Successfully reported this slideshow.
We use your LinkedIn profile and activity data to personalize ads and to show you more relevant ads. You can change your ad preferences anytime.

Vvedenie v bioinformatiku_5_3

291 views

Published on

  • Be the first to comment

  • Be the first to like this

Vvedenie v bioinformatiku_5_3

  1. 1. Анализ белковой последовательности Анализ только аминокислотной последовательность (первичную структуру) белка без боковых цепей.  Предсказание физико-химических параметров белка  Предсказание продуктов расщепления протеазами  Гидрофобные, гидрофильные участки: например, трансмембранные сегменты  Пост-трансляционные модификации  Функциональные домены, принадлежность к функциональным семействам  Фолдинг  Клеточная локализация
  2. 2. Анализ белковой последовательности The ExPASy server – протеомика http://www.expasy.ch/tools/#primary  The Swiss EMBnet – coiled-coil участки, выравнивания и др. http://www.ch.embnet.org  The CBS Prediction Servers – локализация, пост-трансляционные модификации… http://www.cbs.dtu.dk/services
  3. 3. ProtParam - предсказание физико-химических параметров белка
  4. 4. ProtParam Молекулярный вес Аминокислотный состав Extinction coefficient – коэффициент поглощения (280 nm) Instability (менее 40 – хорошо) – нестабильность в эксперименте (test tube, статистика дипептидов) Half-life (yeast in vivo, mammalian reticulocytes in vitro, Escherichia coli in vivo) Алифатический индекс Grand average of hydropathicity (GRAVY) гидрофильность – (-), гидрофобность – (+)
  5. 5. Compute pI/Mw
  6. 6. PeptideMass
  7. 7. PeptideMass - output
  8. 8. PeptideCutter
  9. 9. PeptideCutter - output
  10. 10. PeptideCutter - output
  11. 11. Метод скользящего окна Анализируется последовательность в несколько аминокислот, параметр усредняется по окну. Значение приписывается средней аминокислоте. Output – график Seq. LQAPVLPSDLLSWSCVGAVGILALVSFTCV <---*---> Window 1 <---*---> Window 2 <---*---> Window 3 Размер окна должен соответствовать характерному размеру анализируемого свойства (для ТМ – 19!) Методы, основанные на технике скользящего окна, как правило, не интерпретируют результаты. При интерпретации важно:  Учитывать только очень четко выраженные сигналы  Не зависящие от параметров программы – размера окна, конкретного метода и т.п.
  12. 12. Предсказание трансмембранных сегментов: ProtScale 56 аминокислотных шкал (с литературными ссылками), скользящее окно -> выбор ширины окна
  13. 13. ProtScale - output
  14. 14. Более сложное предсказание трансмембранных сегментов: TMHMM Transmembrane beta barrel prediction: PROFtmb (http://rostlab.org/services/proftmb ); PRED-TMBB (http://biophysics.biol.uoa.gr/PRED-TMBB/); TBBPred (http://www.imtech.res.in/raghava/tbbpred )
  15. 15. TMHMM - результаты TMHMM предсказывает сегменты, а также топологию межсегментных участков Нашёл 7 TMs
  16. 16. Домены • Домен – независимая глобулярная единица в белке. Более функционально – часть белка, обладающая активностью (если отрезать, например). Как правило, каждый домен играет свою роль в функции белка (связывает ион или ДНК, содержит активный сайт и т.п.) • Только небольшая часть известных доменов была изучена экспериментально, остальные описаны как сходные части гомологичных белков • Очень сложно четко определить домен и его границы => существует много подходов и различных доменных коллекций. Какую выбрать?
  17. 17. История коллекций доменов 1980ые – PROSITE: ручная выборка паттернов в белках, определяющих функцию 1987 – доменный профайл (Gribskov): position specific scoring schema – это вероятность для каждой аминокислоты находиться в данной позиции домена  начало 1990х – BLOCKs, PRINTs, Prodom…  PfamA – коллекция профайлов, курированная вручную (сейчас также использует HMM)
  18. 18. Cерверы для поиска доменов InterProScan http://www.ebi.ac.uk/InterProScan CD (Conserved Domain) server (NCBI) http://www.ncbi.nlm.nih.gov/Structure/cdd/wrpsb.cgi Pfscan http://hits.isb-sib.ch/cgi-bin/PFSCAN Domac http://www.bioinfotool.org/domac.html Scooby http://www.ibi.vu.nl/programs/scoobywww/ Dompro http://www.ics.uci.edu/~baldig/domain.html
  19. 19. InterPro Database .
  20. 20. InterPro InterPro is a database of protein families, domains and functional sites in which identifiable features found in known proteins can be applied to unknown protein sequences. Базируется на первичных классификациях целого ряда баз данных функциональных доменов и семейств, объединяет всю доступную информацию С 2001 года – Release 18.0: 75.6% UniProt
  21. 21. Как это происходит Каждое InterPro семейство объединяет первичные семейства других баз данных, описывающие один и тот же домен; включает все белки, принадлежащие хотя бы одной из первичных баз. Документация семейства подробно описывает функцию и структуру соответствующей белковой подписи.
  22. 22. Поиск доменов: InterProScan
  23. 23. InterProScan - результаты
  24. 24. Table View
  25. 25. CD server Input - Accession number, gi или последовательность в FASTA формате
  26. 26. CD server – output Красный – SMART, синий – Pfam, зеленый – COGs Рваные концы указывают на неполные домены!!!! Курсор в графической части – краткое описание функции домена
  27. 27. CDART – поиск белков с аналогичной доменной структурой
  28. 28. Pfscan Как правило, работает несколько минут
  29. 29. Pfscan - output Особенности вывода Pfscan • Схема – легенда, как всегда под рисунком • За легендой следует таблица с локализацией доменов • Далее расшифровка каждого хита – с оценкой вероятности • Затем следует графическая схема для каждого хита и scores (высокий score = хороший хит)
  30. 30. Structure Classification Databases 3D structural similarities (~70%): • SCOP (MRC Cambridge) • CATH (University College, London) • Dali FSSP (EBI, Cambridge) • 3 Dee (EBI, Cambridge) FOLD recognition: • 3D-pssm • TOPITS (EMBL) • UCLA-DOE Structre Prediction Server (UCLA) • 123D • UCSC HMM (UCSC) • FAS (Burnham Institute) • UCLA-DOE Fold-Recognition Benchmark Home Page
  31. 31. SCOP-Structural Classification of Proteins • База данных содержит структурную и эволюционную информацию о взаимосвязях белков с известными структурами. • Классификация белков отражает структурные и эволюционные отношения. • Многоуровневая иерархия – семейство, суперсемейство и фолд. • Ручное инспектирование.
  32. 32. Superfamily: Probable common evolutionary origin Белки, имеющие низкую идентичность последовательностей, но чьи структурные и функциональные особенности позволяют предположить наличие общего предка, могут быть объединены в суперсемейства. Например, актин, the ATPase domain белков теплового шока и гексакиназы образуют суперсемейство Fold: Major structural similarity Общий фолд – одинаковая организация вторичной струкруры, с похожим пространственным расположением и с похожими соединениями. Белки с одинаковым фолдом зачастую имеют концевые элементы вторичной структуры , изгибы и повороты различных разметов и конформаций (до половины всей структуры). Белки, объединённые одним фолдом, могут не иметь общего предка (химия, физика  упаковка и топология) SCOP
  33. 33. SCOP Family: Clear evolutionarily relationship Белки, сгруппированные в семейство, тесно связаны эволюционно. Это значит, что парное выравнивание показывает 30% и выше. Иногда похожие функция и структура показывают наличие общего предка и при отсутствии высокой идентичности последовательностей; например, многие глобины образуют семейство, хотя некоторые из них имеют идентичность 1D ~ 15%.
  34. 34. Archetype Structures of Domains
  35. 35. Поиск по SCOP
  36. 36. SCOP
  37. 37. CATH (Brookhaven protein databank ) • Class, Architecture, Topology, Homology database – иерархическая классификация доменов структур белков Формируется автоматически, но инспектируется вручную
  38. 38. CATH Class, C-level – Класс определяется в соответствии с набором и упаковкой вторичной структуры. Он может быть присвоен как автоматически (90% of the known structures), так и вручную. – 3 главных класса: преимущественно-alpha преимущественно-beta alpha-beta (alpha/beta and alpha+beta) Четвертый класс – белки, содержащие домены без выраженной структуры..
  39. 39. CATH Architecture, A-level • Описывает общий вид доменной структуры, определяемой как ориентация элементов вторичной структуры, но без учета их соединений. • Присваивается вручную (используя простое описание структуры). • Разрабатываются способы автоматизации этого процесса. Topology (fold family), T-level • Структуры группируются в зависимости как от общего вида, так и от соединений элементов вторичной структуры. Алгоритмы сравнения структур.
  40. 40. CATH Homologous superfamily, H-level • Этот уровень объединяет белки, которые, по-видимому, имеют общего предка (гомологи). • Похожесть и идентичнсть – сначала по сравнению последовательностей, затем – сравнение структур. Sequence families, S-level • Структуры в каждом H-level затем группируются по идентичности последовательностей. • Домены, объединенные в семейства последовательностей, имеют идентичноcть 1D >35% , что показывает похожие структуру и функции.
  41. 41. SCOP / CATH SCOP CATH class class architecture fold topology homologous superfamily superfamily family sequence family domain domain CATH - преимущественно структурная классификация, SCOP - эволюционные взаимосвязи CATH - один класс, представляющий смешанную α-β структуру SCOP - 2 класса: α/β: beta структуры параллельны, образуют βαβ мотивы α+β: alpha и beta структуры присутствуют в различных частях протеина
  42. 42. SCOP / CATH -> DALI SCOP & CATHSCOP & CATH • Иерахические, базирующиеся на абстракциях • Создаются (частично) и курируются вручную экспертами Presentation of results of the classification, where the methods that underlie the classification remain internal Structure comparison
  43. 43. DALI α/β β α anti parallel β barrel α β meand er More information about DALI Touring protein fold space with Dali/FSSP: Liisa Holm and Chris Sander Comparing protein structures in 3D
  44. 44. DALI • The FSSP database (Fold classification based on Structure-Structure alignment of Proteins) базируется на all-against-all сравнении 3D структур белков в Protein Data Bank (PDB). Классификация и выравнивание структур автоматически поддерживается и обновляется сервисом Dali search engine. Dali Domain Dictionary • Структурные домены выделяются автоматически. Каждый получает Domain Classification number.
  45. 45. DALI Fold types • Типы фолдов – кластеры структур в пространстве фолдов с средним парным Z-scores (by Dali) выше 2. Высокий Z-score соответствует структурам с близкой архитектурой.
  46. 46. DALI • Базируется на выравненных 2D матрицах внутримолекулярных дистанций • Считает лучший subset соответствующих аминокислот в двух белках – максимальная похожесть 2D матриц дистанций • Поиск по всем возможным выравниваниям остатков – Monte-Carlo и branch- and-bound algorithms An intra-molecular distance plot for myoglobin
  47. 47. Pfam Database Pfam – коллекция результатов множественного выравнивания последовательностей и HMM, содержащая большое количество доменов и семейств белков. Для каждого семейства в Pfam: •Просмотреть результаты MSA •Увидеть архитектуру доменов •Распределение по видам •Перекрестные ссылки •Получить известные 3D структуры •Pfam can be accessed directly or from the PDB description.
  48. 48. Homstrad Database •HOMologous STRucture Alignment Database •Предоставляет выровненные 3D структуры гомологичных белков. •Homstrad - структурный эквивалент Pfam. Вначале структуры белков поступают из PDB, кандидаты семейств традиционно идентифицируются поиском по Pfam. Используются определения доменов из SCOP и информация о белках собирается из SwissProt, Pfam and Interpro. • Аннотирование – в программе Joy, которая предоставляет следующую информацию: • Тип вторичной структуры • Относительную доступность боковых цепей • Наличие водородных связей между амидом и карбонилом • Дисульфидные связи •Положительные phi торзионные углы
  49. 49. PClass Database Инструмент для классификации, базирующийся на иерархии 600 белков- представителей из PDB. Структурное выравнивание 600 структур было выполнено при помощи алгоритма 3dSearch.
  50. 50. 3D Structure Validation Теория: Белки – молекулы несложные: - Линейная структура цепей. - Только 20 различных аминокислот. На практике: Мы не понимаем в деталях механизм сворачивания белковых структур. Единственные «силы», используемые для уточнения, «улучшения» новой структуры – это данные измерений и некоторые факты, присущие для ВСЕХ молекул В общем случае используемая информация недостаточна для распознавания уникальной структуры. Значительная часть работы по уточнению структуры – взгляд эксперта и ручные корректировки. Белки содержат тысячи атомов и невозможно постоянно выполнять ручные корректировки. Это – источник неправильных структур и «слабых мест» в глобьально верных структурах.
  51. 51. Оценка качества стереохимии «Исходя исключительно из координат атомов, есть ли методы, дающие оценку общему стереохимическому качеству структуры? Такие методы могут оказаться полезными для идентификации неправильно построенных структур во время циклов уточнения, или после завершения моделирования. Большинство PDB файлов содержат некоторую авторскую информацию о параметрах кристаллографии. В то же время эта информация обычно короткая, количественная не готовая к machine-reading и не предоставляет качественных оценок надёжности предоставленной структуры». Morris et al (PROTEINS: Structure, Function, and Genetics 12:345-364, 1992) Очень полезная информация для верификации посылаемой структуры белка Introduction to structure verification http://www.cmbi.kun.nl/gv/pdbreport/checkhelp/
  52. 52. Мы можем использовать эту PDB структуру? Год публикации Разрешение X-ray структуры Проблемные остатки (отсутствующие аминокислоты/атомы/боковые цепи) Растворитель/вода Какая цель?
  53. 53. Важные параметры Judging the Quality of Macromolecular Models http://www.cmbi.kun.nl/gv/pdbreport/checkhelp/ R-factor: величина, показывающая согласие между кристаллографической моделью и полученными данными X-ray. Оценивая построенную модель кристаллографер рассчитывает ожидаемую интенсивность рефлексов в образце дифракции и затем сравнивает его с экспериментальными данными, содержащими измеренные позиции и интенсивности. -R-factor используется для проверки прогресса в уточнении структуры. Финальный R-factor – единая мера качества модели. Чем меньше, тем лучше. Разрешение: В X-ray кристаллографии "2-Å model" означает, что модель учитывает дифракцию в группе одинаковых, параллельных плоскостей с атомами с промежутком в 2 Å. Точность атомных позиций: В кристаллографии, в отличии от световой микроскопии, термин «разрешение» означает количество данных, в конечном счете используемое для определения структуры. Напротив, точность атомной позиции частично зависит от разрешения, но в большей степени зависит от качества данных – R-factor. - Хорошие данные могут приносить атомные полиции с точностью 0.2–0.1 от заявленного разрешения.
  54. 54. WHAT IF WHAT IF – CMBI (Centre for Molecular and Biomolecular Informatics) CHECK - качество структуры/модели белка FULCHK – наиболее подробный отчёт о проверке. Производимые проверки – от простых проверок длин связей, торзионных углов и проверок поверхности до глубокого анализа контактов и сети водородных связей. Stand alone versions: Unix, Windows Server: WHAT_CHECK http://www.cmbi.kun.nl/gv/whatcheck/ Может посчитать и некоторые свойства: Атомарные дистанции, столкновения, окружения, контакты с водой, «внутренняя» вода, водородные связи…..
  55. 55. WHAT_IF Validation Parameters 1. Доступность боковых цепей 2. Длины связей – данные экспериментов 3. Углы связей – данные экспериментов 4. Торзионные (трёхгранные) углы, Phi/Psi (ramachandran plot) – данные экспериментов 5. Планарность боковых цепей у His, Phe, Tyr – данные экспериментов 6. Хиральность (D or L) – данные экспериментов 7. Ротамеры (χ-1 and χ-2 комбинации) - моделирование 8. Столкновения атомов – данные экспериментов 9. Абсолютное внутреннее/внешнее распределение аминокислот 10. Погруженные доноры водородов – данные экспериментов 11. Упаковка (сравнение с базами данных) http://www.cmbi.kun.nl/~richardn/intromodelValidation.html
  56. 56. The PDBREPORT Database The PDBREPORT Database http://www.cmbi.kun.nl/gv/pdbreport/ Index of all diagnostic messages http://www.cmbi.kun.nl/gv/pdbreport/pdbreport/revindex.html
  57. 57. WHAT_CHECK Criteria Peptide-Pl: RMS distance of the backbone oxygen from the oxygen in similar backbone conformations found in the database, distances in the range [3..1] are mapped to [0..9] Rotamer: Probability that the sidechain rotamer (chi-1 only) is correct, probabilities in the range [0.1 .. 0.9] are mapped to [0..9] Chi-1/Chi-2: Z-score for the sidechain chi-1/chi-2 combination, Z-scores in the range probabilities in the range [-4..+4] are mapped to [0..9] Bumps: Sum of bumps per residue, distances in the range [0.1 .. 0] are mapped to [0..9]. Packing 1: First packing quality Z-score, Z-scores in the range [-5..+5] are mapped to [0..9]. Packing 2: Second packing quality Z-score, Z-scores in the range [-3..+3] are mapped to [0..9]. In/Out: Absolute inside/outside distribution Z-score per residue, Z-scores in the range [4..2] are mapped to [0..9]. H-Bonds: 9 minus number of unsatisfied hydrogen bonds, 2 is subtracted for buried backbone nitrogen, 5 for buried sidechain. Flips: Indicates flipped Asn/Gln/His sidechain, 9=OK, 0=needs flipping.
  58. 58. WHAT_CHECK Criteria Access: Relative side chain accessibility, 0=buried, 9=exposed. Quality: Several quality estimators from the PDBREPORTs.0=is oh no, 9=perfect. B-Factors: Crystallographic B-factors, the range [10..60] is mapped to [9..0] Bonds: Absolute Z-score of the largest bond deviation per residue, absolute Z-Scores in the range [5..2] are mapped to [0..9]. Angles: Absolute Z-score of the largest angle deviation per residue, absolute Z-Scores in the range [5..2] are mapped to [0..9]. Torsions: Average Z-score of the torsion angles per residue, Z-Scores in the range [-3..+3] are mapped to [0..9]. Phi/Psi: Ramachandran Z-score per residue, Z-Scores in the range [-4..+4] are mapped to [0..9]. Planarity: Z-score for the planarity of the residue sidechain, Z-Scores in the range [6..2] are mapped to [0..9]. Chirality: Average absolute Z-score of the chirality deviations per residue, average absolute Z- Scores in the range [4..2] are mapped to [0..9]. Backbone: Number of similar backbone conformations found in the database, numbers in the range [0..10] are mapped to [0..9]
  59. 59. Procheck http://www.biochem.ucl.ac.uk/~roman/procheck/procheck.html Procheck – программа и сервер для проверки геометрии структуры белка. 1. Геометрия ковалентных связей 2. Планарность 3. Торзионные углы 4. Хиральность 5. Нековалентные взаимодействия 6. Водородные связи основной цепи 7. Дисульфидные мостики 8. Сравнение параметров 9. Поаминокислотный анализ
  60. 60. Procheck. Отчёты
  61. 61. PDB Validation Tools Ad it! http://pdb.rutgers.edu/validate/ The PDB Validation Suite - набор инструментов, используемый в PDB для обработки и проверки структурных данных http://pdb.rutgers.edu/mmcif/VAL/index.html
  62. 62. ERRAT •ERRAT - алгоритм верификации белковых структур, который особенно подходит для оценки процесса построения и улучшения моделей в кристаллографии. • Программа анализирует статистики нековалентных взаимодействий между атомами различных типов. • Общая диаграмма даёт значения функции ошибки (скоринг) vs позиция 9-residue окна. Путём сравнения с статистиками из очень качественных структур функция ошибки калибруется. http://www.doe-mbi.ucla.edu/Services/Errat.html
  63. 63. PROVE • PROVE: PROtein Volume Evaluation, a validation package • PROVE - ПО для проверки качества атомарной модели макромолекулярной структуры • Базируется на расчете атомных объемов. PROVE считает объемы атомов в макромолекуле, используя алгоритм SURVOL (SURVOL обрабатывает атомы как твёрдые сферы с определенными радиусами, зависящими от типа атома) • Использовались высококачественные структуры для выяснения ожидаемых (средних) объемов погруженных атомов. • Отклонения в атомных объемах оценивается в Z-score (how many standard deviations their volume is away from the mean for that atom type). Ожидаемое Z-score – 0. http://www.ucmb.ulb.ac.be/UCMB/PROVE/
  64. 64. Biotech Validation Suite Biotech Validation Suite – EMBL http://biotech.ebi.ac.uk:8400/
  65. 65. SAV SAV- Structure Analysis and Verification Server http://www.doe-mbi.ucla.edu/Services/SV/ Information about the server – Before you start http://www.doe-mbi.ucla.edu/Services/SV/Info.php
  66. 66. Способы визуализации
  67. 67. Для чего визуализация? ALLSFERKYRVRGGTLIGGDLFDFWVGPYFVGFFGVSA IFFIFLGVSLIGYAASQGPTWDPFAISINPPDLKYGLAAPL LEGGFWQAITVCALGAFISWMLREVEISRKLGIGWHVP LAFCVPIFMFCVLQVFRPLLLGSWGHAFPYGILSHLDW VNNFGYQYLNWHYNPGHMSSVSFLFVNAMALGLHGGL ILSVANPGDGDKVKTAEHENQYFRDVVGYSIGALSIHRL GLFLASNIFLTGAFGTIASGPFWTRGWPEWWGWWLDI PFWS
  68. 68. An Introduction to Protein Architecture By A. M. Lesk
  69. 69. Инструменты визуализации RasMol / RasTop Chime Protein Explorer Cn3D YASARA WebLab Viewer SwissPDB Viewer VMD DINO
  70. 70. RasMol
  71. 71. RasTop
  72. 72. Chime • Plugin для Netscape Communicator и других браузеров • Основное предназначение – позволяет визуализировать биомолекулы на компьютерах, лишённых каких-либо других инструментов для структурной биологии, работает как надстройка в браузере. • Подобен RasMol, но не поддерживает командной строки • Дополнительная информация доступна по http://www.umass.edu/microbio/chime/chimehow/chimeho w.htm • Не включает дополнений и усовершенствований RasMol
  73. 73. Protein Explorer •Улучшенная версия RasMol •Графический интерфейс похож на Chime, но с более развитой системой помощи и автоматизации •Доступен для работы новичкам, нет нужды изучать команды •Обеспечивает углублённое изучение молекул и их свойств для профессионалов
  74. 74. Protein Explorer
  75. 75. Protein Explorer
  76. 76. ExPASy
  77. 77. SwissPdbViewer - Deep view • Инструмент, обладающий огромными возможностями • Позволяет анализировать множественные структуры • Позволяет изменять углы химических связей и производить перенос атомов или групп атомов • Моделирование мутаций • Моделирование с использованием гомологов (при подключении к удалённому серверу) • Базовые минимизации энергии • Карты электронных полей
  78. 78. YASARA • Yet Another Scientific Artificial Application • Молекулярная графика на очень хорошем уровне • Моделирование и симуляции (not free!)
  79. 79. RasMol – Главное меню
  80. 80. RasMol - Дисплей
  81. 81. RasMol - Цвет
  82. 82. RasMol – Опции → Сечение
  83. 83. RasMol – Опции → Атомы H
  84. 84. RasMol – Опции → Зеркальная поверхность
  85. 85. RasMol – Опции → Тени
  86. 86. RasMol – Опции → Стерео
  87. 87. RasMol – Опции → Метки
  88. 88. RasMol - Экспорт
  89. 89. RasMol - Help
  90. 90. RasMol Manual RasMol 2.6 Manual http://www.umass.edu/microbio/rasmol/getras.htm#rasmanual RasMol 2.7 Manual http://www.rasmol.org/
  91. 91. RasTop• Download RasTop and install it. • Repeat RasMol assignment 2 with RasTop.
  92. 92. Swiss-PDBViewer Домашняя страница: http://ca.expasy.org/spdbv/ Руководство пользователя http://ca.expasy.org/spdbv/text/tutorial.htm.
  93. 93. Swiss-PDBViewer

×