertaIndonesia Most Favorite Youth Brand untuk Produk Makanan danOur Kalbe Care or ‘Kalbe Berbagi’ movement serves as anumbrella for Kalbe’s four social responsibilities pillars in health,education, environment and infrastructure.In education, particularly in research & technology, we introduceprograms to raise interest in science education, including theKalbe Junior Scientist Award targeting young Indonesian scientistsand Ristek Kalbe Science Awards, a biennial science competitionorganized with the Ministry of Research & Technology, to salutescientists with tangible research works in life sciences and healthrelated technologies. Kalbe’s healthcare programs offer freeaccess to health services to under-privileged communities andpromote the importance of living a healthy life, as well as providemedical assistance to victims of natural disasters. In the area ofenvironmental protection, Kalbe has received ISO 14001:2004certification, an international standard for environmentmanagement, for most of its production facilities. In addition,we regularly launch green programs inviting active participationfrom communities surrounding our facilities. Finally, Kalbe’sinfrastructure programs continue to assist in the development ofhealthcare and education facilities, in line with our goal to becomean active participant in promoting a better life.In 2012, over 100,000 beneficiaries have been touched by KalbeBerbagi’s programs. Moreover, over 2,350 Kalbe employeesthroughout Indonesia have participated in Kalbe Berbagi, a level ofvolunteerism that clearly demonstrates our people’s commitmentto Kalbe’s social responsibility mission.Awards and RecognitionsI am very pleased to note, that thanks to the hard work of many, in2012wehaveearnedsuchwiderangingdomesticandinternationalaccolades from the market. Among the highlights, the Companyreceived the Most Admired Enterprise for Innovation category inASEAN Business Awards 2012 from ASEAN for two consecutiveyears, the Best Managed Companies Award from FinanceAsia, the Asia Pacific Fastest Growing Homegrown Companyin Oncology Care Award from Frost and Sullivan for Innogene,the Company’s subsidiary, and was recognized as Indonesia’s2nd Best Investor Relations by Asia Money. Our products alsoreceived strong recognition such as the Top Brand Awards 2012for Promag, Fatigon, Neo Entrostop and Mixagrip, Indonesia BestBrand Award for four consecutive years 2009 – 2012 for Komix inthe Cough Medicine Category from Swa and Mars and IndonesiaMost Favorite Youth Brand in the Food and Beverage Product,Energy Drink for Extra Joss from MarkPlus Inc., Reader’s Choice
  29. 29. PT Kalbe Farma Tbk. • 2012 Annual Report 27Minuman, Minuman Energi untuk Extra Joss dari MarkPlus Inc.,Reader’s Choice Award untuk Prenagen dari majalah Mother &Baby, dan Top Brand for Kids 2012 untuk Milna dari Frontier danMajalah Marketing. PT Enseval Putera Megatrading Tbk, anakperusahaan Perseroan yang menangani distribusi, menerimapenghargaan Indonesia Excellence Award 2012 dalam kategori“Indonesian Pharmaceutical Distributor Company of the Year”dari Frost & Sullivan.Para karyawan Kalbelah yang paling pantas menerimapenghargaan atas kinerja positif ini. Dengan dukungan seluruhkaryawan, saya yakin bahwa Perseroan dapat meraih lebihbanyak keberhasilan di masa mendatang.Pandangan dan Prioritas 2013Memasuki tahun yang baru, prospek ekonomi Indonesia tetappositif di tengah kondisi ekonomi dunia yang masih lemah,didorong oleh konsumsi domestik, iklim investasi yang positif,serta akselerasi pembangunan infrastruktur. Industri farmasiakan terus memperoleh manfaat dari prospek Indonesia yangpositif. Ke depan, meningkatnya daya beli serta masih rendahnyapenetrasi industri kesehatan akan tetap menjadi pendorongutama pertumbuhan industri.Dengan memperhatikan faktor-faktor di atas, berikut akan kamisampaikan beberapa prioritas strategi ke depan.Pertama, dengan dukungan penuh dari seluruh unit usahaGrup Kalbe, kami akan memperkuat kehadiran Kalbe di pasarregional melalui peluncuran produk dan penguatan jaringandistribusi di pasar regional, untuk memperkuat merek Kalbe diluar Indonesia.Seperti di tahun sebelumnya, peningkatan portofolio usaha akanterus berlanjut, melalui inovasi di bidang produk, proses danbisnis, serta melalui inisiatif penggabungan usaha dan akuisisi.Upaya peningkatan efektivitas penjualan dan pemasaran akanmenjadi prioritas selanjutnya, yang akan dilaksanakan melaluisinergi brand, pembukaan peluang pasar baru, serta penguatanjaringan distribusi untuk memperluas ketersediaan dankeberadaan produk.Pengembangan sumber daya manusia akan terus menjadiprioritas utama, dengan tujuan untuk senantiasa mengembangkanpemimpin-pemimpin masa depan yang kompeten, dengankarakter Panca Sradha Kalbe, yang menjadi nilai dasarPerseroan.Award for Prenagen dari Mother & Baby Magazine, and Top Brandfor Kids 2012 for Milna from Frontier and Marketing Magazine.PT Enseval Putera Megatrading Tbk, the Company’s subsidiaryin charge of distribution, also received Indonesia ExcellenceAward 2012 in the category of the “Indonesian PharmaceuticalDistributor Company of the Year” from Frost & Sullivan.Our employees deserve particular acknowledgement for theseachievements. They are the main reason why I am confidentKalbe will continue to be successful in the future.The Future and 2013 PrioritiesEntering a new year, Indonesia’s economic outlook remainspositive despite a weak global economy, thanks to a steadydomestic consumption, a robust investment climate andaccelerated infrastructure development. The pharmaceuticalsindustry will continue to benefit from Indonesia’s positive outlook.Rising purchasing power and the relatively low healthcarepenetration will remain the major drivers behind the industrygrowth going forward.Taking the above setting for the year, we would like to outlinesome of our major strategic priorities for the year ahead.First, with full support from the entire Kalbe Group’s businesses,we will strengthen Kalbe’s presence in the regional marketsthrough more aggressive product launching and distributionnetwork strengthening in the regional market, to strengthenKalbe’s brand outside Indonesia.Just as in the previous year, business portfolio strengtheningwill continue, through innovation in products, processes andbusinesses, as well as through merger and acquisitions.Efforts to improve Kalbe’s sales and marketing effectivenesswill be our next priority, addressed by better brand synergy,opening of new market opportunities, and by developing strongerdistribution footing to expand product availability and presence.Human capital development remains our ongoing top priority,aiming at continuously developing Kalbe’s competent futureleaders with Panca Sradha Kalbe, our key values.
  30. 30. Performance HighlightsManagement ReportCompany ProfileManagement Discussion and AnalysisCorporate GovernanceCorporate Social ResponsibilityPT Kalbe Farma Tbk. • Laporan Tahunan 201228Akhirnya, pengelolaan rantai pasokan yang efektif merupakanfaktor kunci untuk meraih arus kas operasional yang optimal.Ucapan Terima KasihIzinkan saya untuk menutup laporan ini dengan menyampaikanucapan terima kasih kepada seluruh pemegang saham,konsumen, regulator, mitra, para karyawan, Dewan Komisaris,serta masyarakat luas atas dukungannya kepada Kalbe.Mewakili jajaran manajemen, saya juga menyampaikan terimakasih kepada Bapak Johanes Berchman Apik Ibrahim yangmengundurkan diri dari jabatan Wakil Direktur Utama Perseroanpada tahun 2012 atas pengabdiannya terhadap Grup Kalbeselama lebih dari 27 tahun.Jajaran Direksi dan manajemen senior tetap berkomitmen untukmemberikan yang terbaik agar dapat meningkatkan kinerja tahun2013, serta membangun masa depan yang lebih baik bagi Kalbedan seluruh pemangku kepentingan.Last but not least, effective supply chain management is essentialto maintain optimal operational cash flows.A Thank You NoteAllow me to close this message by extending our thank you toall of our shareholders, customers, regulators, partners, staffmembers, Board of Commissioners and the public at large fortheir continuing support to Kalbe.On behalf of management, I also wish to thank Johanes BerchmanApik Ibrahim who retired in 2012 as the Company’s Vice PresidentDirector, for his invaluable contributions to Kalbe for more than 27years.The Board of Directors and senior management are committed togiving our very best to further enhance our performance in 2013and to build a better future for Kalbe and its larger community ofstakeholders in the years ahead.Bernadette Ruth Irawati SetiadyPresiden Direktur President Director
  31. 31. PT Kalbe Farma Tbk. • 2012 Annual Report 29Bernadette Ruth Irawati SetiadyPresiden DirekturPresident DirectorBudi Dharma WreksoatmodjoDirekturDirectorHerman WidjajaDirekturDirectorOngkie TedjasurjaDirekturDirectorVidjongtiusDirekturDirectorKiri ke kananLeft to right
  32. 32. Performance HighlightsManagement ReportCompany ProfileManagement Discussion and AnalysisCorporate GovernanceCorporate Social ResponsibilityPT Kalbe Farma Tbk. • Laporan Tahunan 201230Informasi PerseroanCorporate InformationNama Perusahaan Name of CompanyPT Kalbe Farma Tbk.Bidang Usaha Line of BusinessFarmasi, Perdagangan, dan PerwakilanPharmaceuticals, Trading, and AgencyTanggal Pendirian Date of Establishment10 September 1966Dasar Hukum Pendirian Legal Basis of EstablishmentAkta No. 3 tanggal 10 September 1966, dibuat di hadapan Raden Imam SoesatyoPrawirokoesoemo, Wakil Notaris di JakartaDeed No. 3, dated September 10, 1966, drawn up before Raden Imam SoesatyoPrawirokoesoemo, a Deputy Notary in JakartaKepemilikan (per 31 Desember 2012)* Ownership (as of December 31, 2012)*PT Gira Sole Prima 10.17%PT Santa Seha Sanadi 9.62%PT Diptanala Bahana 9.49%PT Lucasta Murni Cemerlang 9.47%PT Ladang Ira Panen 9.22%PT Bina Arta Charisma 8.66%Publik Public 43.37%* tidak termasuk saham yang dibeli kembali excluding treasury stockModal Dasar Authorized CapitalRp 850,000,000,000Modal Ditempatkan dan Disetor Penuh Issued and Fully Paid CapitalRp 507,800,721,100Bursa Stock ExchangeBursa Efek IndonesiaIndonesia Stock Exchange Building, Tower 1Jl. Jend. Sudirman Kav 52-53Jakarta 12190, IndonesiaTel. (62-21) 515 0515Fax. (62-21) 515 0330E-mail: callcenter@idx.co.idKode Saham Ticker CodeKLBFTanggal Pencatatan Listing Date30 Juli 1991Kantor Pusat Head OfficeGedung KALBEJl. Let. Jend. Suprapto Kav. 4Cempaka Putih, Jakarta 10510, IndonesiaTel. (62-21) 4287 3888 - 89Fax. (62-21) 4287 3678Web: www.kalbe.co.idPabrik FactoryKawasan Industri Delta SilikonJl. M.H. Thamrin Blok A3 - 1Lippo Cikarang, Bekasi 17550IndonesiaTel. (62-21) 8990 7333 (62-21) 8990 7337Fax. (62-21) 8990 7360Dana Pensiun Pension FundDana Pensiun Kalbe FarmaSumber Daya Manusia Human Resources10,030 karyawan tetap permanent employees7,670 karyawan tidak tetap contractual employeesHubungi Kami Contact UsGedung KALBEJl. Let. Jend. Suprapto Kav. 4Cempaka Putih, Jakarta 10510, IndonesiaTel. (62-21) 4287 3888(62-21) 4287 3889Fax. (62-21) 4287 3678Sekretaris Perusahaan Corporate SecretaryE-mail: vidjongtius@kalbe.co.idHubungan Investor Investor RelationsE-mail: investor.relations@kalbe.co.idKomunikasi Korporat Corporate CommunicationE-mail: corp.comm@kalbe.co.idLayanan Pelanggan Customer CareTel. 0800-140-2000 (toll free)E-mail: customer@kalbenutritionals.com
  33. 33. PT Kalbe Farma Tbk. • 2012 Annual Report 31Nama dan Alamat Lembaga dan/atau Profesi Penunjang Pasar ModalNames and Addresses of Institutions and/or Capital Market Supporting ProfessionalsBursa Stock ExchangeBursa Efek IndonesiaIndonesia Stock Exchange Building, Tower 1Jl. Jend. Sudirman Kav 52-53Jakarta 12190, IndonesiaTel. (62-21) 515 0515Fax. (62-21) 515 0330E-mail: callcenter@idx.co.idAuditor AuditorPurwantono, Suherman & Surja (Ernst & Young)Indonesia Stock Exchange Building, Tower 2, 7th FloorJl. Jend. Sudirman Kav. 52-53Jakarta 12190, IndonesiaTel. (62-21) 5289 5000Fax. (62-21) 5289 4100Biro Administrasi Efek Share RegistrarPT Adimitra TransferindoPlaza Property, 2nd FloorKompleks Pertokoan Pulomas Blok VIII No. 1Jl. Perintis KemerdekaanJakarta 13210, IndonesiaTel. (62-21) 4788 1515Fax. (62-21) 470 9697Notaris NotaryDr. Irawan Soerodjo, SH, Msi.Komp. Ketapang Indah Blok B-2 No. 4-5Jl. K.H. Zainul Arifin No. 2, Jakarta 11140Tel. (62-21) 630 1511Fax. (62-21) 633 7851DivisiDivisions• Divisi Obat Resep Prescription Pharmaceuticals Division• Divisi Produk Kesehatan Consumer Health Division• Divisi Nutrisi Nutritionals Division• Divisi Distribusi & Logistik Distribution & Logistics Division
  34. 34. Performance HighlightsManagement ReportCompany ProfileManagement Discussion and AnalysisCorporate GovernanceCorporate Social ResponsibilityPT Kalbe Farma Tbk. • Laporan Tahunan 201232Sejarah Kalbe Farma diawali dari garasi pendiri Perseroan tahun1966 sebagai perusahaan produk kesehatan dengan prinsip-prinsip dasar: inovasi, merek yang kuat dan manajemen prima.Dengan pedoman “Panca Sradha Kalbe” sebagai nilai dasarPerseroan, Kalbe berhasil meraih pertumbuhan yang solid danmencatatkan sebagai perusahaan publik tahun 1991 di BursaEfek Jakarta dan Bursa Efek Surabaya (sekarang bergabungmenjadi Bursa Efek Indonesia).Melalui proses pertumbuhan organik dan penggabungan usaha& akuisisi, kegiatan usaha Kalbe berkembang meliputi 22 anakperusahaan, dalam empat kelompok divisi usaha: divisi obatresep dengan kontribusi sebesar 24% terhadap pendapatantotal, divisi produk kesehatan dengan kontribusi 16%, divisinutrisi dengan kontribusi 22%, serta divisi distribusi dan logistikdengan kontribusi 38%. Pada tahun 2012, Perseroan melakukanakusisi 100% saham PT Hale International, produsen minumankesehatan, untuk terus memperkuat posisi Kalbe di pasarIndonesia yang terus berkembang.Dengan dukungan lebih dari 17.000 karyawan, termasuk 6.000tenaga penjualan dan pemasaran, kegiatan usaha Perseroanmencakup seluruh wilayah kepulauan Indonesia dan keberadaandi pasar internasional yang terus berkembang.The story of Kalbe Farma begins from a humble beginning in thefounder’s garage in 1966 as a pharmaceutical company driven bya set of basic principles: innovation, strong brands and excellentmanagement.Guided by “Panca Sradha Kalbe” as the Company’s corporatevalues, Kalbe establishes a solid growth curve over the pastdecades and went public in 1991 by listing on the Jakarta StockExchange and Surabaya Stock Exchange (now merged asIndonesia Stock Exchange).Growing both organically and through mergers & acquisitions,Kalbe’s business interests are spread across 22 subsidiaries,grouped into four business divisions: the prescriptionpharmaceuticals division with 24% revenue contribution to totalrevenue, consumer health with 16% contribution, nutritionalswith 22% contribution, and distribution and logistics with 38%contribution. In 2012, the Company sealed a deal to take 100%shares in PT Hale International, a producer of health beverages,to further strengthen its position in the burgeoning Indonesianmarket.With over 17,000 employees, including 6,000 sales and marketingprofessionals, the Company’s operations cover the entireIndonesian archipelago with a growing footing in internationalmarkets.Sekilas KALBE FARMAKALBE FARMA at a Glance
  35. 35. PT Kalbe Farma Tbk. • 2012 Annual Report 33Di Indonesia, Kalbe mampu menjangkau 70% dokter umum, 90%dokter spesialis, 100% rumah sakit, 100% apotek untuk pasarobat-obat resep serta 80% untuk pasar produk kesehatan dannutrisi. Di pasar internasional, Perseroan telah hadir di pasar AsiaTenggara dan Afrika, serta menjadi perusahaan produk kesehatannasional yang dapat bersaing di pasar ekspor.Semangat inovasi untuk kehidupan yang lebih baik menjadi bagiantak terpisahkan dari seluruh kegiatan usaha Kalbe. Aktivitas risetdan pengembangan telah menghasilkan produk-produk inovatifdengan nilai unggul untuk memenuhi kebutuhan masyarakat.Agar dapat menjangkau seluruh kepulauan nusantara, Kalbeterus meningkatkan kapasitas dan kualitas layanan distribusinya.Upaya penyempurnaan integrasi mata rantai pasokan senantiasamenjadi salah satu prioritas utama Kalbe guna meningkatkanefisiensi dan tingkat layanan.Kini, Kalbe merupakan penyedia “layanan kesehatankomprehensif” yang terdepan, produk obat-obatan, nutrisi,makanan dan minuman kesehatan hingga alat-alat kesehatantermasuk pelayanan kesehatan primer. Kalbe adalah perusahaanproduk kesehatan publik yang terbesar di Asia Tenggara dengannilai kapitalisasi pasar sebesar Rp 53,8 triliun dan omset penjualanRp 13,6 triliun di akhir 2012.In Indonesia, Kalbe maintains coverage to over 70% of generalpractitioners, 90% of specialists, 100% of hospitals and 100%of pharmacies for the prescription pharmaceuticals market, aswell as 80% for the consumer health and nutritionals markets.Internationally, the Company has established its footprint inSoutheast Asia and Africa, positioning Kalbe as a nationalpharmaceuticals company with a competitive edge in the exportmarket.The spirit of innovation for a better life is part of the very fabric ofKalbe’s entire business processes. Research and developmentactivities generate innovative and high-value products addressingthe needs of society. To serve the nation’s vast archipelago,Kalbe continues to increase both the capacity and quality of itsdistribution services. Continuous improvement of its supply chainintegration is always among Kalbe’s key priorities to improveefficiency and level of service.Today Kalbe is a leading provider of “comprehensive healthcaresolutions”, from pharmaceuticals, nutrition, health foods andbeverages to medical devices, including primary healthcareservices. Kalbe is the largest publicly-listed pharmaceuticalcompany in Southeast Asia, with a market capitalization of Rp53.8 trillion and Rp 13.6 trillion sales turnover by end of 2012.
  36. 36. Performance HighlightsManagement ReportCompany ProfileManagement Discussion and AnalysisCorporate GovernanceCorporate Social ResponsibilityPT Kalbe Farma Tbk. • Laporan Tahunan 201234Divisi Obat ResepPrescription Pharmaceuticals DivisionDivisi NutrisiNutritionals DivisionDivisi Produk KesehatanConsumer Health DivisionDivisi Obat Resep Kalbe menawarkanrangkaian obat resep yang lengkapuntuk seluruh segmen ekonomimasyarakat, dari obat generik tidakbermerek, obat generik bermerekhingga obat paten. Produk-produkdidistribusikan ke rumah sakit, apotekhingga toko obat di seluruh Indonesiamelaluijaringandistribusiyangterintegrasi.Kalbe juga memiliki tim pemasaran yangsolid, yang dikelompokkan untuk masing-masing segmen dan kelas terapi gunamenjamin kegiatan pemasaran yangterfokus dan efektif.Beberapa produk unggulan Kalbe antaralain adalah Brainact, Cefspan, Mycoral,Cernevit, Cravit, Neuralgin, Broadced,Neurotam, Hemapo, dan CPG.Divisi Nutrisi Kalbe menawarkan ragam produk-produk nutrisi yang lengkap untuk setiap tahapanpenting dalam kehidupan konsumen, mulai daribayi, balita, anak-anak, pra-remaja, dewasa, ibuhamil dan menyusui, hingga usia senja; sertaproduk-produk nutrisi untuk konsumen dengankebutuhan khusus.Beberapa produk unggulan Kalbe antara lainadalah Morinaga Chil Kid, Morinaga Chil School,Morinaga Chil Mil, Morinaga BMT, Prenagen,Milna dan Diabetasol yang diluncurkan sejaklebih dari 20 tahun yang lalu dan menguasaipangsa pasar yang dominan di Indonesia dantelah memperoleh beberapa penghargaan antaralain Reader’s Choice Award untuk Prenagendari majalah Mother & Baby dan Top Brand forKids 2012 untuk Milna dari Frontier dan MajalahMarketing. Kalbe terus melengkapi portofolioproduknya dengan meluncurkan beberapaproduk baru yang menawarkan manfaatkesehatan bagi konsumen seperti Zee, Fitbar,Entrasol dan Nutrive Benecol.Kalbe’s Nutritionals Division showcases acomplete product range for all important stages inconsumer’s lives, from infants, toddlers, children,tweens, adults, expectant and lactating mothers,up to the elderly, as well as nutritional productsfor consumers with special medical needs.Some of Kalbe’s top products include MorinagaChil Kid, Morinaga Chil School, Morinaga Chil Mil,Morinaga BMT, Prenagen, Milna and Diabetasol,which have been launched over 20 years ago andcommand dominant market shares in Indonesiaand have been awarded Reader’s Choice Awardfor Prenagen from Mother & Baby Magazine andTop Brand for Kids 2012 for Milna from Frontierdan Marketing Magazine. Kalbe continues toenhance its product portfolio by introducingseveral new products offering health benefitsfor consumers such as Zee, Fitbar, Entrasol andNutrive Benecol.Divisi Produk Kesehatan Kalbe meliputikategori produk obat bebas bersifat kuratifserta produk-produk konsumsi kesehatanyang memiliki manfaat kesehatan sepertisuplemen dan produk bersifat preventiflainnya, minuman energi serta produkminuman kesehatan. Portofolio kategoriproduk obat bebas Kalbe mencakup lebihdari 6 kelas terapi obat bebas denganmerek-merek dominan yang menguasaipangsa pasar dalam beberapa dekadeterakhir.Beberapa produk unggulan Kalbe sepertiPromag, Komix, Mixagrip dan Entrostoptelah menerima berbagai penghargaandari berbagai institusi. Produk unggulanKalbe lainnya antara lain adalah Woods,Fatigon, Procold, Mextril, Extra Joss,Hydro Coco dan Original Love Juice.Divisi UsahaBusiness DivisionsPT Kalbe Farma Tbk • Laporan Tahunan 201234Kalbe’s Consumer Health Division offersover-the-counter drugs with therapeuticbenefits, consumer products with healthbenefits, including supplements andother preventive products, along withenergy drinks and healthy ready-to-drink products. Kalbe’s over-the-counterportfolio category covers more than 6therapeutical classes with strong brands,commanding a dominant market share,over recent decades.Some of Kalbe’s top products such asPromag, Komix, Mixagrip and Entrostophave been awarded by various institutions.Some other Kalbe’s top products areWoods, Fatigon, Procold, Mextril, ExtraJoss, Hydro Coco and Original LoveJuice.Kalbe’s Prescription PharmaceuticalsDivision features a complete productrange for all segments, from unbrandedgeneric drugs, branded generics upto licensed drugs. These products aredistributed to hospitals, pharmacies anddrug stores across the archipelago throughan integrated distribution network. Kalbealso has a strong marketing team, dividedinto groups dedicated to each segmentand therapeutical class, allowing focusedand effective marketing activities.Some of Kalbe’s top products includeBrainact, Cefspan, Mycoral, Cernevit,Cravit, Neuralgin, Broadced, Neurotam,Hemapo, and CPG.

×