Hormonas- pdf

30,142 views

Published on

2 Comments
6 Likes
Statistics
Notes
No Downloads
Views
Total views
30,142
On SlideShare
0
From Embeds
0
Number of Embeds
66
Actions
Shares
0
Downloads
537
Comments
2
Likes
6
Embeds 0
No embeds

No notes for slide

Hormonas- pdf

  1. 1. Mecanismos de acción hormonal Comunicación intercelular mecanismos endocrinos y neurológicos (regulación neuroendocrina) Hormonas: - Mensajeros químicos que se sintetizan y secretan en un lugar preciso (glándula) en respuesta a un estímulo interno o externo. - Viajan por sangre o líquido intercelular hasta la célula diana. - Se unen a receptores de membrana o intracelulares (proteínas) con una afinidad muy alta: funcionan a concentraciones muy bajas (del orden nanomolar o inferiores) - Se activa una cascada de transducción de señales: 1- Modifican la expresión génica. 2- Modifican el metabolismo (modificación de enzimas). Funciones del sistema endocrino 1- Coordinación de la actividad metabólica y del crecimiento de los distintos tejidos 2- Mantenimiento de la homeostasis (insulina y control de los niveles de glucosa sérica) 3- Adaptación y respuesta al medio externo (adrenalina y susto o peligro) 4- Ejecución de programas cíclicos o de desarrollo (andrógenos, estrógenos y desarrollo de los caracteres sexuales secundarios)
  2. 2. El sistema endocrino: un mecanismo de comunicación intercelular a distancia 1- Comunicación autocrina: 2- Comunicación paracrina: Célula productora = célula diana Célula productora cerca de célula diana 3- Comunicación endocrina: Célula productora lejos de célula diana
  3. 3. Clasificación 1. FISIOLÓGICA: consecuencia final de la acción hormonal. 2. ANATÓMICA-TOPOGRÁFICA: relaciones órgano-tejidos (eje hipotálamo-hipófisis). 3. QUÍMICA: naturaleza química de la hormona 4. BIOQUÍMICA: mecanismo molecular de acción de la hormona y su receptor Clasificación anatómica-topográfica: Hipotálamo Hipófisis Glándula pineal Paratiroides Tiroides Timo Corazón Tracto gastrointestinal Páncreas Corteza suprarrenal Médula suprarrenal Riñones Ovarios Placenta Testículos
  4. 4. SISTEMA NERVIOSO PRINCIPALES SISTEMAS ENDOCRINOS (estrés, fármacos, osmorreceptores, factores ambientales, etc.) Y SUS TEJIDOS DIANA HIPOTÁLAMO Somato- Somatos- Tiroliberina Cortico- Gonado- Oxitocina, liberina tatina (TSHRH) liberina liberinas vasopresina (GHRH (GHIH) (ACTHRH) (LHRH) (FSHRH) HIPÓFISIS ANTERIOR H. POSTERIOR GH GH TSH ACTH LH Vasopresina FSH oxitocina GLÁNDULAS ENDOCRINAS Corteza Ovarios, Hígado Tiroídes suprarrenal testículos Mineral Estrógenos, Somatomedinas Tiroxina corticoides andrógenos, Gluco- progesterona A,B,C corticoides Prolactina Células o tejidos diana
  5. 5. Clasificación química: En función de su naturaleza química. - Aminoácidos: adrenalina, noradrenalina... ● Noradrenalina ● Adrenalina - Péptidos: oxitocina, vasopresina, MSH, ACTH.. ACTH: NH2-SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF-OH - Proteínas: insulina, glucagón, calcitonina, H del crecimiento... - Lípidos: PG, glucocorticoides, mineralcorticoides, H gonadales...
  6. 6. Clasificación bioquímica: Mecanismo molecular de acción del R (de membrana o intracelular). 1- Receptores Tyr quinasa: 2- Receptores acoplados a proteínas G: Proteína quinasas activadas por ligando Dependientes de la activación de una proteína transductora trimérica con capacidad de unión de GDP/GTP A menudo activan proteína quinasas por medio de un segundo mensajero
  7. 7. 3- Receptores de hormonas esteroides: Factores de transcripción controlados por ligando
  8. 8. 1- Receptores Tyr quinasa: Proteína quinasas activadas por ligando Cara extracelular Membrana plasmática P P P P P Proteínas adaptadoras P P P P Cara citosólica Proteína Proteína Inactiva Activa
  9. 9. 2- Receptores acoplados a proteínas G: Estado de reposo (OFF) Recepción y transmisión de señal (ON) Molécula señal Enzima Proteína G activada activada
  10. 10. LA CASCADA DEL AMPc/PKA M A LGL T PTS V Q A NL QSGQ QNAA S RR P I GL L T VARAA L AG L V PTC RC Q PEH G A AV L GA LQ V LL C C D C L E E H L F I V LL N D V V V LT I K S I L I I D Y V HLL NF LG S ET V Y LFN CTV F I F GPF Adenilato FLD LGS LVA SGN SS I LTA VVS MA F LV L WC F AL L NC I SSM VAL I FL VSL VLS LCL SAF GL F A I I ciclasa NE L ALV LSL ALD AGF A I V A VW LY LM M V LTL LP I I YD I AL H TV I TAV F I C V A A A A V CYC D R R F Gsα A I K M P R Y R A A C GK L HV H S LK C NR S I R Q GFG Q P Q T E T S NL H P H E R VL W S R I L A Q LR ATP F Y A T V I QG A L H K R I R β Gsα L S cAMP RYH γ Fosforilación de dianas proteicas PKA inactiva Subunidad Complejo subunidades Subunidad reguladora catalítica inactiva reguladoras-cAMP Subunidades Efectos intracelulares catalíticas activas
  11. 11. 2º mensajero HIDRÓLISIS DE GTP INACTIVACIÓN DE AC SUBUNIDAD α Y DISOCIACIÓN DE PROT. DIANA ADENILATO CICLASA AC cAMP FOSFO- DIESTERASA AC REASOCIACIÓN DE SUBUNIDAD α AL COMPLEJO βγ PROTEÍNA G INACTIVA AC
  12. 12. LA CASCADA DEL DIACILGLICEROL/PKC PI PI(4)P PI (4,5) P2 Cara interna de la bicapa lipídica de la mb plasmática ACTIVA PROTEIN QUINASA C (PKC) LIBERA Ca2+ DEL RETÍCULO PLASMÁTICO
  13. 13. Receptores intracelulares Hormonas liposolubles: - Secretadas en función de la demanda, no se almacenan. -Se transportan con transportador específico: Corticosteroides y mineralcorticoides Sexuales Vitamina D Tiroideas -Tejido diana difunden a través de la membrana, se unen a R intracelulares (citoplasmáticos o nucleares) dimerización y unión a “elementos de respuesta” (HRE), que se encuentran en los promotores de genes regulado (modulación de su transcripción).

×