Advertisement
Advertisement

More Related Content

Slideshows for you(20)

Advertisement

Similar to Biosciences research at the International Livestock Research Institute (ILRI)(20)

More from ILRI(20)

Advertisement

Biosciences research at the International Livestock Research Institute (ILRI)

  1. Biosciences  research  at     Interna.onal  Livestock     Research  Ins.tute  (ILRI)   A  seminar  given  by  Steve  Kemp  and  Vish  Nene   at  University  of  Nairobi  5th  June  2013  
  2. 2  
  3. 3  
  4. 4   Source:  FAOSTAT,  2010  data  
  5. Four  out  of  the  five  highest  value   global  commodi.es  are  livestock   5   Source:  FAOSTAT,  2010  data  
  6. %  growth  in  demand  for  livestock  products   2000  -­‐  2030   6   FAO,  2012  
  7. ILRI  Mission  and  Strategy     §  ILRI envisions a world where all people have access to enough food and livelihood options to fulfill their potential. §  ILRI’s mission is to improve food and nutritional security and to reduce poverty in developing countries through research for efficient, safe and sustainable use of livestock— ensuring better lives through livestock §  ILRI works in partnerships and alliances with other organizations, national and international, in livestock research, training and information. ILRI works in all tropical developing regions of Africa and Asia. §  ILRI is a member of the CGIAR Consortium that conducts food and environmental research to help alleviate poverty and increase food security while protecting the natural resource base.
  8. Strategic  objec.ves   §  ILRI  and  its  partners  will  develop,  test,  adapt  and  promote  science-­‐ based  prac%ces  that—being  sustainable  and  scalable—achieve  beXer   lives  through  livestock.   Ø  ILRI  and  its  partners  will  provide  compelling  scien%fic  evidence  in   ways  that  persuade  decision-­‐makers—from  farms  to  boardrooms   and  parliaments—that  smarter  policies  and  bigger  livestock   investments  can  deliver  significant  socio-­‐economic,  health  and   environmental  dividends  to  both  poor  na.ons  and  households.   Ø  ILRI  and  its  partners  will  work  to  increase  capacity  amongst  ILRI’s   key  stakeholders  and  the  ins.tute  itself  so  that  they  can  make  beXer   use  of  livestock  science  and  investments  for  beXer  lives  through   livestock.  
  9. ILRI’s  competencies   Integrated sciences Biosciences Gender and equity Vaccines Resilience Genomics Value chains and innovation Breeding Zoonotics and food safety BecA Feeds Genomics and gene delivery Livestock and environment (both directions) Feed biosciences Policy, investment and trade Poultry genetics Animal health delivery Payment for ecosystem services Conservation of indigenous animal genetic resources Ruminants and monogastrics
  10. ILRI’s  research  teams   10   Integrated sciences Biosciences Animal science for sustainable productivity BecA-ILRI hub Food safety and zoonoses Vaccine platform Livestock systems and the environment Animal bioscience Livelihoods, gender and impact Feed and forage bioscience Policy, trade, value chains Bioscience facilities
  11. ILRI  Resources   •  Staff:  700.   •  Budget:  $60  million.     •  30+  scien.fic  disciplines.     •  130  senior  scien.sts  from  39  countries.   •  56%  of  interna.onally  recruited   staff  are  from  22  developing  countries.   •  34%  of  interna.onally  recruited  staff   are  women.     •  Large  campuses  in  Kenya  and  Ethiopia.     •  70%  of  research  in  sub-­‐Saharan  Africa.  
  12. ILRI  Offices   Mali   Nigeria   Mozambique   Kenya   Ethiopia   India   Sri  Lanka   China   Laos   Vietnam   Thailand   Nairobi: Headquarters Addis Ababa: principal campus In 2012, offices opened in: Kampala, Uganda Harare, Zimbabwe Office in Bamako, Mali relocated to Ouagadougou, Burkina Faso Dakar, Senegal
  13. Biosciences  eastern  and  central  Africa  –  ILRI  Hub   § a  strategic  partnership  between  ILRI  and  NEPAD.   § a  biosciences  plahorm  that  makes  the  best  lab  facili.es   available  to  the  African  scien.fic  community.   § building  African  scien.fic  capacity.   § iden.fying  agricultural  solu.ons  based  on  modern   biotechnology.   § hosted  at  ILRI’s  headquarters,  Nairobi,  Kenya.      
  14. § Biosciences  infrastructure    
  15. § Biorepository     •  Sampling is a very time-consuming and expensive exercise. •  We have an ethical and scientific responsibility to make the best use of that effort and money!
  16. § Biorepository    
  17. § Sequencing  and  bioinforma.cs     The Bioinformatics platform has 88 compute cores, 31TB of network-attached GlusterFS storage and back up systems. • 454 GSFLX – 500 Mbases in 7 hour run – $10/Mb – 500bp read lengths – Homo-polymer problem • Illumina MiSeq – 1.5-2Gbases in 27 hour run – $0.15/Mb – <150bp read lengths
  18. § Sequencing  and  bioinforma.cs    
  19. § Trypanosomias  research.   § Vaccine  research    
  20. African Trypanosomiasis •  Caused by extracellular protozoan parasites – Trypanosoma •  Transmitted between mammals by Tsetse flies (Glossina sp.) •  Prevalent in 36 countries of sub-Sahara Africa. In cattle •  A chronic debilitating and fatal disease. •  A major constraint on livestock and agricultural production in Africa. •  Costs US$ 1 billion annually. In human (Human Sleeping Sickness) •  Fatal •  60,000 people die every year •  Both wild and domestic animals are the major reservoir of the parasites for human infection.
  21. Trypanosomias  research   Trypanosomes cause fatal disease in humans and livestock. T. congolense, T. vivax T brucei rhodesiense T brucei gambiense
  22. Control and Treatment of African Trypanosomiasis Vector Control (Tsetse Fly) •  Using toxic insecticide •  Not sustainable •  Negative impacts on environment Vaccine •  Tryps periodically change the major surface antigen – variant surface glycoprotein (VSG) and evade the host immune system. •  More than 2 decades, there is no effective vaccine developed. Drug •  Drug toxicity and resistance •  Expensive
  23. Bovins Bovins et Glossines Glossines Cattle Tsetse Cattle and tsetse Origins of N’Dama and Boran cattle N’Dama Boran
  24. Contribution of 10 genes from Boran and N’Dama cattle to reduction in degree of trypanosomosis Boran (relatively susceptible) The N’Dama and Boran each contribute trypanotolerance alleles at 5 of the 10 most significant QTL, indicating that a synthetic breed could have even higher tolerance than the N’Dama. N’Dama (tolerant) -15 -10 -5 0 5 10 15 -15 -10 -5 0 5 10 15
  25. Studying the tolerant/susceptible phenotype has problems: • Separating cause from effect • Separating relevant from irrelevant. • Dominance of the ‘what is happening to this weeks trendy gene/protein/cytokine?’ approach.
  26. An EST Library screen identifies ARHGAP15282H->P mutation in the Bta2 (anaemia) QTL Ø Screened EST libraries made from four tissues from N’Dama and Boran for SNP within shortlisted genes.
  27. N'Dama (n = 35) Boran (n = 28) 282P-Allele 0.990 0.125 282H-Allele 0.010 0.875 Gene frequency H → P mutation at AA282 Alignment of N’Dama ARHGAP15 with homologues Cow NDama KFITRRPSLKTLQEKGLIKDQIFGSPLHTLCEREKSTVPRFVKQCIEAVEK ! Cow Boran KFITRRPSLKTLQEKGLIKDQIFGSHLHTLCEREKSTVPRFVKQCIEAVEK ! Human KFISRRPSLKTLQEKGLIKDQIFGSHLHTVCEREHSTVPWFVKQCIEAVEK ! Pig KFITRRPSLKTLQEKGLIKDQIFGSHLHTVCERENSTVPRFVKQCIEAVEK ! Chicken KFISRRPSLKTLQEKGLIKDQIFGSHLHLVCEHENSTVPQFVRQCIKAVER ! Salmon KFISRRPSMKTLQEKGIIKDRVFGCHLLALCEREGTTVPKFVRQCVEAVEK !
  28. ARHGAP15 is a RAC binding protein and the mutation at the proximal end of the RAC binding domain affects in vitro activity The tolerant allele would be expected to inhibit RAC1 activity in the MAPK pathway which plays a key role in regulating inflammatory responses and could lead to the observed differences in expression or amplify downstream expression differences caused by other factors.
  29. African Trypanosomes Infectivity • T. congolense • T. vivax • T. brucei brucei • T. brucei rhodesiense T. brucei gambiense Cattle Human Baboon (Papio papio) + - - + + - Human and baboon resistance is due to innate Trypanosome Lytic Factor (TLF) in serum which is a subclass of high density lipoprotein (HDL) and can create pores in Tryps lysosome membrane and kill the trypanosomes by loss of osmoregulation. - + -
  30. Can we construct a transgenic cow with resistance to African Trypanosomiasis ? •  Establish a transgenic cattle model with African Trypanosomiasis resistance using nuclear transfer (cloning). •  On the background of a Kenyan indigenous breed – Kenyan Boran. •  Introduce the gene – apoL-I from Baboon into Boran, which is the key trypanolytic component of Baboon’s protective Trypanosome Lytic Factor (TLF) against both cattle and human-infective trypanosomes.
  31. Complete  protec%on  from  human  infec%ve   Trypanosomes  by  baboon  apoL-­‐I  in     transient  transgenic  mice   0 20 40 60 80 100 120 140 0 20 40 60 80 100 Vector (N=6) apoL-I + Hpr (N=5) apoL-I (N=5) * * Days post infection • P  =  <  0.01   • Vector  vs.  treatment   Thomson  et  al  PNAS  2009    106:19509-­‐19514    
  32. Apol-3 Construct with Baboon ApoL-I Genomic Sequence Potential regulator y Sequenc e Myh 9 (myosin heavy chain 9) Chromosome 5 Cattle Apol Family Locus (6, 2 like, 4 like, 3) Targeting Strategy Apol-6, 2 like, 4 like
  33. Project Strategy Genomic locus of Baboon apoL-I gene Vector construction Validate the construct in transgenic mouse Bovine embryonic fibroblasts (BEF) primary culture Transfection & screening apoL-I Transgenic BEFs Nuclear Transfer Transgenic calves Phenotyping Trypanosome resistant transgenic Boran bull ILRI ILRI Kenya Boran Roslin Institute New York University Michigan State University
  34. NuclearTransfer (Cloning) Electrofusion 278 days Bovine Embryonic fibroblast Oocyte Oocyte-cell couplet Blastocyst Cloned calf born
  35. Enuclea.on   Polar body Polar body Polar body MII plate UV+Transmitted light Remove the PB and surrounding cytoplasm, as little as possible Check removal of MII plate under UV light
  36. Cell  Transfer  Fibroblast Select the smallest, round cells with smooth and shining edge Inject the selected fibroblast into the peri-vitelline space and push the cell in touch with the oocyte cytoplasm. Oocyte-cell couplet
  37. Electrofusion   Line perpendicular to the electrodes electrodes
  38. Cell line: Kenya Boran, BEFs_E5_286, Male   No. of Oocytes   No. of Reconstructed Embryos   No. of Blsts   No. of Blsts transferred   No. of Embryo Transfer   Pregnancy   Abortion   No.  of  born   calves   1244   723   85   22   16   5   3   2     58.1%   11.8%       31.3%   60.0%   40%   Summary  of  Control  Nuclear  Transfer    
  39. Name: Tatu Date of Birth:16 July 2012 (Kapiti) Sex: Male Birth Weight:46 kg Date of Death: 19 July 2012 (74 hrs) Cause of death: Low temperature, low blood glucose … ID: CL001 (Tumaini) Date of Birth: 21 August 2012 (ILRI) Sex: Male Birth Weight: 35 kg Current age: 7.5 months, healthy Two Cloned Calves born through Caesarean Section
  40. AtBirth6-Month CL001 (Tumaini)
  41. Identification of cloned calves with microsatellite markers MS Marker ID   Chromosome   Alleles Size     E5 (Cell line)   231-F (Tatu)   BH058 (Mother)   CL001 (Tumaini)   Comment   RM006   7   103.24   103.24     103.23   Calf same as E5  106.96   106.95   106.88   106.93       110.7     BM4440   2       123.69     Calf same as E5 No allele as dam   132.21   132.24     132.31   136.54   136.55     136.57       143.41     INRA053   7   90.96   90.92     90.86   Calf same as E5  102.69   102.7   102.7   102.7       110.14     BMS1116   7       141.67     Calf same as E5  143.87   143.77     143.83   146.03   145.93   145.96   145.96   ILST098   2       93.02     Calf same as E5 No allele as dam   101.08   101     101.08   104.77   104.73     104.79       110.45     Two born calves are the same as the cell line in 11 microsatellite markers.
  42. Future Activities Transfection of Boran BEFs line (Roslin Institute, UK) Establish Apol-I Transgenic Boran by Nuclear Transfer with Transgenic Cells Phenotyping (confirm Tryps resistance) •  Apol-I expression pattern •  Killing of Trypanosomes in vitro (serum) and in vivo (challenge) •  Monitor the health conditions with growth Increase Genetic Diversity •  Establish more transgenic cattle with Kenya Boran BEFs lines •  Establish transgenic cattle with other Kenyan indigenous breeds Transgene Delivery •  Develop a breeding programme to disseminate the transgene with farmers Regulatory, legal, safety & public awareness issues
  43. Future Activities Tumaini A cloned Kenya Boran calf made by SCNT from a Boran embryo fibroblast cell line Cloned NOT transgenic
  44. Current and future animal vaccine research activities at ILRI Vaccine  Biosciences   Interna.onal  Livestock  Research  Ins.tute   Seminar  at  CAVS,  Kabete  Campus,  5th  June  2013    
  45. Importance  of  animal  health  research  in   the  developing  world   Ø Livestock offer a powerful pathway out of poverty for ~750 million poor farmers in South Asia and Africa by providing nutritional and economic security. Ø Infectious livestock diseases feature prominently among the constraints faced by livestock agriculture. •  Endemic diseases •  Epidemic/pandemic diseases •  Trans-boundary diseases •  Emerging and re-emerging diseases •  Zoonotic diseases and food safety Ø For many reasons diseases are neglected problems in affected countries, a situation exacerbated by a general lack of investment, vaccine R & D and manufacturing capacity.
  46. List  of  current  ILRI  high  priority   diseases  targeted  for  control   Ø African swine fever (ASF) – swine •  African disease threatens the global $150 billion/year pig industry Ø Contagious bovine pleuropneumonia (CBPP) – cattle •  Regional losses to CBPP amount to ~ $60 million/year Ø East Coast fever (ECF) – cattle •  Regional losses exceed $300 million/year; kills ~ 1million cattle/year Ø Peste de petits ruminants (PPR) – small ruminants •  Losses in Kenya alone amount to ~ $13 million/year Ø Rift Valley Fever (RVF) – small ruminants, cattle and human •  2006/7 outbreak in Kenya cost ~ $30 million •  309 human cases in Kenya, Somalia and Tanzania; 140 deaths Vaccines save lives and livestock and contribute to food security and poverty alleviation
  47. Socio-­‐economic  impact  of  East  Coast  fever    in  sub-­‐Saharan  Africa     Ø ECF present in 11 countries; it could spread to 8 more Ø ~46 million cattle in region; ~28 million at risk Ø ~1million deaths/year; losses > 300 $ million Ø Small-holder farmers who would benefit: ~ 20
  48. Theileria  parva    life  cycle     R. appendiculatus schizont-infected cells sporozoites piroplasms merogony
  49. An  infec.on  and  treatment  vaccine   A live vaccine for the control of ECF (Muguga cocktail) Problems: Liquid nitrogen cold chain, cost, immunological types
  50. Immune  responses  that  contribute  to   immunity   Anti-sporozoite Anti-schizont
  51. An.-­‐sporozoite  immunity:  p67  can  induce   immunity  to  ECF   p67N p67M p67C 21 225 226 571 572 651 9 709 reduction in severe ECF by 50% in lab (25% immunity in field) Average
  52. A  classical  CD8+  cytotoxic  T  cell  response  to   the  schizont  stage  of  T.  parva   CTL P CTL P T cell receptor (TCR) on CTL recognizes parasite peptide associated with MHC class I molecules
  53. Flowchart  of  CTL  an.gen  discovery   ACTGGTACGTAGGGCATCGA TCGACATGATAGAGCATATA GCATGACGATGCGATCGACA GTCGACAGCTGACAGCTGAG GGTGACACCAGCTGCCAGCT GGACCACCATTAGGACAGAT GACCACACACAAATAGACGA TTAGGACCAGATGAGCCACA TTTTAGGAGGACACACACCA Bioinformatics tools Predict ~ 5000 gene sequences & list candidate vaccine antigens Clone genes of vaccine interest Filter genes via immunological assays T. parva genome sequence A Random cDNA library B Candidate CTL antigens Map CTL epitopes
  54. Mapped  parasite  CTL  an.gens/epitopes   CTL epitope Peptide sequence MHC class I gene BoLA sero-type Tp1214-224 VGYPKVKEEML N*01301 A18 (HD6) Tp227-37 SHEELKKLGML T2b~ Tp249-59 KSSHGMGKVGK N*01201 A10 (T2a) Tp296-104 FAQSLVCVL T2c~ Tp298-106 QSLVCVLMK N*01201 A10 (T2a) Tp4328-336 TGASIQTTL N*00101 A10 (5.1) Tp587-95 SKADVIAKY T5~ Tp7206-214 EFISFPISL T7~ Tp8379-387 CGAELNHFL N*00101 A10 (5.1)
  55. NetMHCpan  –  an  ar.ficial  neural  network   to  predict  CTL  an.gens/epitopes   Center for Biological Sequence Analysis at the Technical University of Denmark Incorporates correlated effects Morten Nielsen
  56. Use  of  pep.de-­‐MHC  tetramers  in  ECF   CD8+ Perforin+ Tp1+ cells CTR CTR BB007 BB007
  57. Diversity  of  BoLA  MHC  class  I  genes?   Cattle - multiplex RNA isolation from PBMCs 454 pyrosequencing RT-PCR Full length cDNAExon 2- Exon 3 • High throughput • Rare variants Nicholas Svitek – post-doc
  58. Genotypic  diversity  –  a  hallmark  of  T.  parva,   can  compara.ve  genomics  help?   Muguga, Marikebuni, Uganda ~ 64,000 SNPs SNP distribution: ~ 65% exons, ~15% introns, ~ 20% inter- genic 81/4076 genes under positive selection (includes Tp2) [Henson et al., BMC Genomics 13: 503, 2012] Joana da Silva – hybrid capture NGS Sequencing more cattle and buffalo derived parasites
  59. An.-­‐schizont  immunity:  trial  of  Tp  an.gens   Graham et al., PNAS, 2006: 30% vaccinated cattle
  60. We  need  beXer  methods  to  generate   immune  responses  in  caXle   Anti-sporozoite Anti-schizont Exploring vaccination systems New adjuvants Viral vectored systems Old & new antigens
  61. A  porholio  of  innova.on  and  vaccine   related  technology  plahorms   Yeast&with&M.#myc&LC& genome& (Delete&puta5ve&& virulence&factors)& Less&virulent&M.#myc&LC& ACTGGTACGTAGGGCATCGA TCGACATGATAGAGCATATA GCATGACGATGCGATCGACA GTCGACAGCTGACAGCTGAG GGTGACACCAGCTGCCAGCT GGACCACCATTAGGACAGAT GACCACACACAAATAGACGA TTAGGACCAGATGAGCCACA TTTTAGGAGGACACACACCA Bioinformatics tools Predict gene sequences and list candidate vaccine antigens Test experimental vaccine Clone genes of vaccine interest (100’s of genes) Filter genes via immunological assays Pathogen genome mining (1000’s of genes) Molecular immunology tools to assess immune responses in cattle (10’s genes) BASIC&RESEARCH& Increasing&our& knowledge&base& & “Knowledge*lays*the* founda2on*for*science”*** ! !  Map&immune&responses&to& infec>on& !  Dissect&pathogen&biology&&& diversity& !  Study&hostDvectorD pathogen&interac>ons& !  Characterize&pathogen& virulence&factors& !  Inves>gate&the& epidemiology&of&disease& !  Iden>fy&vaccine&and& diagnos>c&molecules& & & & & & APPLIED&RESEARCH& Developing&new& vaccines&&&diagnos>cs& & “Vaccines*are*cost8effec2ve* an28disease*inven2ons”* & !  Assess&candidate&subunit& vaccines& !  Assess&aHenuated& pathogen&vaccines& !  Assess&different&vaccina>on& systems& !  Engineer&thermoDstable& vaccine&formula>ons& !  Develop&smarter&easier&to& use&diagnos>c&tests& !  Facilitate&transla>on&of& outputs&to&products& BASIC&RESEARCH& Increasing&our& knowledge&base& & “Knowledge*lays*the* founda2on*for*science”*** ! !  Map&immune&responses&to& infec>on& !  Dissect&pathogen&biology&&& diversity& !  Study&hostDvectorD pathogen&interac>ons& !  Characterize&pathogen& virulence&factors& !  Inves>gate&the& epidemiology&of&disease& !  Iden>fy&vaccine&and& diagnos>c&molecules& & & & & & APPLIED&RESEARCH& Developing&new& vaccines&&&diagnos>cs& & “Vaccines*are*cost8effec2ve* an28disease*inven2ons”* & !  Assess&candidate&subunit& vaccines& !  Assess&aHenuated& pathogen&vaccines& !  Assess&different&vaccina>on& systems& !  Engineer&thermoDstable& vaccine&formula>ons& !  Develop&smarter&easier&to& use&diagnos>c&tests& !  Facilitate&transla>on&of& outputs&to&products&
  62. Acknowledgments   Large number of past and current scientists at ILRI (Evans Taracha et al) and collaborators (LICR, Oxford Uni, Merial) Immuno-informatics approach: John Barlow – University of Vermont Bill Golde – USDA-ARS (Plum Island) Soren Buus – University of Copenhagen Morten Nielsen - Technical University of Denmark ILRI CRP funds TIGR and Craig Venter DFID NSF-BMFG (BREAD program) USAID – Feed the Future via USDA-ARS
  63. The presentation has a Creative Commons licence. You are free to re-use or distribute this work, provided credit is given to ILRI. ilri.org Box 30709, Nairobi 00100, Kenya Phone: + 254 20 422 3000 Fax: +254 20 422 3001 Email: ILRI-Kenya@cgiar.org Box 5689,Addis Ababa, Ethiopia Phone: +251 11 617 2000 Fax: +251 11 617 2001 Email: ILRI-Ethiopia@cgiar.org other offices China • India • Mali Mozambique • Nigeria • Tanzania Thailand • Uganda • Vietnam Better lives through livestock ILRI is a member of the CGIAR Consortium BeFer  lives  through  livestock   ilri.org
  64. The presentation has a Creative Commons licence. You are free to re-use or distribute this work, provided credit is given to ILRI. ilri.org Box 30709, Nairobi 00100, Kenya Phone: + 254 20 422 3000 Fax: +254 20 422 3001 Email: ILRI-Kenya@cgiar.org Box 5689,Addis Ababa, Ethiopia Phone: +251 11 617 2000 Fax: +251 11 617 2001 Email: ILRI-Ethiopia@cgiar.org other offices China • India • Mali Mozambique • Nigeria • Tanzania Thailand • Uganda • Vietnam Better lives through livestock ILRI is a member of the CGIAR Consortium BeFer  lives  through  livestock   ilri.org
Advertisement