Successfully reported this slideshow.
We use your LinkedIn profile and activity data to personalize ads and to show you more relevant ads. You can change your ad preferences anytime.
Введение в биоинформатику.
Современное положение.
Задачи и методы их решения.
Порозов Юрий. porozov@ifc.cnr...
План курса
• Введение в биоинформатику, цели, задачи и методы. Основные понятия. Аминокислоты, протеины и нуклеиновые кисл...
Биоинформатика - наука, занимающаяся анализом
экспериментальных данных молекулярной биологии:
секвенированных последовател...
Structural Genomics
Functional Genomics
Задачи биоинформатики
• Функциональная аннотация биополимеров
• Структурная аннотация биополимеров
• Эволюция
• Геномика и...
(дезоксирибонуклеиновые и рибонуклеиновые кислоты) –
обеспечивающих хранение, передачу из поколения в
Последовательность (sequence, первичная структура)– цепь из
мономеров (нуклеотиды или аминокислоты), составляющих ДНК, РНК...
Биополимеры – ДНК
Аденин Гуанин
Биополимеры - ДНК
J. Watson и F. Crick. Фото из
архива Photo Researchers inc.
Биополимеры - белки
Аминокислоты - органические соединения, в молекуле
которых одновременно содержатся карбоксильные и
Биополимеры - белки
Форматы файлов, используемых в
>roa1_drome Rea guano receptor type III >> 0.1
GenBankLOCUS SCU49845 5028 bp DNA PLN 21-JUN-1999
DEFINITION Saccharomyces cerevisiae TCP1-beta gene, partial cds, and Axl...
PDB – Protein Data Bank
HELIX 1 1 GLU A 5 THR A 9 5 5
HELIX 2 2 ALA A 37 YOF A 39 5 3
HELIX 3 3 PRO A 56 VAL A 61 5 6
HELIX 4 4 VAL A 68 SER A 72 ...
Способы визуализации
Определение структуры (координат атомов) белка:
1) Х-Ray кристаллография
2) Ядерно-магнитный резонанс...
X-ray кристаллография
1. Получение упорядоченных кристаллов белка.
2. Определение дифракции x-ray.
X-ray кристаллография
3. Анализ дифракционной картины даёт представление об
электронных плотностях.
4. «Нанизывание» извес...
1. Nuclear Magnetic Resonance - регистрация
релаксации ядер тяжёлых атомов в
магнитном поле.
а) Выравнивание яде...
3. Использует данные тысяч измерений
дистанций для построения модели
протеина с учётом ограничений.
Источники информации и базы
данных в Интернете
Типы баз данных
• Всеобъемлющие базы данных
• Организмоспецифические
• Молекулярноспецифические
• Дополнительные базы данн...
• Биологические базы данных росли последние 20 лет:
1. Избыточность: множественные записи.
2. Неверные последоват...
Пример GenBank
• GenBank, база данных последовательностей NCBI.
В 1982 году:
700,000 bp,
700 последовательностей.
В 2002 г...
Полные базы данных
Большие базы данных ДНК, РНК и белков.
Примеры: GenBank, EMBL, swissprot.
Имеется обмен информацией меж...
NCBI (National center for biotechnology information)
NCBI - GenBank
• GenBank: открытая база данных нуклеотидных и
аминокислотных последовательностей
• Источники информации:
NCBI - GenBank
GenBank поделён на подбазы:
1. Organism specific (Human, Bacteria, etc).
2. Molecule specific (DNA, RNA, pr...
Параллельная GenBank база данных.
Swiss prot
База данных белков:
1. Очень хорошо аннотированная.
2. Отсутствует избыточность.
3. Имеются перекрёстные ссылки...
Организмоориентированные базы
Молекулоспецифические базы
• Базы даных, ориентированные на группы молекул
GtRDB: The Genomic tRNA Database
PDB – Protein Data Bank
• Главная база данных 3D
структур белков
• Включает порядка 23,000
белковых структур.
• Белки орга...
SCOP - Structural Classification
Of Proteins
• Организована в соответствии со
структурными семействами белков.
• Иерархиче...
NCBI - Entrez
• Entrez - поисковая машина для баз NCBI.
• Поиск начинается с выбора адекватной области для
поикса (Nucleot...
NCBI - Entrez
SRS (Sequence Retrieval System).
• Исталлирована на множестве серверов.
• Имеет связи со многими базами данных.
• Предоста...
Рабочая среда
Выбор базы
формы запроса
Парное выравнивание
Все живое произошло от одного общего предка,
следовательно, все последовательности являются
На само...
||| | | |||| | ||||
Выравнивание (alignment) – сравнение д...
Какие задачи решает парное
• Нуклеотиды
– Изучение эволюционных связей
– Поиск генов, доменов, сигналов …
• ...
Точечный график
• Наиболее интуитивный метод для сравнения
• Использование слов вместо символов позво...
Парное выравнивание
Человеческий гемоглобин (HH):
Миоглобин кашалота (SWM):
Парное выравнивание - идентичность
||| | | || | |
Процент и...
Парное выравнивание - похожесть
||| . | | || | |
Процент по...
Парное выравнивание – вставка
промежутков (gaps)
 .      
Парное выравнивание – вставка
       
- вставка...
Парное выравнивание - подсчёт
Финальная оценка выравнивания – это сумма сумма
положительных очков и штрафных очков:
+ Коли...
Парное выравнивание - Scoring
||| . | | || || |
Final sco...
Парное выравнивание
• Алгоритмы парного выравнивания пробуют
все возможные варианты выравнивания.
• Результат – выравниван...
Система оценки - белки
• Идентичность: подсчитывается количество совпадений и
делится на длину выравниваемого региона
• Si...
Система оценки - белки
Похожесть: Положительная оценка для выравниваемых
аминокислот из одной и той же группы.
Парное выравнивание
• Матрицы для оценки – PAM и BLOSUM
• Системы оценки выравнивания различны
для белков и для ДНКРНК
Матрицы сравнения белков
Семейство матриц, которые отражают
вероятность замены одной аминокислоты
на другую во время эволю...
PAM матрица
• PAM матрица базируется на
последовательностях с 85% идентичности.
У близких белков функции не должны
сильно ...
PAM матрица
• PAM единицы отображают
эволюционную дистанцию.
• 1 PAM единица – вероятность 1
точечной мутации на 100 амино...
PAM 250
Парное выравнивание – методы
• Глобальное выравнивание – находит лучшее
решение для целых последовательностей.
PAM матрицы
Evolutionary distance
Observed %
1 1
11 10
23 20
38 30
56 40
80 50
120 60
159 70
250 80
BLOSUM Matrices
• Blocks Substitution Matrices.
Матрицы PAM обладают ограниченными
возможностями, так как их «рейтинги зам...
• Блоки – короткие стабильные образы «шаблоны»
по 3-60 aa длиной.
• Белки могут быть поделены на семейства по
Параметры по умолчанию
• Параметры для открытияпродления
промежутков индивидуальны для каждой
• PAM30: open=9, ext...
Параметры по умолчанию
Выравнивания будут сильно отличаться при
использовании различных параметров для
Для ка...
Параметры по умолчанию
Мы можем использовать выравнвание
последовательностей, базирующееся на структурном
выравнивании. В ...
Матрицы оценки DNA
• Похожесть нуклеотидов DNA
определить невозможно.
• Основания делятся на 2 группы: пурины
(A,G) и пири...
Матрицы оценки DNA
Мутации делятся на переходы (transitions) и
превращения (transversions).
Transitions – пурин на пурин, ...
Матрицы оценки DNA
• De-facto transitions происходят чаще.
Матрицы оценки DNA
Унифицированная матрица подстановок нуклеотидов:
A 2
G -6 2
C -6 -6 2
T -6 -6 -6 2
Матрицы оценки DNA
Неунифицированная матрица подстановок нуклеотидов:
A 2
G -4 2
C -6 -6 2
T -6 -6 -4 2
Глобальное выравнивание
• Алгоритм Needleman and Wunsch (1970)
• Находит выравнивание двух полных
Дано: 2 последовательности x[1…n] и y[1…m]
При выравниванииПри выравнивании x[1...i] ии y[1…j] есть 3 вариантаесть 3 вариа...
Recursive Relation
Scoring matrix s(a,b), s(−, x) = s(x,−) = −d
Fij – лучшая score-функция выравнивания x[1…i] and y[1…j]
Scoring scheme: s(a, a) = 1, s(a, b) = −1, if a ≠
b, and s(−, a) = s(a,−) =−2.
x : C T T A G A
y : G − T A − A,
x : C T T ...
Локальное выравнивание
• Алгоритм Smith and Waterman (1981).
• Выполняет оптимальное выравнивание наиболее
Recursive relations
Интересует выравнивание подстрок (последовательных сегментов).
Подстрока последовательности x1x2 . . ....
Выравнивание может не только окончиться, но и начаться в
любом месте матрицы.
Таким образом, вместо того, чтобы выб...
• Пара последовательностей.
• Локальное или глобальное
• Штрафы за вставкупродление промежутков
• Матрицы
• Как можно оценить достоверность
• Какое выравнивание лучше ?
A T - G C
A A - A ...
Оценка – подход bootstrap
Данные с тем же набором, но с разным
1. Перемешивание одной последовательности.
2. Пов...
Оценка - bootstrap
Shuffle one of
the sequences
Align with the
second sequence
Calculate mean and
standard deviation of
Оценка качества выравнивания
Сравниваем результат (оценку) нашего выравнивания
со средней оценкой выравнивания перемешанны...
Program output:
Gap Weight: 12 Average Match: 2.912
Length Weight: 4 Average Mismatch: -2.003
Quality: 1239 Length: 356
Gap : Глобальное выравнивание.
Bestfit: Локальное выравнивание.
Обе программы работают с одинаковым
набором данных (по...
Пример: Gap or Bestfit?
2 человеческих
transcription factors:
1. SP1 factor, binds to
GC rich areas.
2. EGR-1 factor, acti...
gap sw:egr1_human sw:sp1_human –ran=100
Gap uses the algorithm of Needleman and Wunsch to find the alignment of
two co...
Gap Output
GAP of: egr1_human check: 6989 from: 1 to: 543
to: sp1_human check: 4284 from: 1 to: 696
Symbol comparison tabl...
Gap Output
1 ................................MAAAKAEMQLMSPLQISDPFGSFPHSPT 28
. . | | | . |
bestfit sw:sp1_human sw:egr1_human -ran=100
BestFit выполняет локальное выравнивание наиболее похожих сегментов,
BESTFIT of: sp1_human check: 4284 from: 1 to: 696
to: egr1_human check: 6989 from: 1 to: 543
Symbol comparison table: /gcg...
sp1_human x egr1_human October 10, 2001 10:50 ..
. . . . .
| | ...
Vvedenie v bioinformatiku_1
Vvedenie v bioinformatiku_1
Upcoming SlideShare
Loading in …5

Vvedenie v bioinformatiku_1


Published on

  • Be the first to comment

  • Be the first to like this

Vvedenie v bioinformatiku_1

  1. 1. Введение в биоинформатику. Современное положение. Задачи и методы их решения. Порозов Юрий.
  2. 2. План курса • Введение в биоинформатику, цели, задачи и методы. Основные понятия. Аминокислоты, протеины и нуклеиновые кислоты. Способы представления информации о последовательностях – форматы записи Fasta, Genbank, PDB и способы визуализации. Источники информации, базы данных и Интернет для биоинформатики. Протеины, пространственное строение, функции. • Молекула ДНК – хранилище генетической информации. Строение ДНК. Упаковка молекулы. Комплементарность. Гены, регуляторные последовательности, сайты связывания. Кодирование информации при помощи нуклеотидов. Репликация (удвоение молекулы). Анализ последовательностей. Парное выравнивание. Алгоритмы выравнивания. Множественное выравнивание. Применение выравнивания в биоинформатике, примеры. • Строение белков. Первичная структура белка. Вторичная структура. Третичная и четвертичная структура белка. Мотивы и домены. α- структуры, β-структуры и их комбинации. Функции белков. Связь между структурой и функцией белков. Главная цепь. Боковые цепи. Геометрия главной цепи. Конформации белка. Конформации боковых цепей. Диаграмма Рамачандран и библиотеки ротамеров. • Предсказание трехмерной структуры белка. Фолдинг (сворачивание) белка. Парадокс Левенталя. Методы определения пространственной структуры белков. X-ray-дифракция. Метод ЯМР. Потенциальная энергия молекулы. Предсказание вторичной структуры. Предсказание третичной структуры: AB-initio. Моделирование гомологов. Threading (распознавание фолда). Структурное выравнивание. • Биологические базы данных и серверы. NCBI и сервисы. PDB. OCA. SRS. SRS-3D. PredictProtein. Swiss-Model. ExPASy. UniProt. Серверы EMBL. ENCODE. Инструменты: Swiss-PDBviewer, VMD, Accelrys Discovery Studio. Актуальные проблемы, требующие решения: аннотация генома, поиск генов, поиск сайтов репликации у человека. Сворачивание белков, предсказание структуры белка — CASP, предсказание функции и клеточной локализации белков. Предсказание подвижности белков и классификация протеинов по принципу подвижности. • Моделирование подвижности белков. Молекулярная динамика и компьютерная графика. Maya, VMD. Моделирование на основе геометрии.
  3. 3. Биоинформатика - наука, занимающаяся анализом экспериментальных данных молекулярной биологии: секвенированных последовательностей биополимеров, экспериментально определенных пространственных структур биологических макромолекул, данных об экспрессии генов и т.д. Методами биоинформатики являются методы организации информации, широко понимаемые компьютерные методы, методы вычислительной математики и статистики. (М.С. Гельфанд et al) Европейский Биоинформационный Институт: биоинформатика – это применение компьютерных технологий для администрирования и анализа биологических данных.
  4. 4. Биоинформатика Structural Genomics Pharmaco-Genomics Functional Genomics Proteomics Genomics Bioinformatics
  5. 5. Задачи биоинформатики • Функциональная аннотация биополимеров • Структурная аннотация биополимеров • Эволюция • Геномика и протеомика
  6. 6. Биополимеры ДНК РНК (дезоксирибонуклеиновые и рибонуклеиновые кислоты) – обеспечивающих хранение, передачу из поколения в поколение и реализацию генетической программы развития и функционирования живых организмов } Протеины (белки)
  7. 7. Последовательность (sequence, первичная структура)– цепь из мономеров (нуклеотиды или аминокислоты), составляющих ДНК, РНК или белок. Последовательности ДНК – от 10-20 нуклеотидов (праймеры для ПЦР) до нескольких миллионов (хромосомная ДНК). Последовательности белков – десятки-тысячи аминокислот.
  8. 8. Биополимеры – ДНК Аденин Гуанин ЦитозинТимин Аденозинфосфат Пурины Пиримидины
  9. 9. Биополимеры - ДНК J. Watson и F. Crick. Фото из архива Photo Researchers inc.
  10. 10. Биополимеры - белки Аминокислоты - органические соединения, в молекуле которых одновременно содержатся карбоксильные и аминные группы. Последовательность, цепь аминокислот составляет белок.
  11. 11. Биополимеры - белки
  13. 13. GenBankLOCUS SCU49845 5028 bp DNA PLN 21-JUN-1999 DEFINITION Saccharomyces cerevisiae TCP1-beta gene, partial cds, and Axl2p (AXL2) and Rev7p (REV7) genes, complete cds. ACCESSION U49845 VERSION U49845.1 GI:1293613 KEYWORDS . SOURCE Saccharomyces cerevisiae (baker's yeast) ORGANISM Saccharomyces cerevisiae Eukaryota; Fungi; Ascomycota; Saccharomycotina; Saccharomycetes; Saccharomycetales; Saccharomycetaceae; Saccharomyces. REFERENCE 1 (bases 1 to 5028) AUTHORS Torpey,L.E., Gibbs,P.E., Nelson,J. and Lawrence,C.W. TITLE Cloning and sequence of REV7, a gene whose function is required for DNA damage-induced mutagenesis in Saccharomyces cerevisiae JOURNAL Yeast 10 (11), 1503-1509 (1994) PUBMED 7871890 REFERENCE 2 (bases 1 to 5028) AUTHORS Roemer,T., Madden,K., Chang,J. and Snyder,M. TITLE Selection of axial growth sites in yeast requires Axl2p, a novel plasma membrane glycoprotein JOURNAL Genes Dev. 10 (7), 777-793 (1996) PUBMED 8846915 REFERENCE 3 (bases 1 to 5028) AUTHORS Roemer,T. TITLE Direct Submission JOURNAL Submitted (22-FEB-1996) Terry Roemer, Biology, Yale University, New Haven, CT, USA FEATURES Location/Qualifiers source 1..5028 /organism="Saccharomyces cerevisiae" /db_xref="taxon:4932" /chromosome="IX" /map="9" CDS <1..206 /codon_start=3 /product="TCP1-beta" /protein_id="AAA98665.1" /db_xref="GI:1293614" /translation="SSIYNGISTSGLDLNNGTIADMRQLGIVESYKLKRAVVSSASEA AEVLLRVDNIIRARPRTANRQHM" gene 687..3158 /gene="AXL2" CDS 687..3158 /gene="AXL2" /note="plasma membrane glycoprotein" /codon_start=1 /function="required for axial budding pattern of S. cerevisiae" /product="Axl2p" /protein_id="AAA98666.1" /db_xref="GI:1293615" /translation="MTQLQISLLLTATISLLHLVVATPYEAYPIGKQYPPVARVNESF TFQISNDTYKSSVDKTAQITYNCFDLPSWLSFDSSSRTFSGEPSSDLLSDANTTLYFN ------------------------------------------//--------------------------------------------------------- YGSQKTVDTEKLFDLEAPEKEKRTSRDVTMSSLDPWNSNISPSPVRKSVTPSPYNVTK RNRHLQNIQDSQSGKNGITPTTMSTSSSDDFVPVKDGENFCWVHSMEPDRRPSKKRL VDFSNKSNVNVGQVKDIHGRIPEML" gene complement(3300..4037) /gene="REV7" CDS complement(3300..4037) /gene="REV7" /codon_start=1 /product="Rev7p" /protein_id="AAA98667.1" /db_xref="GI:1293616" /translation="MNRWVEKWLRVYLKCYINLILFYRNVYPPQSFDYTTYQSFNLPQ FVPINRHPALIDYIEELILDVLSKLTHVYRFSICIINKKNDLCIEKYVLDFSELQHVD KDDQIITETEVFDEFRSSLNSLIMHLEKLPKVNDDTITFEAVINAIELELGHKLDRNR RVDSLEEKAEIERDSNWVKCQEDENLPDNNGFQPPKIKLTSLVGSDVGPLIIHQFSEK LISGDDKILNGVYSQYEEGESIFGSLF" ORIGIN 1 gatcctccat atacaacggt atctccacct caggtttaga tctcaacaac ggaaccattg 61 ccgacatgag acagttaggt atcgtcgaga gttacaagct aaaacgagca gtagtcagct 121 ctgcatctga agccgctgaa gttctactaa gggtggataa catcatccgt gcaagaccaa 181 gaaccgccaa tagacaacat atgtaacata tttaggatat acctcgaaaa taataaaccg 241 ccacactgtc attattataa ttagaaacag aacgcaaaaa ttatccacta tataattcaa 301 agacgcgaaa aaaaaagaac aacgcgtcat agaacttttg gcaattcgcg tcacaaataa ------------------------------------------//---------------------------------------------- 4621 tcttcgcact tcttttccca ttcatctctt tcttcttcca aagcaacgat ccttctaccc 4681 atttgctcag agttcaaatc ggcctctttc agtttatcca ttgcttcctt cagtttggct 4741 tcactgtctt ctagctgttg ttctagatcc tggtttttct tggtgtagtt ctcattatta 4801 gatctcaagt tattggagtc ttcagccaat tgctttgtat cagacaattg actctctaac 4861 ttctccactt cactgtcgag ttgctcgttt ttagcggaca aagatttaat ctcgttttct 4921 ttttcagtgt tagattgctc taattctttg agctgttctc tcagctcctc atatttttct 4981 tgccatgact cagattctaa ttttaagcta ttcaatttct ctttgatc //
  15. 15. HELIX 1 1 GLU A 5 THR A 9 5 5 HELIX 2 2 ALA A 37 YOF A 39 5 3 HELIX 3 3 PRO A 56 VAL A 61 5 6 HELIX 4 4 VAL A 68 SER A 72 5 5 HELIX 5 5 PRO A 75 HIS A 81 5 7 HELIX 6 6 ASP A 82 ALA A 87 1 6 SHEET 1 A12 VAL A 12 VAL A 22 0 SHEET 2 A12 HIS A 25 ASP A 36 -1 O GLY A 31 N VAL A 16 SHEET 3 A12 LYS A 41 CYS A 48 -1 O THR A 43 N GLU A 34 SHEET 4 A12 HIS A 217 ALA A 227 -1 O LEU A 220 N LEU A 44 SHEET 5 A12 HIS A 199 SER A 208 -1 N SER A 202 O THR A 225 SHEET 6 A12 ASN A 149 ASP A 155 -1 N ILE A 152 O HIS A 199 SHEET 7 A12 GLY A 160 ASN A 170 -1 O GLY A 160 N ASP A 155 SHEET 8 A12 VAL A 176 PRO A 187 -1 O GLN A 177 N HIS A 169 SHEET 9 A12 YOF A 92 PHE A 100 -1 N GLU A 95 O GLN A 184 SHEET 10 A12 ASN A 105 GLU A 115 -1 O YOF A 106 N ILE A 98 SHEET 11 A12 THR A 118 ILE A 128 -1 O LYS A 126 N LYS A 107 SHEET 12 A12 VAL A 12 VAL A 22 1 N ASP A 21 O GLY A 127 CISPEP 1 MET A 88 PRO A 89 0 0.50 CRYST1 51.003 62.430 70.931 90.00 90.00 90.00 P 21 21 21 4 ORIGX1 1.000000 0.000000 0.000000 0.00000 ORIGX2 0.000000 1.000000 0.000000 0.00000 ORIGX3 0.000000 0.000000 1.000000 0.00000 SCALE1 0.019607 0.000000 0.000000 0.00000 SCALE2 0.000000 0.016018 0.000000 0.00000 SCALE3 0.000000 0.000000 0.014098 0.00000 ATOM 1 N SER A 2 28.277 8.150 50.951 1.00 57.00 N ATOM 2 CA SER A 2 27.454 9.223 51.584 1.00 55.40 C ATOM 3 C SER A 2 25.972 8.992 51.295 1.00 55.44 C ATOM 4 O SER A 2 25.576 7.932 50.799 1.00 54.37 O ATOM 5 CB SER A 2 27.883 10.601 51.046 1.00 70.82 C ATOM 6 OG SER A 2 27.150 11.676 51.622 1.00 71.45 O ATOM 7 N LYS A 3 25.157 9.993 51.619 1.00141.28 N ATOM 8 CA LYS A 3 23.716 9.932 51.398 1.00140.16 C -----------------------------------//---------------------------------------------------------------- ATOM 47 CA PHE A 8 26.551 11.090 41.294 1.00 19.27 C ATOM 48 C PHE A 8 27.751 10.357 40.676 1.00 21.43 C ATOM 49 O PHE A 8 28.562 10.924 39.938 1.00 21.44 O ATOM 50 CB PHE A 8 27.022 12.362 41.991 1.00 21.68 C ATOM 51 CG PHE A 8 25.909 13.297 42.288 1.00 17.60 C ATOM 52 CD1 PHE A 8 25.488 14.212 41.321 1.00 14.95 C ATOM 495 CA VAL A 68 23.860 22.610 40.452 1.00 14.12 C ATOM 496 C VAL A 68 25.259 22.196 40.854 1.00 13.41 C ATOM 1164 CA SER A 147 37.123 31.083 35.325 1.00 21.88 C ATOM 1819 CD1 ILE A 229 38.888 21.450 53.055 1.00 29.11 C ATOM 1820 OXT ILE A 229 43.220 19.637 50.148 1.00 25.25 O TER 1821 ILE A 229 HETATM 1822 O HOH 1 30.450 20.682 37.367 1.00 15.75 O HETATM 1823 O HOH 2 26.443 24.175 38.999 1.00 18.82 O ---------------------------------//------------------------------------------------ HETATM 1831 O HOH 10 29.132 18.648 45.101 1.00 13.77 O HETATM 1832 O HOH 11 24.076 46.248 42.794 1.00 22.62 O HETATM 1833 O HOH 12 31.870 32.426 52.146 1.00 36.77 O HETATM 1880 O HOH 59 37.243 14.571 53.463 1.00 31.12 O HETATM 1881 O HOH 60 40.360 20.483 56.144 1.00 32.74 O HETATM 1882 O HOH 61 13.483 49.374 33.179 1.00 30.77 O CONECT 267 268 CONECT 268 267 269 271 CONECT 819 820 CONECT 1594 1592 1596 1598 CONECT 1595 1593 1596 CONECT 1596 1594 1595 1597 CONECT 1597 1596 CONECT 1598 1594 MASTER 259 0 10 6 12 0 0 6 1881 1 140 18 END
  16. 16. GCG
  17. 17. Способы визуализации Определение структуры (координат атомов) белка: 1) Х-Ray кристаллография 2) Ядерно-магнитный резонанс (NMR) Эти методы довольно трудоёмки и дороги 3) Предсказание структуры белка
  18. 18. X-ray кристаллография 1. Получение упорядоченных кристаллов белка. 2. Определение дифракции x-ray.
  19. 19. X-ray кристаллография 3. Анализ дифракционной картины даёт представление об электронных плотностях. 4. «Нанизывание» известной аминокислотной последовательности на карту электронных плотностей. Tyrosine
  20. 20. ЯМР (NMR) 1. Nuclear Magnetic Resonance - регистрация релаксации ядер тяжёлых атомов в магнитном поле. а) Выравнивание ядер тяжелых атомов в сильном постоянном или импульсном магнитном поле б) Регистрация резонанса (в постоянном поле) или релаксации (в импульсном поле) атомных ядер. 2. Измерение дистанций между атомами в протеине.
  21. 21. ЯМР 3. Использует данные тысяч измерений дистанций для построения модели протеина с учётом ограничений.
  22. 22. Источники информации и базы данных в Интернете
  23. 23. Типы баз данных • Всеобъемлющие базы данных • Организмоспецифические • Молекулярноспецифические • Дополнительные базы данных
  24. 24. Проблемы • Биологические базы данных росли последние 20 лет: 1. Избыточность: множественные записи. 2. Неверные последовательности и записи. • Открытость (данные добавляются пользователями): 1. Изменения вносятся владельцами записей. 2. Старые последовательности. 3. Неверные последовательности. 4. Неполные аннотации.
  25. 25. Пример GenBank • GenBank, база данных последовательностей NCBI. В 1982 году: 700,000 bp, 700 последовательностей. В 2002 году : 29,000,000,000 22,000,000 последовательностей В 2009 году: 145,959,997,864 bp 49,063,546 последовательностей
  26. 26. Полные базы данных Большие базы данных ДНК, РНК и белков. Примеры: GenBank, EMBL, swissprot. Имеется обмен информацией между базами
  27. 27. NCBI (National center for biotechnology information) NCBI PubMed Books OMIM Nucleotides Proteins GenomesTaxonomy Structure Domains Exp’ profiles
  28. 28. NCBI - GenBank • GenBank: открытая база данных нуклеотидных и аминокислотных последовательностей • Источники информации: 1. Прямая подача от исследователей. 2. Литература. 3. Центры исследований последовательностей (Sanger, TIgr) 4. Обмен с другими базами (swiss-prot, PDB).
  29. 29. NCBI - GenBank GenBank поделён на подбазы: 1. Organism specific (Human, Bacteria, etc). 2. Molecule specific (DNA, RNA, protein). 3. Sequence specific (Genome, mRNA, ESTs etc).
  30. 30. EMBL Параллельная GenBank база данных.
  31. 31. Swiss prot База данных белков: 1. Очень хорошо аннотированная. 2. Отсутствует избыточность. 3. Имеются перекрёстные ссылки. 4. ID для нескольких связанных файлов белков
  32. 32. Организмоориентированные базы
  33. 33. Молекулоспецифические базы • Базы даных, ориентированные на группы молекул GtRDB: The Genomic tRNA Database
  34. 34. PDB – Protein Data Bank • Главная база данных 3D структур белков • Включает порядка 23,000 белковых структур. • Белки организованы в группы, семейства и т.д. • Имеет порядка 5600 точных структур.
  35. 35. SCOP - Structural Classification Of Proteins • Организована в соответствии со структурными семействами белков. • Иерархическая система.
  36. 36. NCBI - Entrez • Entrez - поисковая машина для баз NCBI. • Поиск начинается с выбора адекватной области для поикса (Nucleotide, белки). • Можно использовать определители полей, логические операторы, условия и т.д.
  37. 37. NCBI - Entrez Ограничения:
  38. 38. SRS (Sequence Retrieval System). • Исталлирована на множестве серверов. • Имеет связи со многими базами данных. • Предоставляет множество инструментов и служб для анализа. • Позволяет сохранить результаты работы и анализа и продолжить работу локально.
  39. 39. SRS Рабочая среда Выбор базы данных Заполнение формы запроса Страница результатов
  40. 40. Парное выравнивание
  41. 41. Гомологи Все живое произошло от одного общего предка, следовательно, все последовательности являются «гомологами». На самом деле гомологи – только те последовательности, похожесть которых можно подтвердить существующими методами с определенной чувствительностью: Белок в двух различных организмах выполняет сходную функцию и это можно подтвердить экспериментально. 5 млн.лет 120 млн.лет 1500 млн.лет
  42. 42. Определение VLSPADKTNVKAAWAKVGAHAAGHG ||| | | |||| | |||| VLSEAEWQLVLHVWAKVEADVAGHG Выравнивание (alignment) – сравнение двух (парный) или нескольких (множественный) последовательностей. Поиск серий идентичных символов в последовательностях
  43. 43. Какие задачи решает парное выравнивание? • Нуклеотиды – Изучение эволюционных связей – Поиск генов, доменов, сигналов … • Белки – Изучение эволюционных связей – Классификация белковых семейств по функции или структуре – Идентификация общих доменов по функции или структуре.
  44. 44. Точечный график • Наиболее интуитивный метод для сравнения последовательностей. • Использование слов вместо символов позволяет уменьшить шум.
  45. 45. Парное выравнивание Человеческий гемоглобин (HH): VLSPADKTNVKAAWGKVGAHAGYEG Миоглобин кашалота (SWM): VLSEGEWQLVLHVWAKVEADVAGHG
  46. 46. Парное выравнивание - идентичность (HH) VLSPADKTNVKAAWGKVGAHAGYEG ||| | | || | | (SWM) VLSEGEWQLVLHVWAKVEADVAGHG Процент идентичности: 36.000 (| only)
  47. 47. Парное выравнивание - похожесть (HH) VLSPADKTNVKAAWGKVGAHAGYEG ||| . | | || | | (SWM) VLSEGEWQLVLHVWAKVEADVAGHG Процент похожести: 40.000 (| и .) Процент идентичности: 36.000 ( только |)
  48. 48. Парное выравнивание – вставка промежутков (gaps) (HH) VLSPADKTNVKAAWGKVGAH-AGYEG  .       (SWM) VLSEGEWQLVLHVWAKVEADVAGH-G • Gap Weight: 4 • Gaps: 2 • Процент похожести: 54.167 • Процент идентичности: 45.833
  49. 49. Парное выравнивание – вставка промежутков AKWTNLK----WAKV-ADVAGH-G         AK-TNVKAKLPWGKVGAHVAGEYG - вставкаудаление промежутка - продление промежутка
  50. 50. Парное выравнивание - подсчёт Финальная оценка выравнивания – это сумма сумма положительных очков и штрафных очков: + Количество идентичных + Количество похожих - Количество вставленных промежутков - Количество удлиненных промежутков Оценка выравнивания
  51. 51. Парное выравнивание - Scoring (HH) VLSPADKTNVKAAWGKVGAH-AGYEG ||| . | | || || | (SWM) VLSEGEWQLVLHVWAKVEADVAGH-G Final score: (V,V) + (L,L) + (S,S) + (D,E) + … - (penalty for gap insertion)*(number of gaps) - (penalty for gap extension)*(extension length)
  52. 52. Парное выравнивание • Алгоритмы парного выравнивания пробуют все возможные варианты выравнивания. • Результат – выравнивание с наивысшей оценкой. • Различные системы оценки дают разные лучшие выравнивания!!!
  53. 53. Система оценки - белки • Идентичность: подсчитывается количество совпадений и делится на длину выравниваемого региона • Similarity: Менее формализованная величина Category Amino Acid Кислотыамиды Asp (D) Glu(E) Asn (N) Gln (Q) Основания His (H) Lys (K) Arg (R) Ароматические Phe (F) Tyr (Y) Trp (W) Гидрофильные Ala (A) Cys (C) Gly (G) Pro (P) Ser (S) Thr (T) Гидрофобные Ile (I) Leu (L) Met (M) Val (V)
  54. 54. Система оценки - белки Похожесть: Положительная оценка для выравниваемых аминокислот из одной и той же группы.
  55. 55. Парное выравнивание • Матрицы для оценки – PAM и BLOSUM • Системы оценки выравнивания различны для белков и для ДНКРНК
  56. 56. Матрицы сравнения белков Семейство матриц, которые отражают вероятность замены одной аминокислоты на другую во время эволюции.
  57. 57. PAM матрица • PAM матрица базируется на последовательностях с 85% идентичности. У близких белков функции не должны сильно различаться
  58. 58. PAM матрица • PAM единицы отображают эволюционную дистанцию. • 1 PAM единица – вероятность 1 точечной мутации на 100 аминокислот. • Умножение PAM 1 на себя даёт более высокие матрицы, применимые для сравнения белков, удалённых эволюционно.
  59. 59. PAM 1
  60. 60. PAM 250
  61. 61. Парное выравнивание – методы сравнения • Глобальное выравнивание – находит лучшее решение для целых последовательностей. • Локальное выравнивание – находит похожие районы в двух последовательностях. Глобальное Локальное _____ _______ __ ____ __ ____ ____ __ ____
  62. 62. PAM матрицы Evolutionary distance (PAM) Observed % difference 1 1 11 10 23 20 38 30 56 40 80 50 120 60 159 70 250 80
  63. 63. BLOSUM Matrices • Blocks Substitution Matrices. Матрицы PAM обладают ограниченными возможностями, так как их «рейтинги замен» были получены из выравниваний последовательностей с как минимум 85% идентичности. • Henikoff and Henikoff (1992) разработали сет матриц, базирующийся на большем количестве данных (dataset of alignments). BLOSUM учитывает значительно больше замен, чем PAM, даже для редких пар.
  64. 64. BLOSUM • Блоки – короткие стабильные образы «шаблоны» по 3-60 aa длиной. • Белки могут быть поделены на семейства по наличию тех или иных блоков (семейство X содержит блоки a,b,c,d). Blosum использует ~500 семейств и ~2000 блоков. • Различные матрицы Blosum выведены из блоков с различной степенью идентичности: blosum62 получена из выравнивания последовательностей с по меньшей мере 62% идентичности.
  65. 65. Параметры по умолчанию • Параметры для открытияпродления промежутков индивидуальны для каждой матрицы • PAM30: open=9, extension=1 • PAM250: open=14, extension=2
  66. 66. Параметры по умолчанию Выравнивания будут сильно отличаться при использовании различных параметров для промежутков. Для каждой матрицы параметры по умолчанию генерируют оптимальное выравнивание. Матрицы были тестированы с разными параметрами до тех пор, пока не был получено «правильное выравнивание».
  67. 67. Параметры по умолчанию Мы можем использовать выравнвание последовательностей, базирующееся на структурном выравнивании. В этом случае структурное выравнивание является «правильным» для наших целей
  68. 68. Матрицы оценки DNA • Похожесть нуклеотидов DNA определить невозможно. • Основания делятся на 2 группы: пурины (A,G) и пиримидины (C,T)
  69. 69. Матрицы оценки DNA Мутации делятся на переходы (transitions) и превращения (transversions). Transitions – пурин на пурин, пиримидин на пиримидин (4 варианта). Transversions – пурин на пиримидин или пиримидин на пурин (8 вариантов). By chance transversions должны происходить в 2 раза чаще, чем transitions.
  70. 70. Матрицы оценки DNA • De-facto transitions происходят чаще.
  71. 71. Матрицы оценки DNA Унифицированная матрица подстановок нуклеотидов: From To A G C T A 2 G -6 2 C -6 -6 2 T -6 -6 -6 2 MatchMismatch
  72. 72. Матрицы оценки DNA Неунифицированная матрица подстановок нуклеотидов: From To A G C T A 2 G -4 2 C -6 -6 2 T -6 -6 -4 2 MatchMismatchMismatch
  73. 73. Глобальное выравнивание • Алгоритм Needleman and Wunsch (1970) • Находит выравнивание двух полных последовательностей: ADLGAVFALCDRYFQ |||| |||| | ADLGRTQN-CDRYYQ
  74. 74. Дано: 2 последовательности x[1…n] и y[1…m] При выравниванииПри выравнивании x[1...i] ии y[1…j] есть 3 вариантаесть 3 варианта: Совпадение x[1…i-1] и y[1…j-1]: x[i]=y[j] Совпадение x[1…i] и y[1…j-1] и совпадение пропуска в x и y[j] Совпадение x[1…i-1] и y[1…j] и совпадение x[i] и пропуска в y x[1…i-1] i y[1…j-1] j x[1… i ] - y[1…j-1] j x[1…i-1] i y[1… j ] - Динамическое программирование. Глобальное выравнивание
  75. 75. Recursive Relation Scoring matrix s(a,b), s(−, x) = s(x,−) = −d Fij – лучшая score-функция выравнивания x[1…i] and y[1…j] for 1 <= i <= n, 1 <= j <= m Fi-1,j-1 + s(xi,yj) Fij = max Fi,j-1 - d Fi-1,j - d Needleman-Wunsch 1970
  76. 76. Scoring scheme: s(a, a) = 1, s(a, b) = −1, if a ≠ b, and s(−, a) = s(a,−) =−2. x : C T T A G A y : G − T A − A, x : C T T A G A y : G T − A − A, x : C T T A G A y : − G T A − A x = CTTAGA, y = GTAA Расчет элементов матрицы: Si,1=Si-1,1+d, S1,j= S1,j-1+d Все остальные элементы: Si,j=max{Si-1,j+d, Si,j-1+d, Si-1,j-1+t} где t – либо совпадение (1) либо замена (-1)
  77. 77. Локальное выравнивание • Алгоритм Smith and Waterman (1981). • Выполняет оптимальное выравнивание наиболее идентичногопохожего сегмента двух последовательностей. ADLG CDRYFQ |||| |||| | ADLG CDRYYQ
  78. 78. Recursive relations Интересует выравнивание подстрок (последовательных сегментов). Подстрока последовательности x1x2 . . . xn имеет вид xixi+1 . . . xi+k для 1 ≤ i ≤ n and k ≤ n − i. Smith-Waterman алгоритм [SW] (решение проблемы пробелов между подстроками): Матрица (n + 1) х (m + 1) , также, как и в алгоритме Needleman-Wunsch. Формула скоринга несколько другая: 0 Fij = max Fi-1,j-1 + s(xi,yj) Fi,j-1 - d Fi-1,j - d Где 0 – начало нового выравнивания, если предыдущее выравнивание дало отрицательный скоринг и продолжать дальше смысла нет.
  79. 79. Важно: Выравнивание может не только окончиться, но и начаться в любом месте матрицы. Таким образом, вместо того, чтобы выбирать стартовую точку F(n,m) в правом нижнем углу, выбирают элементы с максимальным скорингом в матрице.
  80. 80. Данные • Пара последовательностей. • Локальное или глобальное • Штрафы за вставкупродление промежутков • Матрицы
  81. 81. Оценка • Как можно оценить достоверность выравнивания? • Какое выравнивание лучше ? A T C G C A T - G C A A C A A A A - A A ? Откуда взялись очки (оценка) : из порядка следования нуклеотидов или из набора?
  82. 82. Оценка – подход bootstrap Данные с тем же набором, но с разным порядком: 1. Перемешивание одной последовательности. 2. Повтор выравнивания и его оценка. 3. Повторение 1) и 2) много раз. 4. Посчёт среднего и SD оценки выравнивания перемешанной последовательности.
  83. 83. Оценка - bootstrap Shuffle one of the sequences Align with the second sequence Calculate mean and standard deviation of shuffled alignments Compare alignment score with mean of shuffled alignments
  84. 84. Оценка качества выравнивания Сравниваем результат (оценку) нашего выравнивания со средней оценкой выравнивания перемешанных последовательностей. Правило: If: original alignment >>average score + 6*SD Then: the alignment is statistically significant.
  85. 85. Program output: Gap Weight: 12 Average Match: 2.912 Length Weight: 4 Average Mismatch: -2.003 Quality: 1239 Length: 356 Ratio: 3.480 Gaps: 0 Percent Similarity: 69.663 Percent Identity: 65.730 Average quality based on 100 randomizations: 34.9 +/- 4.7 Is it significant? 34.9 + 6 * 4.7 = 63.1 << 1239
  86. 86. GCG Gap : Глобальное выравнивание. Bestfit: Локальное выравнивание. Обе программы работают с одинаковым набором данных (последовательности, scoring matrix, etc)
  87. 87. Пример: Gap or Bestfit? 2 человеческих transcription factors: 1. SP1 factor, binds to GC rich areas. 2. EGR-1 factor, active at differentiation stage
  88. 88. Gap gap sw:egr1_human sw:sp1_human –ran=100 Gap uses the algorithm of Needleman and Wunsch to find the alignment of two complete sequences that maximizes the number of matches and minimizes the number of gaps. Begin (* 1 *) ? End (* 543 *) ? Begin (* 1 *) ? End (* 696 *) ? What is the gap creation penalty (* 8 *) ? What is the gap extension penalty (* 2 *) ? What should I call the paired output display file (* egr1_human.pair *) ?
  89. 89. Gap Output GAP of: egr1_human check: 6989 from: 1 to: 543 to: sp1_human check: 4284 from: 1 to: 696 Symbol comparison table: /gcg10disk/gcg/gcgcore/data/rundata/blosum62.cmp CompCheck: 1102 Gap Weight: 8 Average Match: 2.778 Length Weight: 2 Average Mismatch: -2.248 Quality: 162 Length: 783 Ratio: 0.298 Gaps: 23 Percent Similarity: 32.675 Percent Identity: 26.974 Average quality based on 100 randomizations: 14.6 +/- 7.0
  91. 91. bestfit sw:sp1_human sw:egr1_human -ran=100 BestFit выполняет локальное выравнивание наиболее похожих сегментов, используя local homology algorithm (Smith and Waterman). Begin (* 1 *) ? End (* 696 *) ? Begin (* 1 *) ? End (* 543 *) ? What is the gap creation penalty (* 8 *) ? What is the gap extension penalty (* 2 *) ? What should I call the paired output display file (* sp1_human.pair *) ? Bestfit
  92. 92. BESTFIT of: sp1_human check: 4284 from: 1 to: 696 to: egr1_human check: 6989 from: 1 to: 543 Symbol comparison table: /gcg10disk/gcg/gcgcore/data/rundata/blosum62.cmp CompCheck: 1102 Gap Weight: 8 Average Match: 2.778 Length Weight: 2 Average Mismatch: -2.248 Quality: 233 Length: 135 Ratio: 1.779 Gaps: 3 Percent Similarity: 50.000 Percent Identity: 39.063 Average quality based on 100 randomizations: 50.6 +/- 7.3 Bestfit Output
  93. 93. sp1_human x egr1_human October 10, 2001 10:50 .. . . . . . 526 RGSGDPGKKKQHICHIQGCGKVYGKTSHLRAHLRWHTGERPFMCTWSYCG 575 | | | .: : | :: | : : :. | |:| |||::|| | | 327 RPSKTPPHERPYACPVESCDRRFSRSDELTRHIRIHTGQKPFQC..RICM 374 . . . . . 576 KRFTRSDELQRHKRTHTGEKKFACPECPKRFMRSDHLSKHIKTH...QNK 622 : |.||| | | ||||||| ||| | ::| ||| :| | | ..| 375 RNFSRSDHLTTHIRTHTGEKPFACDICGRKFARSDERKRHTKIHLRQKDK 424 . . . 623 KGGPGVALSVGTLPLDSGAGSEGSGTATPSALITT 657 | | | | | | |. || . |. 425 KADKSVVASSATSSLSSYPSP..VATSYPSPVTTS 457 Bestfit Output
