Your SlideShare is downloading. ×
Bahasa malaysia kssr sk thn 4
Bahasa malaysia kssr sk thn 4
Bahasa malaysia kssr sk thn 4
Bahasa malaysia kssr sk thn 4
Bahasa malaysia kssr sk thn 4
Bahasa malaysia kssr sk thn 4
Bahasa malaysia kssr sk thn 4
Bahasa malaysia kssr sk thn 4
Bahasa malaysia kssr sk thn 4
Bahasa malaysia kssr sk thn 4
Bahasa malaysia kssr sk thn 4
Bahasa malaysia kssr sk thn 4
Bahasa malaysia kssr sk thn 4
Bahasa malaysia kssr sk thn 4
Bahasa malaysia kssr sk thn 4
Bahasa malaysia kssr sk thn 4
Bahasa malaysia kssr sk thn 4
Bahasa malaysia kssr sk thn 4
Bahasa malaysia kssr sk thn 4
Bahasa malaysia kssr sk thn 4
Bahasa malaysia kssr sk thn 4
Bahasa malaysia kssr sk thn 4
Bahasa malaysia kssr sk thn 4
Bahasa malaysia kssr sk thn 4
Bahasa malaysia kssr sk thn 4
Bahasa malaysia kssr sk thn 4
Bahasa malaysia kssr sk thn 4
Bahasa malaysia kssr sk thn 4
Bahasa malaysia kssr sk thn 4
Bahasa malaysia kssr sk thn 4
Bahasa malaysia kssr sk thn 4
Bahasa malaysia kssr sk thn 4
Bahasa malaysia kssr sk thn 4
Bahasa malaysia kssr sk thn 4
Bahasa malaysia kssr sk thn 4
Bahasa malaysia kssr sk thn 4
Bahasa malaysia kssr sk thn 4
Bahasa malaysia kssr sk thn 4
Bahasa malaysia kssr sk thn 4
Bahasa malaysia kssr sk thn 4
Bahasa malaysia kssr sk thn 4
Bahasa malaysia kssr sk thn 4
Bahasa malaysia kssr sk thn 4
Bahasa malaysia kssr sk thn 4
Bahasa malaysia kssr sk thn 4
Bahasa malaysia kssr sk thn 4
Bahasa malaysia kssr sk thn 4
Bahasa malaysia kssr sk thn 4
Bahasa malaysia kssr sk thn 4
Bahasa malaysia kssr sk thn 4
Bahasa malaysia kssr sk thn 4
Bahasa malaysia kssr sk thn 4
Bahasa malaysia kssr sk thn 4
Bahasa malaysia kssr sk thn 4
Bahasa malaysia kssr sk thn 4
Bahasa malaysia kssr sk thn 4
Bahasa malaysia kssr sk thn 4
Bahasa malaysia kssr sk thn 4
Bahasa malaysia kssr sk thn 4
Bahasa malaysia kssr sk thn 4
Bahasa malaysia kssr sk thn 4
Bahasa malaysia kssr sk thn 4
Bahasa malaysia kssr sk thn 4
Bahasa malaysia kssr sk thn 4
Bahasa malaysia kssr sk thn 4
Bahasa malaysia kssr sk thn 4
Bahasa malaysia kssr sk thn 4
Bahasa malaysia kssr sk thn 4
Bahasa malaysia kssr sk thn 4
Bahasa malaysia kssr sk thn 4
Bahasa malaysia kssr sk thn 4
Bahasa malaysia kssr sk thn 4
Bahasa malaysia kssr sk thn 4
Bahasa malaysia kssr sk thn 4
Bahasa malaysia kssr sk thn 4
Bahasa malaysia kssr sk thn 4
Bahasa malaysia kssr sk thn 4
Bahasa malaysia kssr sk thn 4
Bahasa malaysia kssr sk thn 4
Bahasa malaysia kssr sk thn 4
Bahasa malaysia kssr sk thn 4
Bahasa malaysia kssr sk thn 4
Bahasa malaysia kssr sk thn 4
Bahasa malaysia kssr sk thn 4
Bahasa malaysia kssr sk thn 4
Bahasa malaysia kssr sk thn 4
Bahasa malaysia kssr sk thn 4
Bahasa malaysia kssr sk thn 4
Bahasa malaysia kssr sk thn 4
Bahasa malaysia kssr sk thn 4
Bahasa malaysia kssr sk thn 4
Bahasa malaysia kssr sk thn 4
Bahasa malaysia kssr sk thn 4
Bahasa malaysia kssr sk thn 4
Bahasa malaysia kssr sk thn 4
Bahasa malaysia kssr sk thn 4
Bahasa malaysia kssr sk thn 4
Bahasa malaysia kssr sk thn 4
Bahasa malaysia kssr sk thn 4
Bahasa malaysia kssr sk thn 4
Bahasa malaysia kssr sk thn 4
Bahasa malaysia kssr sk thn 4
Bahasa malaysia kssr sk thn 4
Bahasa malaysia kssr sk thn 4
Bahasa malaysia kssr sk thn 4
Bahasa malaysia kssr sk thn 4
Bahasa malaysia kssr sk thn 4
Bahasa malaysia kssr sk thn 4
Bahasa malaysia kssr sk thn 4
Bahasa malaysia kssr sk thn 4
Bahasa malaysia kssr sk thn 4
Bahasa malaysia kssr sk thn 4
Bahasa malaysia kssr sk thn 4
Bahasa malaysia kssr sk thn 4
Bahasa malaysia kssr sk thn 4
Bahasa malaysia kssr sk thn 4
Bahasa malaysia kssr sk thn 4
Bahasa malaysia kssr sk thn 4
Bahasa malaysia kssr sk thn 4
Bahasa malaysia kssr sk thn 4
Bahasa malaysia kssr sk thn 4
Bahasa malaysia kssr sk thn 4
Bahasa malaysia kssr sk thn 4
Bahasa malaysia kssr sk thn 4
Bahasa malaysia kssr sk thn 4
Bahasa malaysia kssr sk thn 4
Bahasa malaysia kssr sk thn 4
Bahasa malaysia kssr sk thn 4
Bahasa malaysia kssr sk thn 4
Bahasa malaysia kssr sk thn 4
Bahasa malaysia kssr sk thn 4
Bahasa malaysia kssr sk thn 4
Bahasa malaysia kssr sk thn 4
Bahasa malaysia kssr sk thn 4
Bahasa malaysia kssr sk thn 4
Bahasa malaysia kssr sk thn 4
Bahasa malaysia kssr sk thn 4
Bahasa malaysia kssr sk thn 4
Bahasa malaysia kssr sk thn 4
Bahasa malaysia kssr sk thn 4
Bahasa malaysia kssr sk thn 4
Bahasa malaysia kssr sk thn 4
Bahasa malaysia kssr sk thn 4
Bahasa malaysia kssr sk thn 4
Bahasa malaysia kssr sk thn 4
Bahasa malaysia kssr sk thn 4
Bahasa malaysia kssr sk thn 4
Bahasa malaysia kssr sk thn 4
Bahasa malaysia kssr sk thn 4
Bahasa malaysia kssr sk thn 4
Bahasa malaysia kssr sk thn 4
Bahasa malaysia kssr sk thn 4
Bahasa malaysia kssr sk thn 4
Bahasa malaysia kssr sk thn 4
Bahasa malaysia kssr sk thn 4
Bahasa malaysia kssr sk thn 4
Bahasa malaysia kssr sk thn 4
Bahasa malaysia kssr sk thn 4
Bahasa malaysia kssr sk thn 4
Bahasa malaysia kssr sk thn 4
Bahasa malaysia kssr sk thn 4
Bahasa malaysia kssr sk thn 4
Bahasa malaysia kssr sk thn 4
Bahasa malaysia kssr sk thn 4
Bahasa malaysia kssr sk thn 4
Bahasa malaysia kssr sk thn 4
Bahasa malaysia kssr sk thn 4
Bahasa malaysia kssr sk thn 4
Bahasa malaysia kssr sk thn 4
Bahasa malaysia kssr sk thn 4
Bahasa malaysia kssr sk thn 4
Bahasa malaysia kssr sk thn 4
Bahasa malaysia kssr sk thn 4
Bahasa malaysia kssr sk thn 4
Bahasa malaysia kssr sk thn 4
Bahasa malaysia kssr sk thn 4
Bahasa malaysia kssr sk thn 4
Bahasa malaysia kssr sk thn 4
Bahasa malaysia kssr sk thn 4
Bahasa malaysia kssr sk thn 4
Bahasa malaysia kssr sk thn 4
Bahasa malaysia kssr sk thn 4
Bahasa malaysia kssr sk thn 4
Bahasa malaysia kssr sk thn 4
Bahasa malaysia kssr sk thn 4
Bahasa malaysia kssr sk thn 4
Bahasa malaysia kssr sk thn 4
Bahasa malaysia kssr sk thn 4
Bahasa malaysia kssr sk thn 4
Bahasa malaysia kssr sk thn 4
Bahasa malaysia kssr sk thn 4
Bahasa malaysia kssr sk thn 4
Bahasa malaysia kssr sk thn 4
Bahasa malaysia kssr sk thn 4
Bahasa malaysia kssr sk thn 4
Bahasa malaysia kssr sk thn 4
Bahasa malaysia kssr sk thn 4
Bahasa malaysia kssr sk thn 4
Bahasa malaysia kssr sk thn 4
Bahasa malaysia kssr sk thn 4
Bahasa malaysia kssr sk thn 4
Bahasa malaysia kssr sk thn 4
Bahasa malaysia kssr sk thn 4
Bahasa malaysia kssr sk thn 4
Bahasa malaysia kssr sk thn 4
Bahasa malaysia kssr sk thn 4
Upcoming SlideShare
Loading in...5
×

Thanks for flagging this SlideShare!

Oops! An error has occurred.

×
Saving this for later? Get the SlideShare app to save on your phone or tablet. Read anywhere, anytime – even offline.
Text the download link to your phone
Standard text messaging rates apply

Bahasa malaysia kssr sk thn 4

8,418

Published on

kssr bm tahun 4

kssr bm tahun 4

Published in: Education
4 Comments
9 Likes
Statistics
Notes
No Downloads
Views
Total Views
8,418
On Slideshare
0
From Embeds
0
Number of Embeds
3
Actions
Shares
0
Downloads
504
Comments
4
Likes
9
Embeds 0
No embeds

Report content
Flagged as inappropriate Flag as inappropriate
Flag as inappropriate

Select your reason for flagging this presentation as inappropriate.

Cancel
No notes for slide

Transcript

  • 1. KEMENTERIAN PELAJARAN MALAYSIAKurikulum Standard Sekolah RendahPANDUAN GURUBAHASA MALAYSIA(Sekolah Kebangsaan)TAHUN 4TerbitanBahagian Pembangunan Kurikulum2013
  • 2. Cetakan Pertama 2013© Kementerian Pelajaran MalaysiaHak Cipta Terpelihara. Tidak dibenarkan mengeluar ulang mana-mana bahagianartikel, ilustrasi dan isi kandungan buku ini dalam apa-apa juga bentuk dan dengancara apa-apa jua sama ada secara elektronik, fotokopi, mekanik, rakaman atau caralain sebelum mendapat kebenaran bertulis daripada Pengarah, BahagianPembangunan Kurikulum, Kementerian Pelajaran Malaysia, Aras 4-8, Blok E9,Parcel E, Kompleks Pentadbiran Kerajaan Persekutuan, 62604 Putrajaya.
  • 3. iiiA. BAHAGIAN 1PENGENALAN BUKU PANDUAN GURU1. Pendahuluan 32. Tunjang Kurikulum Standard Bahasa Malaysia Sekolah Rendah 43. Matlamat 54. Objektif Umum 55. Fokus 66. Organisasi Kandungan Kurikulum 67. Pengisian Kurikulum 118. Strategi Pengajaran dan Pembelajaran 13B. BAHAGIAN 2CADANGAN STRATEGI PENGAJARAN DAN PEMBELAJARAN1. Strategi Standard Kandungan Kemahiran Mendengar danBertutur 232. Strategi Standard Kandungan Kemahiran Membaca 583. Strategi Standard Kandungan Kemahiran Menulis 884. Strategi Standard Kandungan Aspek Seni Bahasa 1145. Strategi Standard Kandungan Aspek Tatabahasa 132C. BAHAGIAN 3PEMETAAN RANCANGAN MENGAJAR MINGGUAN1. Tema: Kesihatan 1632. Tema: Keselamatan 1643. Tema: Kemasyarakatan 165D. BAHAGIAN 41. Daftar Kata 1692. Simpulan Bahasa 1853. Perumpamaan 1874. Bidalan 1885. Pepatah 1896. Kata-kata Hikmat 1907. Glosari 191KANDUNGAN
  • 4. vRUKUN NEGARABAHAWASANYA negara kita Malaysia mendukungcita-cita untuk mencapai perpaduan yang lebiherat dalam kalangan seluruh masyarakatnya;memelihara satu cara hidup demokratik; menciptamasyarakat yang adil bagi kemakmuran negarayang akan dapat dinikmati bersama secara adildan saksama; menjamin satu cara yang liberalterhadap tradisi-tradisi kebudayaannya yang kayadan berbagai-bagai corak; membina satumasyarakat progresif yang akan menggunakansains dan teknologi moden;MAKA KAMI, rakyat Malaysia, berikrar akanmenumpukan seluruh tenaga dan usaha kami untukmencapai cita-cita tersebut berdasarkan atas prinsip-prinsip yang berikut:• KEPERCAYAAN KEPADA TUHAN• KESETIAAN KEPADA RAJA DAN NEGARA• KELUHURAN PERLEMBAGAAN• KEDAULATAN UNDANG-UNDANG• KESOPANAN DAN KESUSILAAN
  • 5. viPendidikan di Malaysia adalah suatu usahaberterusan ke arah lebihmemperkembangkan potensi individusecara menyeluruh dan bersepadu untukmelahirkan insan yang seimbang danharmonis dari segi intelek, rohani, emosidan jasmani berdasarkan kepercayaan dankepatuhan kepada Tuhan. Usaha ini adalahbertujuan untuk melahirkan warganegaraMalaysia yang berilmu pengetahuan,berketerampilan, berakhlak mulia,bertanggungjawab dan berkeupayaanmencapai kesejahteraan diri sertamemberikan sumbangan terhadapkeharmonian dan kemakmuran keluarga,masyarakat dan negara.
  • 6. BAHAGIAN 1PENGENALAN BUKU PANDUAN GURU
  • 7. STANDARD KURIKULUM BAHASA MALAYSIA SEKOLAH RENDAH SK TAHUN 43Dunia pendidikan mengalami perkembangan yang sangat dinamik dalam arus globalisasi.Perkembangan ini juga menuntut perubahan dalam kurikulum. Seiringan dengan itu,Kementerian Pelajaran Malaysia mengambil inisiatif menyemak dan melakukanpenambahbaikan dalam kurikulum.Selaras dengan perubahan tersebut, Kurikulum Bahasa Malaysia turut melalui prosessemakan dan penambahbaikan dalam penggubalannya hingga terhasil Standard KurikulumBahasa Malaysia. Standard yang diketengahkan ini mengandungi Standard Kandungan danStandard Pembelajaran. Standard Kurikulum ini merupakan pernyataan yang merangkumipengetahuan, kemahiran dan nilai murni yang mesti dipelajari dan dikuasai oleh murid di sekolahkebangsaan.Penggubalan Standard Kurikulum Bahasa Malaysia berpaksikan Rukun Negara, DasarPendidikan Kebangsaan dan Falsafah Pendidikan Kebangsaan. Standard ini menjunjungperanan bahasa Melayu sebagai bahasa kebangsaan, bahasa rasmi, bahasa perpaduannegara, bahasa ilmu dan bahasa pengantar di sekolah. Standard ini turut menitikberatkanpenggabungjalinan kemahiran bahasa, penyerapan ilmu dan nilai murni. Standard KurikulumBahasa Malaysia boleh dijadikan pemangkin untuk memahami akal budi, pemikiran dansosiobudaya penuturnya ke arah melahirkan semangat cinta akan bahasa dan tanah air yangdikongsi bersama dalam satu wawasan demi memartabatkan bahasa Melayu.Pada asasnya, pembinaan kerangka standard ini berdasarkan prinsip KurikulumBersepadu Sekolah Rendah. Standard ini mengetengahkan pendekatan berbentuk modular danpembelajaran secara didik hibur bagi mencungkil potensi murid untuk meneroka pelbagai bidangilmu pengetahuan. Seterusnya, membolehkan murid memperkembangkan keupayaan danpenguasaan kemahiran bahasa, serta berkomunikasi menggunakan bahasa Melayu secaraberkesan dan bertatasusila dalam semua urusan.Standard Kurikulum Bahasa Malaysia Sekolah Kebangsaan mengambil kira pendekatanpengajaran Bahasa Malaysia sebagai bahasa pertama. Kepelbagaian pengajaran danpembelajaran, minat dan kecerdasan yang berbeza dalam kalangan murid turut diberipenekanan. Selain itu, aktiviti kokurikulum di luar bilik darjah turut dijadikan landasan bagimembina keyakinan diri, mengetengahkan bakat, memupuk sifat kepemimpinan, dan ketokohanmurid dalam pelbagai bidang. Aktiviti kokurikulum juga berupaya memantapkan penguasaanberbahasa murid serta menyokong pelaksanaan Standard Kurikulum Bahasa Malaysia.PENDAHULUAN
  • 8. STANDARD KURIKULUM BAHASA MALAYSIA SEKOLAH RENDAH SK TAHUN 44Standard Kurikulum Bahasa Malaysia dibina berasaskan enam tunjang, iaitu Komunikasi;Kerohanian, Sikap dan Nilai; Kemanusiaan; Literasi Sains dan Teknologi; Fizikal dan Estetika;dan Keterampilan Diri. Enam tunjang tersebut merupakan domain utama yang menyokongantara satu sama lain dan disepadukan dengan pemikiran kritis, kreatif dan inovatif.Kesepaduan ini bertujuan untuk membangunkan modal insan yang seimbang, berpengetahuandan berketerampilan seperti yang terdapat dalam Rajah 1.Rajah 1: Standard Kurikulum Berasaskan Enam TunjangTUNJANG STANDARD KURIKULUMBAHASA MALAYSIA SEKOLAH RENDAH
  • 9. STANDARD KURIKULUM BAHASA MALAYSIA SEKOLAH RENDAH SK TAHUN 45Standard Kurikulum Bahasa Malaysia Sekolah Rendah digubal untuk membolehkan muridberketerampilan dalam berbahasa dan boleh berkomunikasi untuk memenuhi keperluan diri,memperoleh pengetahuan, ilmu, kemahiran, maklumat, nilai dan idea serta hubungan sosialdalam kehidupan harian.Murid yang mengikuti pengajaran dan pembelajaran Standard Kurikulum Bahasa MalaysiaSekolah Rendah berkeupayaan untuk:i. mendengar, mengecam, mengajuk dan menentukan arah bunyi persekitaran denganteliti dan betul;ii. mendengar, memahami, dan menyebut bunyi bahasa iaitu abjad, perkataan, frasa danayat dengan betul;iii. mendengar, memahami dan memberikan respons berdasarkan arahan, pesanan danpertanyaan dengan betul;iv. bertutur dan berbual serta menyatakan permintaan tentang sesuatu perkara dalamsituasi formal dan tidak formal dengan betul secara bertatasusila;v. bercerita sesuatu perkara dan menceritakan semula perkara yang didengar, dibaca danditonton menggunakan sebutan yang jelas dan intonasi yang betul;vi. berbicara untuk menyampaikan maklumat tentang sesuatu perkara daripada pelbagaisumber dengan tepat secara bertatasusila;vii. berbincang dan mengemukakan pendapat tentang sesuatu perkara daripada pelbagaisumber secara bertatasusila;viii. membaca pelbagai perkataan, frasa dan ayat secara mekanis dengan sebutan danintonasi yang betul;ix. membaca, memahami perkataan, frasa dan ayat daripada pelbagai sumber denganlancar, sebutan yang jelas dan intonasi yang betul;x. membaca dan memahami maklumat yang tersurat dan tersirat daripada pelbagai bahanuntuk memberi respons dengan betul;xi. membaca dan menaakul untuk memindahkan maklumat yang terdapat dalam pelbagaibahan;xii. membaca pelbagai bahan bacaan bagi memperkaya kosa kata dan maklumat untukmemupuk minat membaca;xiii. melakukan aktiviti pramenulis dengan betul;xiv. menulis secara mekanis dengan betul dan kemas;1.0 MATLAMAT2.0 OBJEKTIF UMUM
  • 10. STANDARD KURIKULUM BAHASA MALAYSIA SEKOLAH RENDAH SK TAHUN 46xv. membina dan menulis perkataan, frasa dan ayat dengan betul;xvi. menulis imlak dengan tepat;xvii. mencatat dan menulis untuk menyampaikan maklumat tentang sesuatu perkara denganmenggunakan bahasa yang santun;xviii. menghasilkan penulisan kreatif dalam pelbagai genre dengan betul;xix. mengedit dan memurnikan hasil penulisan;xx. menulis ulasan berdasarkan maklumat yang diperoleh daripada pelbagai sumber;xxi. menggunakan sistem bahasa yang betul dalam pertuturan, pembacaan danpenulisan; danxxii. menghayati dan mengamalkan nilai murni, bersikap positif, semangat patriotik dankewarganegaraan melalui aktiviti berbahasa.Pembelajaran Bahasa Malaysia di sekolah rendah berfokus pada kemahiran literasi danaplikasi bahasa. Pada Tahap 1, murid-murid perlu menguasai asas kemahiran mendengar,bertutur, membaca dan menulis. Ini bermakna konsep kembali kepada asas (back to basic)diberi penekanan yang khusus. Penekanan juga diberikan kepada pembelajaran yangmenyeronokkan yang berkonsepkan aktiviti didik hibur. Pada Tahap 2 pula, penekanandiberikan kepada pengukuhan dan aplikasi kemahiran bahasa.Melalui penguasaan kemahiran bahasa ini, murid dapat berkomunikasi dalampelbagai situasi dengan lebih berkesan, manakala melalui kemahiran membaca, muriddapat meningkatkan kosa kata di samping memupuk minat membaca. Penguasaantatabahasa yang baik dapat membantu murid menghasilkan penulisan yang kreatif danberkualiti. Aktiviti didik hibur dalam pengajaran dan pembelajaran yang mengaplikasikanpelbagai pendekatan dan teknik seperti nyanyian dan permainan serta penggunaanpelbagai bahan yang menarik dapat membantu murid menguasai dan menghayatipembelajaran.4.1 Standard KurikulumStandard Kurikulum Bahasa Malaysia Sekolah Rendah digubal dengan memberikanpenekanan pada Standard Kandungan dan Standard Pembelajaran yang perlu diketahui dan3.0 FOKUSORGANISASI KANDUNGAN KURIKULUMORGANISASI KANDUNGAN KURIKULUM4.0 ORGANISASI KANDUNGAN KURIKULUM
  • 11. STANDARD KURIKULUM BAHASA MALAYSIA SEKOLAH RENDAH SK TAHUN 47boleh dilakukan oleh murid. Standard Kandungan dan Standard Pembelajaran iniberpaksikan Kemahiran Bahasa dan Sistem Bahasa yang disokong oleh elemen PengisianKurikulum.Standard ini digubal dalam bentuk pernyataan Standard Kandungan dan StandardPembelajaran yang perlu dikuasai oleh murid. Standard ini dipersembahkan dalam bentukmodular yang dibahagikan kepada bahagian dan unit yang mengandungi elemenpengetahuan, kemahiran, nilai murni, kreativiti dan inovasi yang perlu dikuasai oleh murid.Standard KandunganPernyataan tentang bidang ilmu yang patut diketahui dan dapat dilakukan oleh murid dalamsuatu tempoh persekolahan yang merangkumi aspek pengetahuan, kemahiran dan nilai.Standard PembelajaranPernyataan tentang penetapan kriteria untuk memastikan kualiti pembelajaran danpencapaian murid bagi setiap standard kandungan.4.2 Kemahiran BahasaKemahiran bahasa merupakan teras kepada Standard Kurikulum Bahasa Malaysia danpendekatan modular. Kemahiran bahasa meliputi kemahiran seperti berikut:x Kemahiran Mendengarx Kemahiran Bertuturx Kemahiran Membacax Kemahiran Menulis4.3 Pendekatan ModularStandard Kurikulum Bahasa Malaysia distrukturkan dengan menggunakan pendekatanmodular untuk memastikan penguasaan kecekapan berbahasa yang baik. Pendekatanmodular bermaksud memecahkan kemahiran kepada unit-unit kecil yang dikenali sebagaimodul. Dalam mata pelajaran Bahasa Malaysia terdapat lima modul iaitu Modul Mendengardan Bertutur, Modul Membaca, Modul Menulis, Modul Seni Bahasa dan Modul Tatabahasa.Tiga modul yang pertama berasaskan empat kemahiran iaitu kemahiran mendengar,kemahiran bertutur, kemahiran membaca dan kemahiran menulis. Modul Seni Bahasa danModul Tatabahasa menyokong modul-modul tersebut untuk mengukuhkan kecekapanberbahasa murid.4.3.1 Modul Kemahiran Mendengar dan BertuturModul Kemahiran Mendengar dan Bertutur memberi penekanan pada kemahiranmendengar dan bertutur. Kemahiran mendengar merujuk pada keupayaan muridmendengar dengan teliti, memahami dan menghayati secara lisan perkara yangdidengar dalam pelbagai situasi pengucapan, serta dapat memberikan respons.Kemahiran bertutur pula merujuk keupayaan murid berkomunikasi untuk menjalinhubungan dan menyampaikan maklumat, pendapat, perasaan serta idea yang kreatifdan kritis dengan sebutan dan intonasi yang betul secara sopan dan bertatasusila.Penggunaan tatabahasa yang betul diberikan penekanan dalam kemahiran bertutur.4.3.2 Modul Kemahiran MembacaModul Kemahiran Membaca memberikan tumpuan pada kemahiran membacadi samping penggabungjalinan kemahiran bahasa yang lain. Kemahiran
  • 12. STANDARD KURIKULUM BAHASA MALAYSIA SEKOLAH RENDAH SK TAHUN 48membaca merujuk keupayaan murid membaca dengan sebutan, intonasi, jeda,dan kelancaran yang betul. Penekanan perlu diberikan pada aspek pemahamandan penaakulan pelbagai bahan secara kritis dengan menggunakan teknik-teknikmembaca. Di samping itu, melalui modul kemahiran membaca murid jugaberupaya menghayati teks yang dibaca.4.3.3 Modul Kemahiran MenulisModul Kemahiran Menulis pula berfokuskan kemahiran menulis. Kemahiranmenulis merujuk keupayaan murid menulis perkataan dan melahirkan ideamelalui pelbagai jenis penulisan yang berkaitan dengan ilmu pengetahuan danpengalaman peribadi yang telah dilalui. Penekanan perlu diberikan padapenggunaan ayat yang gramatis, tanda baca dan ejaan yang betul, serta tulisanyang jelas dan kemas. Murid juga digalakkan menggunakan kreativiti merekauntuk menghasilkan penulisan berunsur pengetahuan dan imaginasi.Penguasaan kemahiran bahasa ini diperoleh melalui situasi dan konteks dalampelbagai bahan prosa, puisi dan grafik.4.3.4 Modul Seni BahasaModul Seni Bahasa merujuk aspek kebahasaan, keindahan dan kehalusandalam Bahasa Melayu yang perlu difahami dan dikuasai oleh murid. Penguasaanaspek seni bahasa merangkumi kecekapan memahami, mengungkap danmenghayati bahasa yang indah. Melalui pembelajaran modul ini, muridmenghasilkan dan mempersembahkan karya kreatif pelbagai genre secara lisandan bertulis melalui variasi teknik yang menarik. Aspek seni bahasa jugamenzahirkan pembelajaran yang menyeronokkan secara didik hibur..4.3.5 Modul TatabahasaModul Tatabahasa merujuk aspek morfologi dan sintaksis bahasa Melayu yangperlu difahami dan dikuasai oleh murid. Aspek ini perlu diajarkan melaluipengajaran yang terancang dengan teknik yang sesuai dan berkesan supayamurid memahami dan menggunakan tatabahasa dengan betul dan tepat dalampelbagai konteks secara lisan dan bertulis.4.4 Sistem BahasaSistem bahasa terdiri daripada tatabahasa, sistem ejaan, sebutan dan intonasi, kosa katadan peribahasa. Pelaksanaan sistem bahasa dalam pengajaran dan pembelajaran BahasaMalaysia membolehkan murid menggunakan dan mengamalkan bahasa Melayu baku.Penerangan bagi perkara tersebut dinyatakan di bawah.4.4.1 TatabahasaKandungan tatabahasa terdiri daripada morfologi dan sintaksis.1.1 MorfologiMorfologi ialah bidang ilmu bahasa yang mengkaji struktur, bentuk dan golongankata. Struktur kata ialah susunan bentuk bunyi ujaran atau lambang (tulisan)yang menjadi unit bahasa yang bermakna. Bentuk kata pula ialah unit
  • 13. STANDARD KURIKULUM BAHASA MALAYSIA SEKOLAH RENDAH SK TAHUN 49tatabahasa sama ada bentuk tunggal atau hasil daripada proses pengimbuhan,pemajmukan dan penggandaan. Golongan kata pula ialah proses menjeniskanperkataan berdasarkan keserupaan bentuk atau fungsi dengan anggota yang laindalam golongan yang sama.a. Struktur kata merujuk pola suku katabagi:i. kata asli bahasa Melayuii. kata pinjaman bahasa Melayub. Bentuk kata terdiri daripada:i. kata tunggalii. kata terbitaniii. kata gandaiv. kata majmukc. Proses pembentukan kata meliputi:i. pengimbuhanii. penggandaaniii. pemajmukanAntara ketiga-tiga proses pembentukan kata ini, yang amat kompleks ialahpengimbuhan. Oleh itu, penekanan hendaklah diberikan pada aspek penggunaanimbuhan yang betul dari segi bentuk dan makna termasuk aspek baharu dalamproses pengimbuhan.d. Golongan kata terdiri daripada:i. kata namaii. kata kerjaiii. kata adjektifiv. kata tugas1.2 SintaksisSintaksis ialah bidang ilmu bahasa yang mengkaji bentuk, struktur dan binaanayat. Hal ini bermakna, bidang sintaksis ialah kajian tentang hukum atau rumustatabahasa yang mendasari kaedah penggabungan dan penyusunan perkataanatau kelompok perkataan untuk membentuk ayat. Aspek sintaksis yangdiberikan tumpuan adalah seperti yang berikut:a. Unsur utama yang terdiri daripada kata, frasa, klausa dan aspekpembinaannya serta pembahagian subjek dan predikat.b. Jenis ayat iaitu ayat penyata, ayat tanya, ayat perintah dan ayat seruan.c. Ragam ayat iaitu ayat aktif dan ayat pasif.d. Susunan ayat, iaitu susunan biasa dan songsang.e. Binaan ayat:i. ayat dasarii. ayat tunggaliii. ayat terbitan atau ayat majmukf. Proses ayat terbitan:i. proses penggantianii. proses pengguguraniii. proses penyusunan semulaiv. proses peluasan
  • 14. STANDARD KURIKULUM BAHASA MALAYSIA SEKOLAH RENDAH SK TAHUN 4104.4.2 Sistem EjaanTanda baca penting dikuasai dalam komunikasi tulisan untuk memastikankeselarasan dan juga makna yang tepat. Misalnya, koma dan tanda noktah mewakilihentian dalam pertuturan. Penggunaan tanda baca yang betul dapat mewakiliintonasi dalam bacaan dan penulisan.Perkara yang diberikan penekanan ialah:i. Pola keselarasan huruf vokalii. Ejaan kata pinjamaniii. Ejaan kata dasar dan kata terbitan4.4.3 Sebutan dan IntonasiSebutan dan intonasi diajarkan supaya murid dapat menyebut perkataan dan ayatdengan betul serta memahami intonasi dan jeda. Kemahiran yang ditekankan ialahkebolehan mengenal pasti dan membezakan pelbagai aspek dalam sebutan danintonasi supaya murid dapat menyampaikan maksud dengan tepat.a. SebutanSebutan diajarkan supaya murid dapat menyebut sesuatu kata dengan betul.Sebutan bahasa Melayu yang diajarkan di sekolah hendaklah menggunakansebutan bahasa Melayu baku.b. IntonasiIntonasi ayat bahasa Melayu yang betul hendaklah diajarkan mengikut pola yangberikut:i. ayat penyataii. ayat tanyaiii. ayat perintahiv. ayat seruanv. ayat terbalik atau songsangvi. ayat aktifvii. ayat pasif4.4.4 Kosa kataKosa kata terdiri daripada kata umum dan istilah. Penguasaan kosa kata perluditingkatkan dan dikembangkan agar murid dapat mengungkap maklumat dan buahfikiran selaras dengan penambahan ilmu dalam mata-mata pelajaran yang dipelajaripada peringkat sekolah rendah.4.4.5 PeribahasaPeribahasa merangkumi simpulan bahasa, perumpamaan, pepatah, bidalan,perbilangan dan kata-kata hikmat perlu diajarkan dalam mata pelajaran BahasaMalaysia. Pemilihan peribahasa hendaklah mengutamakan falsafah, keperibadian,dan nilai murni masyarakat Malaysia yang berbilang kaum.Nota:Buku Tatabahasa Dewan Edisi Terkini ialah buku tatabahasa pegangan yang menjadi sumber rujukan dalampengajaran dan pembelajaran.
  • 15. STANDARD KURIKULUM BAHASA MALAYSIA SEKOLAH RENDAH SK TAHUN 411Pengisian kurikulum mengambil kira elemen merentas kurikulum iaitu unsur-unsur yang diserapdalam setiap mata pelajaran. Elemen Merentas Kurikulum ialah unsur nilai tambah yangditerapkan dalam proses pengajaran dan pembelajaran selain yang ditetapkan dalam standardkandungan. Penerapan elemen ini bertujuan untuk mengukuhkan kemahiran dan keterampilanmodal insan yang dihasratkan serta dapat menangani cabaran semasa dan masa hadapan.Pengisian kurikulum tersebut merangkumi perkara-perkara yang berikut:5.1 IlmuIlmu merangkumi pelbagai bidang ilmu dan disiplin, contohnya ilmu dalam bidang sains,dan geografi dapat digunakan untuk memperkembangkan ilmu bahasa dan kemahiranbahasa. Ilmu lain yang berkaitan dengan hal-hal semasa juga boleh dipertimbangkan olehguru dalam pengajaran dan pembelajaran.5.2 KemahiranDalam pengajaran dan pembelajaran bahasa kemahiran mendengar, kemahiran bertutur,kemahiran membaca dan kemahiran menulis merupakan kemahiran yang mestidilaksanakan. Selain itu, kemahiran merentas kurikulum tidak diketepikan, malah turutditekankan dalam KSSR yang meliputi pelbagai kemahiran yang boleh membantumempertingkatkan pengetahuan dan potensi diri murid. Kemahiran menggunakan teknologimaklumat merupakan antara kemahiran merentas kurikulum yang diaplikasikan dalampengajaran bahasa Malaysia.5.3 Nilai MurniPenyerapan nilai murni dalam Kurikulum Bahasa Malaysia bertujuan melahirkan insan yangberketerampilan dan memiliki akhlak yang mulia. Selain itu, penghayatan dan amalan murnidapat membentuk generasi muda yang berhemah tinggi dan berkeperibadian luhur.Pemahaman dan kesedaran tentang nilai murni dalam masyarakat Malaysia harus dipupuksecara langsung atau tidak langsung selaras dengan nilai-nilai sejagat. Antara nilai murniialah:x Baik hatix Berdikarix Hemah tinggix Hormat-menghormatix Kasih sayangx Keadilanx Kebebasanx Keberanian5.0 PENGISIAN KURIKULUM
  • 16. STANDARD KURIKULUM BAHASA MALAYSIA SEKOLAH RENDAH SK TAHUN 412x Kebersihan fizikal dan mentalx Kejujuranx Kerajinanx Kerjasamax Kesederhanaanx Kesyukuranx Rasionalx Semangat bermasyarakat5.4 PatriotismeElemen patriotisme dalam pendidikan Bahasa Malaysia mengutamakan pemupukansemangat cinta dan taat akan negara, serta berbangga sebagai rakyat Malaysia. Semangatpatriotisme dipupuk melalui mata pelajaran dan aktiviti kokurikulum bertujuan untukmelahirkan warganegara yang mempunyai jati diri, cinta akan bahasa dan bangsa, sertameningkatkan komitmen individu terhadap negara.5.5 Peraturan SosiobudayaPeraturan sosiobudaya dalam Kurikulum Bahasa Malaysia merangkumi kesantunan bahasa,laras bahasa dan peribahasa yang diamalkan dalam kalangan masyarakat Malaysia.Peraturan sosiobudaya ini mencerminkan falsafah dan keperibadian masyarakat Malaysia.5.6 Sains dan TeknologiPenerapan empat unsur sains dan teknologi dalam mata pelajaran lain dilaksanakanmelalui kandungan, aktiviti dan bahan atau prasarana. Antara unsurnya ialah pengetahuansains dan teknologi, kemahiran saintifik dan penggunaan teknologi dalam aktiviti pengajarandan pembelajaran.5.7 Pendidikan Alam SekitarPendidikan alam sekitar bertujuan untuk menanam sikap mencintai dan menyayangi alamsekitar dalam jiwa murid. Aktiviti berkaitan dengan alam sekitar boleh memberikankesedaran dan membentuk etika murid untuk menghargai alam.5.8 Kreativiti dan InovasiElemen kreativiti dan inovasi perlu diintegrasikan dalam pengajaran dan pembelajaranKSSR bagi membangun dan mengembangkan tahap potensi kreativiti mengikut keupayaanindividu murid. Selain itu, kreativiti merujuk kepada tindakan penghasilan idea, pendekatanatau tindakan baharu. Inovasi pula ialah proses menjana idea dan mengaplikasi idea, sertakreatif dalam konteks tertentu. Kreativiti dan inovasi perlu digandingkan dalam pengajarandan pembelajaran untuk membangunkan modal insan yang dihasratkan.5.9 KeusahawanElemen keusahawanan merentas kurikulum merupakan satu pendekatan membudayakankeusahawanan. Proses ini melibatkan pembentukan sikap keusahawan serta amalan nilaimoral dan etika dalam keusahawanan. Penerapan elemen keusahawanan bertujuan
  • 17. STANDARD KURIKULUM BAHASA MALAYSIA SEKOLAH RENDAH SK TAHUN 413membentuk ciri-ciri dan amalan keusahawanan sehingga menjadi satu budaya dalamkalangan murid.5.9 Teknologi Maklumat dan KomunikasiKemahiran Teknologi Maklumat dan Komunikasi (TMK) diaplikasikan dan diintegrasikansupaya murid dapat belajar mengenai perkakasan dan perisian. Selain itu, guru dan muridmenggunakan TMK sebagai alat untuk mengajar dan belajar. Murid juga belajar melaluiTMK untuk mengakses maklumat dan ilmu pengetahuan menggunakan media TMK sepertiinternet dan lain-lain untuk meluaskan penerokaan ilmu pengetahuan dalam urusankehidupan.6.1 Prinsip 5P6.1 Prinsip 5PDalam mencapai hasrat dan matlamat KSSR, strategi pengajaran dan pembelajaran BahasaMalaysia perlu menekankan prinsip 5P iaitu penggabungjalinan, penyerapan, penilaian,pemulihan dan pengayaan. Hal ini selaras dengan usaha memenuhi konsep bersepadudalam Falsafah Pendidikan Kebangsaan. Strategi pengajaran dan pembelajaran tersebutadalah seperti yang berikut:PenggabungjalinanPenggabungjalinan memainkan peranan penting dalam proses pengajaran danpembelajaran. Melalui proses ini, beberapa kemahiran dapat dikuasai serentak. Cara inijuga dapat mengelakkan kebosanan dalam proses pembelajaran. Kemahiran dapatdigabungjalinkan, sama ada kemahiran mendengar, bertutur, membaca dan menulis yangterdapat dalam standard kandungan.PenyerapanDalam pengajaran dan pembelajaran Bahasa Malaysia, unsur ilmu, nilai murni dankemahiran bernilai tambah boleh diserapkan. Penyerapan ini mengandungi pelbagai ilmudan disiplin daripada mata-mata pelajaran lain, nilai murni masyarakat Malaysia sertakemahiran berfikir, kemahiran menaakul dan kemahiran yang lain membolehkan muridmenguasai kemahiran secara bersepadu menerusi pengalaman pembelajaran bahasa.PenilaianPenilaian dianggap sebagai sebahagian daripada proses pengajaran dan pembelajaran.Penilaian merupakan suatu aktiviti untuk mendapatkan maklumat yang berguna bagimenentukan pencapaian sesuatu objektif pengajaran dan pembelajaran. Penilaian perlulahdijalankan secara berterusan dalam proses pengajaran dan pembelajaran. Melalui prosespenilaian berterusan segala kelemahan dapat dikenal pasti dan jenis tindakan susulan dapatdiambil terhadap seseorang murid sama ada berbentuk pemulihan atau pengayaan.6.1 Prinsip 5P6.0 STRATEGI PENGAJARAN DANPEMBELAJARAN
  • 18. STANDARD KURIKULUM BAHASA MALAYSIA SEKOLAH RENDAH SK TAHUN 414PemulihanProgram pemulihan disediakan untuk membantu murid menguasai kemahiran asas yangbelum dapat dikuasai dalam tempoh yang ditetapkan. Bahan untuk program ini terdiridaripada kad, carta, bahan maujud, alat permainan, dan lain-lain yang boleh digunakansecara berperingkat-peringkat daripada yang mudah kepada yang sukar. Pelaksanaanprogram ini adalah mengikut kadar kemampuan murid menguasai sesuatu kemahiran.PengayaanProgram pengayaan disediakan untuk memantapkan kebolehan, keupayaan, bakat danminat murid. Murid hendaklah diberikan bahan yang berbeza untuk digunakan secarabersendirian atau dengan bimbingan guru. Bahan bacaan tambahan, kad, permainan danbahan aktiviti boleh diberikan kepada murid yang telah menguasai kemahiran dalam jangkamasa yang ditetapkan atau lebih awal daripada jangka masa yang ditentukan.6.2 Pendekatan Berpusatkan MuridStrategi pengajaran dan pembelajaran dalam mata pelajaran Bahasa Malaysia haruslahberpusatkan murid bagi membolehkan mereka berinteraksi dan menguasai kemahiranbelajar melalui pengalaman sendiri. Oleh itu, murid dapat membina keyakinan berbahasa.6.3 Pendekatan TematikPengajaran dan pembelajaran mata pelajaran Bahasa Malaysia diajar berdasarkan tema.Melalui pengajaran dan pembelajaran bertema kemahiran bahasa, pembelajaran tatabahasadan pengembangan kosa kata dapat disepadukan dan dikukuhkan. Di samping itu, ilmudaripada mata pelajaran dan disiplin lain lebih mudah diserapkan. Bagi tujuan ini,perancangan dan penentuan tema pengajaran meliputi pelbagai bidang ilmu, halpersendirian dan isu kemasyarakatan, menghargai warisan, mencungkil daya kreativiti daninovasi dalam diri murid serta isu-isu semasa. Cakupan tema yang ditekankan adalahseperti yang berikut:KekeluargaanTema kekeluargaan merangkumi hubungan sesuatu keluarga yang melibatkan keluargaasas dan keluarga kembangan. Tema ini diajarkan kepada murid sekolah rendah agarmenghargai dan menghormati setiap ahli keluarga.KemasyarakatanTema ini merujuk tanggungjawab individu dan kumpulan dalam kalangan pelbagai bangsauntuk mewujudkan keharmonian dan kepentingan hidup bersama. Tema ini sesuaidiajarkan kepada murid sekolah rendah agar dapat melahirkan masyarakat yang berakhlakmulia, hormat-menghormati, bekerjasama dan bertanggungjawab.Kesihatan dan KebersihanTema kesihatan dan kebersihan merujuk kesempurnaan dari segi kesihatan fizikal, mentaldan sosial. Tema ini sesuai diajarkan kepada murid sekolah rendah agar mendapatpendedahan awal berkaitan penjagaan kebersihan dan kesihatan, dan amalan gaya hidupsihat.KeselamatanTema keselamatan merujuk keupayaan murid melindungi diri daripada bahaya ketikaberada dalam pelbagai persekitaran. Tema ini sesuai diajarkan kepada murid supayadapat memberi kesedaran agar mengutamakan keselamatan.
  • 19. STANDARD KURIKULUM BAHASA MALAYSIA SEKOLAH RENDAH SK TAHUN 415PerpaduanTema perpaduan merujuk kepentingan hubungan erat yang terbentuk hasil daripada toleransidalam kalangan penduduk Malaysia. Tema ini sesuai diajarkan kepada murid dalam usahamemupuk semangat perpaduan.Kebudayaan, Kesenian dan EstetikaTema kebudayaan, kesenian dan estetika merangkumielemen-elemen budaya yang terdapat dalam masyarakat pelbagai kaum di Malaysia yangmeliputi adat dan budaya. Tema ini sesuai diajarkan kepada murid agar kehalusan senibudaya ini dapat dihayati oleh murid sebagai asas pembentukan jati diri warga Malaysia.Jati diri, Patriotisme dan KewarganegaraanTema jati diri, patriotisme dan kewarganegaraan merujuk kepada keupayaan muridmenzahirkan keperibadian insan yang seimbang dari segi fizikal, mental, emosi dan rohaniserta mempunyai semangat juang dan sanggup berkorban demi negara. Tema ini sesuaidiajarkan kepada murid untuk melahirkan masyarakat madani, yang mempunyai semangatkekitaan dan setia kepada negara.Sains, Teknologi dan InovasiTema sains, teknologi dan inovasi merujuk ilmu pengetahuan yang teratur atau sistematik yangboleh diuji, dibuktikan kebenarannya dan dapat menghasilkan sesuatu yang baharu. Tema inisesuai diajarkan kepada murid agar dapat melahirkan insan yang berupaya menjana idea untukmenghasilkan sesuatu yang berinovasi.Alam Sekitar dan Teknologi HijauTema alam sekitar dan teknologi hijau merujuk keupayaan murid menjaga dan mengurusalam sekitar untuk kesejahteraan kehidupan manusia, haiwan serta tumbuhan bagikelangsungan kehidupan generasi akan datang. Tema ini sesuai diajarkan agar murid cintadan prihatin serta bertanggungjawab dalam menjaga alam sekitar dan teknologi hijau.Pertanian dan PenternakanTema pertanian dan penternakan memberi murid pendedahan perihal asas-asas pertaniandan penternakan secara tradisional dan moden. Tema ini sesuai diajarkan untuk memupukkesedaran tentang kepentingan bidang bioteknologi pertanian dan penternakan dalamkehidupan.Ekonomi, Keusahawanan dan Pengurusan KewanganTema ekonomi memberi murid pendedahan perihal bidang peniagaan dan keusahawanandalam menjana pendapatan dan pengurusan perdagangan. Tema ini sesuai diajarkan untukmemupuk kesedaran tentang kepentingan bidang ekonomi dan membudayakan sikapkeusahawanan dalam kehidupan.6.4 Kepelbagaian Kaedah dan TeknikProses pengajaran dan pembelajaran mata pelajaran Bahasa Malaysia sekolah rendahmenggalakkan penggunaan pelbagai kaedah dan teknik mengajar. Guru boleh memilihkaedah pengajaran dan pembelajaran yang sesuai dengan kebolehan murid.Keberkesanan pengajaran dan pembelajaran bergantung pada pengolahan teknik danpenggunaan bahan bantu mengajar, serta teknologi yang dapat merangsang danmenggalakkan murid berkomunikasi dan berinteraksi serta berfikir secara kritis, kreatif daninovatif.
  • 20. STANDARD KURIKULUM BAHASA MALAYSIA SEKOLAH RENDAH SK TAHUN 4166.4.1 Kemahiran BerfikirKemahiran berfikir diajarkan kepada murid melalui pelbagai aktiviti yangmemerlukan pemikiran kritis dan kreatif dalam kemahiran mendengar, bertutur,membaca, dan menulis. Kemahiran berfikir sama ada dari segi mengkonsepsikanidea, menyelesaikan masalah, atau membuat keputusan adalah penting dalamkehidupan harian dan kerjaya murid pada masa hadapan.6.4.2 Didik HiburDidik hibur merupakan satu pendekatan dalam proses pengajaran danpembelajaran yang menekankan persekitaran pembelajaran yang menyeronokkansecara terancang. Unsur keseronokan akan wujud melalui pembelajaran yangsantai, menarik, menghibur, bermakna dan memikat yang dapat membantumemperkukuh pemahaman dan mendorong murid untuk belajar. Didik hiburdilaksanakan mengikut konteks isi kandungan mata pelajaran serta menggunakankepelbagaian strategi dan bahan pengajaran dan pembelajaran yang dapatmenimbulkan cabaran, rasa ingin tahu, kawalan, fantasi, kerjasama, persaingansihat dan pengiktirafan. Pendekatan ini dilaksanakan merentas kemahiran bahasaiaitu kemahiran mendengar, bertutur, membaca, menulis, aspek seni bahasa danaspek tatabahasa6.4.3 Penyelesaian MasalahPenyelesaian masalah ialah aktiviti pengajaran dan pembelajaran yang melibatkanmasalah berbentuk perkataan, masalah bukan mekanis, teka-teki, kuiz ataupenggunaaan kemahiran matematik dalam situasi sebenar. Murid perlumenggunakan kemahiran, prinsip dan teori yang telah mereka pelajari untukmenyelesaikan masalah yang diberikan. Kaedah ini menggalakkan murid berfikirkritis dan kreatif.6.4.4 Pembelajaran Berasaskan ProjekMurid menggunakan maklumat lama dan baharu untuk menghasilkan sesuatu yangnyata. Kaedah ini melibatkan murid-murid mengkaji sesuatu isu, menyiasat danmempersembahkan dapatannya. Ini juga dapat membantu guru menilaiperkembangan atau kualiti pembelajaran murid. Murid lebih bermotivasi keranadapat menghasilkan sesuatu produk.6.4.5 Pembelajaran KoperatifKaedah pengajaran dan pembelajaran dalam kumpulan yang membolehkan muridbelajar bersama-sama, saling belajar dan membantu antara satu sama lain untukmenyelesaikan sesuatu tugasan. Ahli kumpulan bekerja, berkongsi idea, bahan danperalatan untuk mencapai matlamat sendiri dan kumpulan. Pembelajaran koperatifini dapat menghasilkan satu tugasan kumpulan, di samping mewujudkan interaksiantara murid, kerjasama dan semangat berpasukan yang kuat.6.4.6 Kecerdasan PelbagaiKecerdasan pelbagai dapat mengembangkan potensi kecerdasan, minat dankecenderungan murid kerana setiap individu mempunyai kecerdasan dankebolehan yang berbeza. Kecerdasan pelbagai merangkumi kecerdasan verballinguistik, logik matematik, muzik, kinestetik, visual ruang, interpersonal,intrapersonal dan naturalis.
  • 21. STANDARD KURIKULUM BAHASA MALAYSIA SEKOLAH RENDAH SK TAHUN 4176.4.7 Pembelajaran KontekstualPembelajaran kontekstual ialah kaedah pembelajaran yang mengaitkan isi pelajarandengan pengalaman harian individu, masyarakat dan alam pekerjaan.Pembelajaran berlaku apabila murid berupaya menghubungkaitkan pengetahuanbaharu secara bermakna dan menghayati kerelevanan pembelajaran dalamkehidupan mereka.6.4.8 Pembelajaran KonstruktivismePembelajaran konstruktivisme dalam pendidikan dapat melahirkan murid yangberkeupayaan untuk membina pemahaman dan pengetahuan baharu merekasendiri berdasarkan pengalaman sedia ada. Pembelajaran ini menjadikan muridlebih faham, yakin dan seronok belajar sepanjang hayat mereka.6.4.9 Kemahiran Belajar Cara BelajarKemahiran belajar cara belajar perlu diajarkan kepada murid supaya mereka pekaterhadap teknik pembelajaran yang berkesan. Penguasaan kemahiran inimembolehkan murid meningkatkan pengetahuan, cekap bertindak untukmenghadapi dunia yang sering berubah dan berkeupayaan mengamalkanpembelajaran seumur hidup.6.4.10 Kajian Masa DepanKajian masa depan ialah satu pendekatan pengajaran untuk mendidik murid agarlebih prihatin terhadap sesuatu perkara atau isu yang berlaku pada masa lampau,masa kini dan masa depan. Hal ini bermakna, murid dapat membuat ramalan,menjangka akibat serta menangani perubahan supaya mereka mendapat manfaatyang maksimum.6.4.11 Pembelajaran Akses KendiriPembelajaran Akses Kendiri (PAK) ialah satu program yang membolehkan muridbelajar secara kendiri melalui penggunaan bahan pembelajaran. Murid diberipeluang memilih aktiviti, menilai hasil kerja dan memantau kemajuan mereka sendiriagar mereka bertanggungjawab dan berdikari terhadap pembelajaran mereka.6.4.12 Pembelajaran Luar Bilik DarjahAktiviti kurikulum yang dilaksanakan di luar bilik darjah secara terancang danberstruktur serta berpusatkan murid. Kaedah ini dapat mengukuhkan pemahamanmurid terhadap konsep yang dipelajari semasa di dalam bilik darjah, memberipengalaman pembelajaran dalam situasi yang sebenar, mengembangkankemahiran sosial dan kerja berpasukan.6.4.13 Pembelajaran MasteriPembelajaran Masteri memastikan semua murid menguasai hasil pembelajarandalam sesuatu unit sebelum berpindah ke unit pembelajaran yang lain.Pembelajaran ini dipecahkan kepada unit yang lebih kecil untuk mudah dikuasai.Murid mesti menguasai 80% aras masteri sebelum berpindah ke unit pembelajaranyang baharu.
  • 22. STANDARD KURIKULUM BAHASA MALAYSIA SEKOLAH RENDAH SK TAHUN 4186.5 Kepelbagaian Sumber BahanPenggunaan pusat sumber dan komputer amatlah digalakkan dalam pengajaran danpembelajaran Bahasa Malaysia. Bahan-bahan sumber seperti akhbar, majalah, bukurujukan, kamus, Internet, bahan sastera dan bahan berunsur ilmu hendaklah digunakandalam pengajaran dan pembelajaran serta untuk bacaan ekstensif.
  • 23. BAHAGIAN 2CADANGAN STRATEGI PENGAJARANDAN PEMBELAJARAN
  • 24. Kemahiran Mendengar dan Bertutur Tahun 4 SK21Standard Kandungan dan Standard Pembelajaran Kemahiran Mendengar menentukankeupayaan murid supaya berkebolehan mendengar dengan teliti, memahami, dan menghayatiperkara yang didengar dalam pelbagai situasi pengucapan, serta dapat memberikan maklumbalas. Manakala Kemahiran Bertutur merujuk kepada keupayaan murid berbicara secara lisanuntuk menjalin hubungan, menyampaikan maklumat, pendapat, perasaan, serta idea yang kritisdan kreatif, dengan sebutan dan intonasi yang betul secara bertatasusila. Penekanan diberikanpada pengucapan yang menggunakan tatabahasa yang betul dan ungkapan yang dilafazkansecara bertatasusila.Dalam strategi pengajaran dan pembelajaran kemahiran mendengar dan bertutur, guru perlumenetapkan objektif yang perlu dicapai oleh murid dengan merujuk Standard Kandungan danStandard Pembelajaran Kemahiran Mendengar dan Bertutur.Standard Kandungan Kemahiran Mendengar Dan BertuturMurid patut mengetahui dan boleh:1.2 Mendengar, mengecam dan menyebut bunyi bahasa iaitu abjad, sukukata, perkataan,frasa dan ayat dengan betul.1.3 Mendengar, memahami dan memberi respons terhadap sesuatu arahan, soalan danpesanan yang didengar dengan betul.1.4 Bertutur, berbual dan menyatakan permintaan tentang sesuatu perkara daripadapelbagai sumber dalam situasi formal dan tidak formal secara bertatasusila.1.5 Bercerita dan menceritakan sesuatu perkara semula dengan tepat menggunakansebutan yang jelas dan intonasi yang betul.1.6 Berbicara untuk menyampaikan maklumat tentang sesuatu perkara daripada pelbagaisumber dengan tepat secara bertatasusila.1.7 Berbincang dan mengemukakan pendapat tentang sesuatu perkara daripada pelbagaisumber secara bertatasusila.1.0 STANDARD KANDUNGAN DAN STANDARDPEMBELAJARAN KEMAHIRANMENDENGAR DAN BERTUTUR
  • 25. Kemahiran Mendengar dan Bertutur Tahun 4 SK22Standard Pembelajaran Kemahiran Mendengar Dan Bertutur1.2.6 Mendengar, memahami dan menyebut ayat pelbagai jenis dengan struktur binaanayat yang betul dan tepat.1.3.1 Mendengar, memahami dan memberikan respons yang sesuai secara lisan atau geraklaku terhadap arahan berdasarkan ayat perintah dengan betul.1.3.2 Mendengar, memahami dan memberikan respons terhadap soalan tanpa kata tanyasecara lisan dengan betul.1.3.3 Mendengar, memahami dan memberikan respons dengan menyampaikan pesananyang betul mengikut urutan.1.4.1 Bertutur tentang sesuatu perkara daripada pelbagai sumber dengan menggunakanayat yang gramatis dalam situasi formal dan tidak formal secara bertatasusila.1.4.2 Berbual tentang sesuatu perkara menggunakan kata gelaran yang sesuai dalamsituasi tidak formal secara bertatasusila.1.4.3 Berbual tentang sesuatu perkara menggunakan kata ganti nama diri orang dan kataganti nama diri tanya dengan betul dalam situasi formal dan tidak formal secarabertatasusila.1.4.4 Menyatakan permintaan tentang sesuatu perkara dengan menggunakan kata danbahasa badan yang sesuai dalam situasi tidak formal secara bertatasusila.1.5.1 Bercerita tentang sesuatu perkara dengan tepat, sebutan yang jelas dan intonasi yangbetul menggunakan ayat yang mengandungi wacana.1.5.2 Menceritakan sesuatu perkara yang dilihat dan yang ditonton dengan tepat, sebutanyang jelas dan intonasi yang betul menggunakan ayat yang mengandungi wacana.1.6.1 Berbicara untuk mendapatkan maklumat yang tersirat dengan tepat tentang sesuatuperkara secara bertatasusila.1.6.2 Menyampaikan maklumat tentang sesuatu perkara daripada media cetak dalambentuk pengumuman dengan menggunakan ayat yang gramatis secara bertatasusila.1.7.2 Berbincang dan mengemukakan pendapat tentang sesuatu perkara daripada pelbagaisumber dengan menggunakan ayat yang gramatis secara bertatasusila.
  • 26. Kemahiran Mendengar dan Bertutur Tahun 4 SK23Semasa merancang strategipengajaran dan pembelajaran bagikemahiran mendengar dan bertutur,guru perlu memberi pertimbanganaktiviti yang sesuai sebelum, semasadan selepas kemahiran mendengardan bertutur yang diajar. Pengajarandan pembelajaran kemahiran ini bolehdilaksanakan melalui pelbagai aktivitisecara terancang bagi mencapaiobjektif yang telah ditentukan. Guruboleh merancang strategi pengajarandan pembelajaran dengan pelbagaicara seperti dalam contoh rancanganmengajar yang disediakan ini.1.0 STRATEGI PENGAJARAN DANPEMBELAJARAN KEMAHIRANMENDENGAR DAN BERTUTUR
  • 27. Kemahiran Mendengar dan Bertutur Tahun 4 SK24TEMA KESIHATANTAJUK Faedah BersukanMASASTANDARDPEMBELAJARAN1.7.2Berbincang dan mengemukakan pendapat tentang sesuatuperkara daripada pelbagai sumber dengan menggunakanayat yang gramatis secara bertatasusila.OBJEKTIFPada akhir pengajaran murid dapat:i. berbincang tentang faedah bersukan menggunakan ayat yanggramatis secara bertatasusila.ii. mengemukakan pendapat tentang aktiviti sukan berdasarkangambar.PENGISIANKURIKULUMIlmu : Pendidikan Kesihatan, Celik KewanganNilai : Menjaga kesihatan, Toleransi, Bekerjasama, MenghargaiMasaEMK : Kreativiti dan Inovasi, TMKKB : Menjana IdeaTKP : Verbal Linguistik, InterpersonalSISTEM BAHASATatabahasa : SintaksisKosa Kata : Gejala, sosial, memudaratkan, toleransi, terjebakBAHAN BANTUBELAJARSlaid ‘power point’, petikan teks dan lembaran kerjaPENILAIANPENGAJARANDANPEMBELAJARANMurid memberi pendapat tentang faedah bersukan menggunakan ayatyang gramatis secara bertatasusilaREFLEKSI
  • 28. Kemahiran Mendengar dan Bertutur Tahun 4 SK25STRATEGI PENGAJARAN DAN PEMBELAJARANAKTIVITI PENGISIAN KURIKULUM CATATANBersoal jawab1. Guru menayangkan slaiddan minta murid menyebutaktiviti sukan yang dilihat.Contoh:x badmintonx bolingx bola sepakx squashx berbasikal2. Guru bersoal jawabtentang pelbagai aktivitisukan tersebut.3. Murid menerangkan carauntuk mendapatkan wangbagi membeli peralatansukan yang merekaminati.Ilmu : PJKNilai : MementingkankesihatanEMK : TMKIlmu : Celik Kewangan.KB : MenjanaIdeaLampiran 1Membaca dan berbincang1. Murid membaca senyappetikan yang diedarkanuntuk mendapatkanmaklumat.2. Murid membaca tekssecara individu,berpasangan atauberkumpulan.3. Guru dan muridberbincang tentang aktivitisukan berdasarkan teksNilai : BekerjasamaEMK : KreativitiBCB : BcaanMekanisTKP : VerballinguistikLampiran 2(i),Lampiran 2(ii)N
  • 29. Kemahiran Mendengar dan Bertutur Tahun 4 SK26AKTIVITI PENGISIAN KURIKULUM CATATANmenggunakan ayat yanggramatis berpandukansoalan yang diberi.Menyampaikan pendapat1. Setiap kumpulan diberipetikan perenggan dandiminta berbincangtentang petikan tersebut.2. Wakil kumpulan dimintamengemukakan pendapattentang faedah bersukanmenggunakan ayat yanggramatis di hadapankelas.3. Murid lain memberirespons terhadappendapat yangdikemukakan denganbimbingan guru.TKP : InterpersonalLampiran 3Penilaian1. Murid berbincang tentanggambar yang diberi.2. Murid mengemukakanpendapat tentang aktivitisukan berdasarkangambar denganmenggunakan ayat yanggramatis.Nilai : Bekerjasama KP : VerbalLinguistikLampiran 4Pemulihan1. Murid menyatakanpendapat tentang aktivitisukan yang terdapatdalam gambar secaraberpandu berdasarkanLampiran 5
  • 30. Kemahiran Mendengar dan Bertutur Tahun 4 SK27AKTIVITI PENGISIAN KURIKULUM CATATANsoalan yang diberi.Pengayaan1. Murid mengemukakanpendapat secara bertulistentang sukan yangmereka minati.Lampiran 6
  • 31. Kemahiran Mendengar dan Bertutur Tahun 4 SK28Lampiran 1Bersoal jawab tentang aktiviti sukan yang dipaparkanmelalui tayangan slaid ‘powerpoint’ atau gambar.
  • 32. Kemahiran Mendengar dan Bertutur Tahun 4 SK29Lampiran 2(i)Bersukan merupakan satu kegiatan yang penting dalam kehidupan kita.Badan yang sihat terhasil daripada kerajinan kita bersukan. Jika kita tidakbersukan, badan kita akan lemah dan mudah diserang penyakit. Walaubagaimanapun, di negara kita, masih banyak orang yang tidak aktif dalam sukanwalaupun kerajaan telah menyediakan pelbagai kemudahan sukan.Bersukan ada pelbagai jenis. Antara aktiviti sukan yang popular ialaholahraga, renang, badminton, bola sepak, berjoging, berjalan kaki, squash, dansebagainya. Anggota badan kita akan menjadi cergas dan kuat denganbersukan. Justeru, kita harus melibatkan diri dalam aktiviti sukan atau beriadahsekurang-kurangnya dua kali seminggu.Di samping itu, menerusi kegiatan sukan juga, kita dapat membentuk sifat-sifat yang mulia seperti bekerjasama, sabar, bertolak ansur, dan semangattoleransi. Malah, dengan bersukan juga dapat mewujudkan keharmonian danperpaduan antara kaum di negara kita.Penyertaan dalam bidang sukan juga dapat mengisi masa lapang kitadengan aktiviti yang berfaedah. Bersukan dapat menghindarkan diri kitadaripada terjebak dalam gejala yang tidak bermoral seperti melepak, mencuri,dan menagih dadah. Gejala sosial ini akan merosakkan diri kita. Lantaran itu,kita perlu menjauhi gejala sosial yang akan memudaratkan kita.Kesimpulannya, kita haruslah menjadikan sukan sebagai satu daripadaaktiviti harian kita. Dengan bersukan, kita akan hidup sihat dan sejahtera. Badanyang sihat pula akan melahirkan minda yang cerdas.Baca petikan di bawah.
  • 33. Kemahiran Mendengar dan Bertutur Tahun 4 SK30Lampiran 2(ii)Kemukakan pendapat kamu berdasarkansoalan yang diberi dengan menggunakan ayatyang gramatis.2. Mengapakah aktiviti sukan menjadikan badan kita cergas dan kuat?1. Mengapakah kebanyakan orang tidak aktif bersukan walaupun kerajaan telahmenyediakan pelbagai kemudahan sukan?4. Apakah faedah yang diperolehi dengan melibatkan diri dalam aktiviti sukan?3. Bagaiamanakah aktiviti sukan dapat mewujudkan keharmonian dan perpaduanantara kaum di negara kita?
  • 34. Kemahiran Mendengar dan Bertutur Tahun 4 SK31Lampiran 2Bincangkan dan kemukakan pendapat kamu berdasarkanpetikan perenggan yang diberi menggunakan ayat yangtiBincangkan tentang aktiviti-aktiviti bersukan.Bersukan ada pelbagai jenis. Antara aktiviti sukan yang popular ialaholahraga, renang, badminton, bola sepak, berjoging, berjalan kaki, skuasy, dansebagainya. Anggota badan kita akan menjadi cergas dan kuat dengan bersukan.Justeru, kita harus melibatkan diri dalam aktiviti sukan atau beriadah sekurang-KUMPULAN 2Bincangkan tentang kebaikan bersukan.Bersukan merupakan salah satu kegiatan yang penting dalam kehidupan kita.Badan yang sihat terhasil daripada kerajinan kita bersukan. Jika kita tidak bersukan,badan kita akan lemah dan mudah diserang penyakit. Walau bagaimanapun, dinegara kita, masih banyak orang yang tidak aktif dalam sukan walaupun kerajaantelah menyediakan pelbagai kemudahan sukan.KUMPULAN 1Di samping itu, menerusi kegiatan sukan juga, kita dapat membentuk sifat-sifat yang mulia seperti bekerjasama, sabar, bertolak ansur, dan semangat toleransi.Malah, dengan bersukan juga dapat mewujudkan keharmonian dan perpaduanantara kaum di negara kita.KUMPULAN 3 Bincangkan tentang bagaimana perpaduan kaum dapatdiwujudkan melalui sukan.Penyertaan dalam bidang sukan juga dapat mengisi masa lapang kita denganaktiviti yang berfaedah. Bersukan dapat menghindarkan diri kita daripada terjebakdalam gejala yang tidak bermoral seperti melepak, mencuri, dan menagih dadah.Gejala sosial ini akan merosakkan diri kita. Lantaran itu, kita perlu menjauhi gejalasosial yang akan memudaratkan kita.KUMPULAN 4 Bincangkan tentang aktiviti berfaedah untuk mengisi masalapang
  • 35. Kemahiran Mendengar dan Bertutur Tahun 4 SK32Lampiran 4Penilaian________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________Tulis pendapat kamu tentang aktiviti sukan dalamgambar.
  • 36. Kemahiran Mendengar dan Bertutur Tahun 4 SK33Lampiran 5PemulihanBincangkan pendapat kamu tentang:1. Nama permainan yang disukai / dipilih.2. Mengapakah kamu memilih permainan itu?3. Apakah yang kamu perlu lakukan untuk menjadi seorang pemain negara?4. Berapakah bilangan pemain yang sesuai untuk memainkan permainan itu?5. Bagaimanakah cara untuk menjadikan negara kita juara bagi permainantersebut?Pilih satu daripada permainan berikut.Kemukakan pendapat kamu tentang gambardipilih berdasarkan soalan yang diberi.
  • 37. Kemahiran Mendengar dan Bertutur Tahun 4 SK34Lampiran 6Pengayaan____________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________Kemukakan pendapat tentang sukan yang kamuminati dan tulis pendapat kamu itu dalam satuperenggan.
  • 38. Kemahiran Mendengar dan Bertutur Tahun 4 SK35TEMA KESELAMATANTAJUK BanjirMASASTANDARDPEMBELAJARAN1.3.3Mendengar, memahami dan memberikan respons denganmenyampaikan pesanan yang betul mengikut urutan.OBJEKTIFPada akhir pengajaran, murid dapat:i. menyampaikan pesanan dengan betul mengikut urutanberdasarkan bahan yang didengar daripada pita rakaman.ii. menyampaikan pesanan yang betul mengikut urutan berdasarkankad yang diberi.PENGISIANKURIKULUMIlmu : Kajian Tempatan, Celik KewanganNilai : Berhati-hati, Patuh, BekerjasamaEMK : TMK, SimpananKB : Menjana Idea, Menyusun AturBCB : Mendengar dengan berkesan, mencatat nota, mengingatTKP : InterpersonalSISTEM BAHASA Tatabahasa : Ayat MajmukBAHAN BANTUBELAJARKad gambar, kad pesanan, pita rakaman dan lembaran kerjaPENILAIANPENGAJARANDANPEMBELAJARANMurid dapat menyampaikan pesanan yang betul mengikut urutantentang bahan yang didengar daripada pita rakamanREFLEKSI
  • 39. Kemahiran Mendengar dan Bertutur Tahun 4 SK36STRATEGI PENGAJARAN DAN PEMBELAJARANAKTIVITI PENGISIAN KURIKULUM CATATANLihat dan ceritakan1. Murid melihat gambar yangditunjukkan dengan teliti.2. Murid menceritakan suasana dalamgambar.- rumah dan bangunan telahditenggelami air- penduduk berpindah ke tempatyang lebih selamat- murid menyatakan langkah-langkah menjaga keselamatanjika berlaku banjir- murid menyatakan kesan banjir.. kerugian.. terpaksa meminjam jika tiadasimpananIlmu : KajianTempatanNilai : Berhati-hatiIlmu : Celik KewanganKB : MenjanaIideaTKP : InterpersonalLampiran 1BBB :Kad GambarMendengar dan menyebut pesanan1. Murid dibahagikan kepada 4kumpulan.2. Guru memperdengarkan rakamanpetikan berita tentang banjir.3. Setiap ahli dalam kumpulandikehendaki mencatat pesananyang didengar melalui rakamantersebut.4. Setiap kumpulan akan berbincangtentang pesanan yang telah dicatat.5. Ketua kumpulan akanmenyampaikan pesanan yangdidengar kepada rakan sekelas.Nilai : PatuhEMK : TMKBCB : mendengardengan teliti,mencatat notaLampiran 2BBB :RadioN
  • 40. Kemahiran Mendengar dan Bertutur Tahun 4 SK37AKTIVITI PENGISIAN KURIKULUM CATATAN6. Guru dan murid lain memberirespons terhadap hasilpembentangan.Bermain permainan bahasa “TelefonKarat”1. Murid dibahagikan kepada 4kumpulan.2. Ketua setiap kumpulan memilih kadpesanan dan membaca secarasenyap.3. Ketua kumpulan menyampaikanpesanan kepada salah seorang ahlikumpulan.4. Seterusnya murid tersebutmenyampaikan pesanan yangserupa kepada rakan dalamkumpulan sehingga semua ahlimenerima pesanan tersebut.5. Ahli kumpulan yang terakhir akanmelaporkan pesanan itu dihadapan kelas.Nilai : BekerjasamaEMK : KreativitiBCB : MengingatTKP :InterpersonalLampiran 3Penilaian1. Murid menyampaikan pesananyang telah didengar dan ditulispada lembaran kerja dengan jelasmengikut urutan yang betul.Lampiran 4Pemulihan1. Murid menyusun pesanan yangdiberi mengikut urutan yang betulkemudian menyampaikanmaklumat kepada rakan sekelas.KB : MenyusunAturLampiran 5Pengayaan
  • 41. Kemahiran Mendengar dan Bertutur Tahun 4 SK38AKTIVITI PENGISIAN KURIKULUM CATATAN1. Murid diminta menyampaikanpesanan untuk menjagakeselamatan diri berdasarkangambar yang diberi kepada rakansekelas.KB - menjana ideaLampiran 6Kad Gambar
  • 42. Kemahiran Mendengar dan Bertutur Tahun 4 SK39Lampiran 1Lihat dan ceritakan tentang suasana dalam gambar.
  • 43. Kemahiran Mendengar dan Bertutur Tahun 4 SK40Lampiran 2Awas, banjir !Berikut ialah berita terkini tentang banjir…Orang ramai yang tinggal di kawasan rendah dan sering dinaiki air diingatkansupaya sentiasa berjaga-jaga berikutan hujan lebat pada masa ini. Setakat ini,beberapa buah kampung di daerah Batang Pinang telah dinaiki air. Antaranyatermasuklah Kampung Lembah Keramat, Kampung Lembah Beringin danKampung Tebing Rumbia.Penduduk kampung tersebut dinasihati supaya sentiasa berwaspada danmematuhi arahan daripada pihak yang berkuasa. Utamakanlah keselamatandiri dan hargailah nyawa. Berpindahlah segera jika diarahkan berbuat demikiandan simpanlah dokumen-dokumen penting di tempat yang selamat.Kanak-kanak pula dinasihati agar tidak bermain air. Ibu bapa hendaklahsentiasa mengawasi anak-anak kerana ‛malang tidak berbau’.Dengar rakaman berita tentang banjir dengan telitidan sampaikan pesanan mengikut urutan yangbetul.
  • 44. Kemahiran Mendengar dan Bertutur Tahun 4 SK41Lampiran 3KAD PESANANKad Pesanan 1Tutup semua suis peralatan elektrik apabila hujan lebat dan banjir berlaku.Kad Pesanan 2Pastikan dokumen–dokumen penting dibawa bersama-sama sekiranyadiarahkan berpindah.Kad Pesanan 3Patuhi semua arahan pasukan penyelamat.Kad Pesanan 4Pastikan tingkap dan pintu rumah ditutup dan dikunci sebelummeninggalkan rumah.Baca dan fahami situasi berikut. Kemudiansampaikan pesanan kepada rakan.
  • 45. Kemahiran Mendengar dan Bertutur Tahun 4 SK42Lampiran 4PenilaianTulis pesanan yang telah kamu dengar kemudiansampaikan pesanan tersebut kepada rakan kamu4.1.3.Persediaan Menghadapi Banjir2.
  • 46. Kemahiran Mendengar dan Bertutur Tahun 4 SK43Lampiran 5Pemulihan1. ................................................................................................................................................................................................................................................................2. ................................................................................................................................................................................................................................................................3. ................................................................................................................................................................................................................................................................4. ..............................................................................................................................................................................................................................................................Dengar dan susun pesanan yang di beri mengikuturutan yang betul.PERSEDIAAN MENGHADAPI BANJIRPastikan tingkap dan pintu rumah ditutup dan dikunci sebelummeninggalkan rumah.Patuhi semua arahan pasukan penyelamat.Tutup semua suis peralatan elektrik apabila hujan lebat dan banjirberlaku.Pastikan dokumen-dokumen penting dibawa bersama-samasekiranya diarahkan berpindah.
  • 47. Kemahiran Mendengar dan Bertutur Tahun 4 SK44Lampiran 6PengayaanTulis pesanan untuk menjaga keselamatan diriberdasarkan gambar dan sampaikan pesanantersebut kepada rakan sekelas.
  • 48. Kemahiran Mendengar dan Bertutur Tahun 4 SK45TEMA KEMASYARAKATANTAJUK Budi Bahasa Amalan KitaMASASTANDARDPEMBELAJARAN1.4.2Berbual tentang sesuatu perkara menggunakan kata gelaranyang sesuai dalam situasi tidak formal secara bertatasusila.OBJEKTIFPada akhir pengajaran, murid dapat:i. berbual tentang amalan berbudi bahasa menggunakan kata gelaranyang sesuai dalam situasi tidak formal secara bertatasusila.PENGISIANKURIKULUMIlmu : Pendidikan Moral / SivikNilai : Berbudi bahasa, Hormat-menghormati, Berjimat cermatEMK : TMKSimpanan dan PelaburanKreativiti dan InovasiKB : Menghubung Kait, Menjana IdeaKMD : Membuat RamalanTKP : Verbal LinguistikSISTEM BAHASATatabahasa: Kata gelaranSebutan dan intonasiBAHAN BANTUBELAJARPetikan, kad gambar, video, lembaran kerja.PENILAIANPENGAJARANDANPEMBELAJARANMurid dapat menyatakan kata gelaran yang sesuai berdasarkangambar yang diberikan.REFLEKSI
  • 49. Kemahiran Mendengar dan Bertutur Tahun 4 SK46STRATEGI PENGAJARAN DAN PEMBELAJARANAKTIVITI PENGISIAN KURIKULUM CATATANBersoal jawab1. Murid menontontayangan video/ melihatgambar yang dipaparkan.2. Murid diminta mencatatgelaran yang didengardan ditonton daripadawatak melalui tayanganvideo tersebut.3. Guru bersoal jawabberdasarkan video yangditonton atau gambaryang dilihat.Ilmu : PendidikanMoralNilai : MenghormatiEMK : TMKKP : VerbalLinguistikLampiran 1Slaid Video(Guru juga bolehmenggunakan bahanberbentuk gambar atauposter)Berlakon1. Murid dibahagikankepada beberapakumpulan.2. Setiap kumpulan dimintaberbincang untukmelakonkan semulawatak berdasarkan videoyang ditonton pada awalpembelajaran.3. Setiap kumpulan dimintaberlakon berdasarkanvideo yang ditontonmenggunakan katagelaran yang sesuai dihadapan kelas mengikutkreativiti masing-masing.Nilai: BekerjasamaEMK:Kreativiti dan inovasiKB : MenghubungKaitLampiran 1N
  • 50. Kemahiran Mendengar dan Bertutur Tahun 4 SK47AKTIVITI PENGISIAN KURIKULUM CATATANPerbincangan1. Murid dibahagikan kepadabeberapa kumpulan.2. Setiap kumpulan dimintaberbincang untukmelakonkan watak-watakberdasarkan kad situasisecara main peranan.3. Setiap murid dalamkumpulan diminta berbualmenggunakan katagelaran yang sesuaimengikut watak yangdiberi.Dialog contoh :Puan Yati : Encik,bagaimanakah cara untukmembuka akaun untukanak saya sebagaipersediaan pendidikannyapada masa hadapan?a. Encik Linggam : Puanperlu mengisi borangyang lengkap tentangbutir diri anak puan.Nilai: BekerjasamaBerjimat-cermatElemen :Simpanan dan PelaburanEMK : Celik KewanganKB : MenjanaIdeaKMD : MembuatRamalanLampiran 2Kad SituasiPenilaian1. Murid diminta berbualberdasarkan situasi yangterdapat dalam gambarmenggunakan kata gelaranyang sesuai.Nilai: Kerjasama TKP : VerbalLinguistikLampiran 3Kad GambarPemulihan1. Murid melakonkan watakberpandukan petikan dialogyang disediakan.Lampiran 4
  • 51. Kemahiran Mendengar dan Bertutur Tahun 4 SK48AKTIVITI PENGISIAN KURIKULUM CATATANPengayaan1. Murid berbual secaraberpasanganberdasarkan gambardengan menggunakankata gelaran yangsesuai secarabertatasusila.2. Murid membina dialogmenggunakan katagelaran yang diberi.TKP : VerbalLinguistikLampiran 5Lampiran 6
  • 52. Kemahiran Mendengar dan Bertutur Tahun 4 SK49Lampiran 1Tayangan Video Upin dan IpinPada Zaman Dahuluhttp://www.youtube.com/watchSenaraikan watak yang terdapat dalam video yangditayangkan.
  • 53. Kemahiran Mendengar dan Bertutur Tahun 4 SK50Lampiran 2Kad SituasiSITUASI 1Puan Yati pergi ke bank untuk membuka buku akaun untuk anaknya Aminsebagai persedian pendidikan pada masa hadapan. Mereka berurusan denganEncik Linggam.Arahan:Lakonkan watak Amin, Puan Yati dan Encik Linggam dengan menggunakangelaran yang sesuai.Gelaran: Amin (adik)Juruwang (Encik Linggam)Ibu Amin (Puan Yati)SITUASI 2Rosni, Ah Chin dan Ravi pergi ke rumah Haji Saleh untuk menjemputnyake Mesyuarat Persatuan Ibu Bapa dan Guru di sekolah mereka. Merekaberjumpa Haji Saleh.Arahan:Lakonkan watak Rosni, Ah Chin, Ravi, Haji Salleh. Gunakan gelaran yangsesuai.Gelaran: Rosni dan Ah Chin (saudari)Ravi ( saudara )Haji Saleh (Tuan Haji)Lakonkan watak berpandukan situasi yang diberidengan menggunakan kata gelaran yang sesuai.
  • 54. Kemahiran Mendengar dan Bertutur Tahun 4 SK51SITUASI 3Encik Zaki dan Encik Zamri ahli jawatankuasa kampung untuk ProgramGotong-royong. Mereka diminta berbincang dengan wakil rakyat tentang programtersebut.Arahan:Lakonkan watak Encik Zaki, Encik Zamri dan YB Datuk Haji Kamal denganmenggunakan gelaran yang sesuai.Gelaran: Encik Zaki, Encik Zamri, Yang Berhormat Datuk Haji KamalSITUASI 4Cikgu Ani ingin berjumpa dengan Guru Besar Sekolah Kebangsaan Sri Medanuntuk berbincang tentang Program Amalan Berbudi Bahasa.Arahan:Lakonkan watak Cikgu Ani dan guru besar dengan menggunakan gelaran yangsesuai.Gelaran: Guru Besar ( Tuan Guru Besar )Cikgu Ani ( Cik Ani )
  • 55. Kemahiran Mendengar dan Bertutur Tahun 4 SK52Lampiran 3PenilaianBina dialog dan berbual berdasarkan situasidalam gambar dengan menggunakan kata gelaranyang sesuai.
  • 56. Kemahiran Mendengar dan Bertutur Tahun 4 SK53Lampiran 4PemulihanEncik Hairi : Selamat pagi, puan.Puan Julia : Selamat pagi, encik. Apa yang boleh saya bantu?Encik Hairi : Boleh saya berjumpa dengan Tuan Guru Besar?Puan Julia : Boleh, silakan encik.(Puan Julia mengiringi Encik Hairi ke bilik Guru Besar)Encik Hairi : Selamat pagi, Tuan Haji. Saya Hairi ingin mendaftar anak saya disekolah ini.Guru Besar : Selamat pagi, Encik Hairi. Sila duduk. Encik, tolong isi borang ini danserahkan kepada Puan Julia.Encik Hairi : Terima kasih, Tuan Haji.Guru Besar : Sama-sama.Lakonkan dialog di bawah.
  • 57. Kemahiran Mendengar dan Bertutur Tahun 4 SK54Lampiran 5PengayaanBina dialog berdasarkan kad gambar.Kemudian, lakonkan dialog menggunakankata gelaran yang sesuai.
  • 58. Kemahiran Mendengar dan Bertutur Tahun 4 SK55Lampiran 6Pengayaan1. Yang Berhormat________________________________________________________________________________________________________________________________2. Puan Sri________________________________________________________________________________________________________________________________3. Tuan Haji________________________________________________________________________________________________________________________________4. Encik______________________________________________________________________________________________________________________________________Bina dialog menggunakan kata gelaranyang diberi.
  • 59. Kemahiran MembacaTahun 456Standard Kandungan Kemahiran Membaca menentukan keupayaan murid supayaberkebolehan membaca dengan sebutan, intonasi, jeda, dan kelancaran yang betul. Penekananperlu diberikan pada aspek pemahaman dan penaakulan pelbagai bahan ilmu dan bahansastera secara kritis dengan menggunakan pelbagai teknik bacaan. Di samping itu, muridberupaya menghayati teks yang dibaca. Dalam strategi pengajaran dan pembelajarankemahiran membaca, guru perlu menetapkan objektif yang perlu dicapai oleh murid denganmerujuk Standard Kandungan dan Standard Pembelajaran Kemahiran Membaca.Standard Kandungan Kemahiran MembacaMurid patut mengetahui dan boleh:2.1 Asas membaca dengan sebutan yang betul2.2 Membaca dan memahami perkataan, frasa dan ayat daripada pelbagai sumber dengansebutan yang betul.2.3 Membaca kuat pelbagai bahan bacaan dengan lancar, sebutan yang jelas dan intonasiyang betul.2.4 Membaca dan memahami maklumat yang tersurat dan tersirat daripada pelbagaibahan untuk memberi respons dengan betul.2.5 Membaca, memahami dan menaakul untuk memindahkan maklumat yang terdapatdalam pelbagai bahan dengan betul.2.6 Membaca pelbagai bahan sastera dan bukan sastera yang sesuai bagi memupukminat membaca.Standard Pembelajaran Kemahiran Membaca2.2.3 Membaca dan memahami ayat yang mengandungi perkataan berimbuhan apitandaripada pelbagai sumber dengan sebutan yang betul.2.3.1 Membaca pelbagai bahan yang mengandungi pelbagai jenis ayat secara mekanisdengan lancar, sebutan yang jelas dan intonasi yang betul.2.0 STANDARD KANDUNGAN DANSTANDARD PEMBELAJARAN KEMAHIRANMEMBACA
  • 60. Kemahiran MembacaTahun 4572.3.2 Membaca pelbagai bahan yang mengandungi ayat tunggal dan ayat majmuk berbilangsubjek secara mekanis dengan lancar, sebutan yang jelas dan intonasi yang betul.2.4.1 Membaca dan memahami maklumat untuk mengenal pasti idea utama dan ideasampingan dalam pelbagai bahan bagi membuat ramalan dengan tepat.2.4.2 Membaca dan memahami maklumat daripada bahan untuk menjana idea dengan betul.2.4.3 Membaca dan memahami maklumat yang tersurat dan tersirat dengan tepat daripadapelbagai bahan untuk membuat penilaian dengan betul.2.5.1 Membaca dan memahami maklumat yang tersurat dan tersirat daripada bahan prosadengan betul.2.5.2 Membaca, memahami dan menaakul maklumat yang tersurat dan tersirat daripadabahan prosa dengan betul.2.5.3 Membaca, memahami dan menaakul bahan prosa untuk memindahkan maklumatkepada bentuk puisi dengan betul.2.6.1 Membaca dan memahami pelbagai bahan sastera yang sesuai untuk meningkatkandaya berfikir secara kreatif.2.6.2 Membaca dan memahami pelbagai bahan bukan sastera untuk mengenal pasti nilaimurni.
  • 61. Kemahiran MembacaTahun 4582.0 STRATEGI PENGAJARAN DANPEMBELAJARAN KEMAHIRANMEMBACASemasa menyediakan strategipengajaran dan pembelajaran bagikemahiran membaca, guru perlumemberi pertimbangan aktiviti yangsesuai sebelum, semasa dan selepaskemahiran membaca yang diajar.Pengajaran dan pembelajarankemahiran ini boleh dilaksanakanmelalui pelbagai aktiviti secaraterancang bagi mencapai objektif yangtelah ditentukan. Guru bolehmerancang strategi pengajaran danpembelajaran dengan pelbagai caraseperti dalam contoh rancanganmengajar yang disediakan ini.
  • 62. Kemahiran MembacaTahun 459TEMA KESIHATANTAJUK Demam Denggi Wabak MembunuhMASASTANDARDPEMBELAJARAN 2.4.3Membaca dan memahami maklumat yang tersurat dan tersiratdengan tepat daripada pelbagai bahan untuk membuatpenilaian dengan betul.OBJEKTIFPada akhir pengajaran murid dapat:i. menyatakan maklumat yang tersurat dengan tepat daripada teksyang dibaca.ii. menulis maklumat yang tersurat dan tersirat dengan tepat denganmengisi borang grafik daripada petikan teks yang disediakan.PENGISIANKURIKULUMIlmu : Sains, Pendidikan Kesihatan, Celik KewanganNilai : KebersihanEMK : Kreativiti dan InovasiKB : Menyusun Atur,BCB : Mencatat Nota, Bacaan IntensifTKP : Verbal LinguistikSISTEM BAHASASebutan dan intonasiKosa Kata: Metamorfosis, pupa, sifon, larvaBAHAN BANTUBELAJARLampiran petikan, lembaran kerjaPENILAIANPENGAJARANDANPEMBELAJARANMurid dapat menyatakan maklumat dengan tepat daripada teks yangdibaca.REFLEKSI
  • 63. Kemahiran MembacaTahun 460STRATEGI PENGAJARAN DAN PEMBELAJARANAKTIVITI PENGISIAN KURIKULUM CATATANMembaca petikan1. Murid membaca petikan secarasenyap.2. Murid membaca teks secaramekanis dengan sebutan danintonasi yang betul secaraindividu, berkumpulan dan kelas.3. Guru dan murid berbincangtentang petikan yang dibaca.- punca demam denggi- tanda-tanda deman denggi- langkah pencegahan- kos rawatanIlmu: Sains danPendidikanKesihatanNilai: Cermat, KerjasamaIlmu: Celik KewanganBCB - BacaanIntensifTKP - VerbalLinguistikLampiran 1Membaca dan mencatat maklumat1. Dalam kumpulan muridmencatat maklumat denganbetul berdasarkan petikan.2. Murid mencatat hasilperbincangan pada lembarankerja (lakaran grafik) yangdisediakan.Nilai : Bekerjasama Lampiran 2Penilaian1. Murid membaca danmenyatakan maklumatberdasarkan gambar rajah yangdiberi.2. Murid menyusun pernyataanEMK :Kreativiti dan InovasiNilai : Kerjasama, BeraniKB : Menyusun AturBCB : MencatatLampiran 3
  • 64. Kemahiran MembacaTahun 461AKTIVITI PENGISIAN KURIKULUM CATATANtentang kitaran hidup nyamukmengikut urutan.Pemulihan1. Murid melengkapkan ayatdengan perkataan yang betulberdasarkan petikan.Lampiran 4Pengayaan1. Murid menjawab soalanpemahaman yang diberi.Nilai : Teliti Lampiran 5
  • 65. Kemahiran MembacaTahun 462Lampiran 1Baca dan fahami teks di bawah.Demam denggi bermula dengan demammengejut, sakit kepala teruk, sakit dibelakang bebola mata, sakit sendi dan ototserta gatal-gatal. Ciri-ciri keradangandemam denggi ialah bintik-bintik merahterang, dan biasanya muncul pada anggotabahagian bawah.Amalan pencegahan boleh dilakukandengan menjaga kebersihansekeliling rumah sama ada di dalamdan di luar rumah bagimenghindarkan pembiakan nyamuk.Cara untuk menghalang pembiakannyamuk adalah dengan,menggunakan penyembur racunserangga, memasukkan ubatpembunuh jentik-jentik ke dalambekas simpanan air, menutup bekassimpanan air untuk mencegahnyamuk daripada bertelur, sentiasamenukar air di dalam bekassimpanan air, jambangan bunga dankolah mandi setiap minggu sertagotong-royong membersihkankawasan persekitaran.Demam Denggi merupakan sejenispenyakit yang disebabkan oleh jangkitanvirus denggi yang disebar oleh nyamukAedes betina. Cara penyebarannya adalahmelalui gigitan nyamuk aedes. Terdapatdua jenis denggi yang paling berat iaituDemam Hemoragik Denggi dan SindromKejutan Denggi.Demam denggi merupakan penyakit yangsangat berbahaya dan mengancamkesejahteraan hidup serta masyarakatsetempat. Pihak berkuasa perlumelaksanakan penguatkuasaan berterusanyang lebih berkesan agar dapatmenghapuskan kawasan pembiakannyamuk. Sekiranya perkara inidilaksanakan secara berterusan sudahpasti masalah denggi dalam kalanganmasyarakat kita dapat dikawal dandikurangkan. Ingatlah “DenggiMembunuh”.
  • 66. Kemahiran MembacaTahun 463Lampiran 2Jenis-jenis DemamDenggiTanda-tanda DemamDenggi---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------_____________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________Langkah-langkah PencegahanDenggiTuliskan maklumat penting padalakaran grafik yang disediakan.
  • 67. Kemahiran MembacaTahun 464Lampiran 3PenilaianKitaran HidupNyamukTeliti gambar rajah kitaran hidup nyamuk.
  • 68. Kemahiran MembacaTahun 465Lampiran 3PenilaianNyamuk dewasa keluar daripada pupa apabila kulit terbuka selepas beberapahari. Nyamuk dewasa hanya boleh hidup beberapa minggu sahaja.Nyamuk - Nyamuk mengalami metamorfosis lengkap. Nyamuk mengalamiempat peringkat perkembangan yang jelas. Empat peringkat itu ialah telur, larva,pupa dan nyamuk dewasa. Kitar hidup lengkap nyamuk mengambil masasebulan.Larva - Dalam masa seminggu, telur itu akan menetas dan menghasilkan larvaatau dipanggil jentik-jentik. Larva bernafas melalui tiub yang terkeluar padapermukaan air. Larva memakan bahagian kecil bahan organik yang terapungdan juga makan sesama sendiri. Seterusnya larva akan bertukar menjadi pupa.Pupa - Pupa tinggal berhampiran dengan permukaan air, bernafas melalui duatiub berbentuk seperti tanduk yang dipanggil sifon. Sifon terletak pada bahagianbelakang pupa. Pupa tidak makan.Telur - Selepas menghisap darah, nyamuk betina bertelur sekelompok iaitukelompok telur berbentuk rakit. Telur yang mengandungi 40 hingga 400 telurhalus yang berwarna putih terapung pada permukaan air bertakung atau air yangmengalir.Susun dan nomborkan pernyataan berikutmengikut urutan kitaran hidup nyamuk.
  • 69. Kemahiran MembacaTahun 466Lampiran 4Pemulihan1. Demam denggi disebabkan oleh nyamuk _________________________.2. Cara penyebarannya ialah melalui ____________ gigitan nyamuk aedes.3. Salah satu daripada tanda kita dijangkiti deman denggi ialah ______________________________________________.4. Kita boleh mencegah pembiakan nyamuk aedes dengan _________________kawasan rumah.5. Sentiasa _______________________________ di dalam bekas simpanan airsupaya nyamuk tidakmembiak.Isi tempat kosong di bawah denganperkataan yang sesuai berdasarkan teks.
  • 70. Kemahiran MembacaTahun 467Lampiran 5PengayaanBaca dan jawab soalan-soalanpemahaman di bawah ini.1. Apakah yang dimaksudkan dengan istilah metamorfosis?__________________________________________________________________________________________________________________________2. Berapa peringkatkah kitaran hidup nyamuk?3. Berapakah anggaran seekor nyamuk betina bertelur?4. Apakah nama pada peringkat kedua seekor nyamuk sebelummenjadi pupa?5. Nyatakan tentang proses kitaran hidup seekor nyamuk mengikuturutan yang betul.________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________
  • 71. Kemahiran MembacaTahun 468OBJEKTIFPada akhir pengajaran murid dapat:i. membaca dialog secara mekanis dengan lancar, sebutan yangjelas dan intonasi yang betul.ii. membina ayat yang gramatis menggunakan perkataan yangdiberi secara lisan.PENGISIANKURIKULUMIlmu : Pendidikan Keselamatan Jalan Raya,Pengurusan wang, Celik KewanganNilai : Patuh, Bekerjasama, BerhemahEMK : TMKKB : Menjana IdeaTKP : Verbal Linguistik, InterpersonalBCB : Bacaan MekanisSISTEM BAHASASebutan dan intonasiKosa Kata: Mengancam, kecuaian, memotog, persimpanganBAHAN BANTUBELAJARPetikan dialog, lembaran kerja, slaid ‘power point’PENILAIANPENGAJARANDANPEMBELAJARANMurid dapat membaca dialog dengan lancar, sebutan yang jelas danintonasi yang betul.REFLEKSITEMA KESELAMATANTAJUK Sikap PemanduMASASTANDARDPEMBELAJARAN2.3.1Membaca pelbagai bahan yang mengandungi pelbagai jenisayat secara mekanis dengan lancar, sebutan yang jelas danintonasi yang betul.
  • 72. Kemahiran MembacaTahun 469STRATEGI PENGAJARAN DAN PEMBELAJARANAKTIVITI PENGISIAN KURIKULUM CATATANMembaca1. Guru memaparkan slaid tentangdialog.2. Murid membaca senyap dialogyang dipaparkan.3. Murid membaca dialog secarakelas.4. Guru dan murid berbual tentangpetikan :- sikap pemandu- kos rawatan- kos membaiki kenderaanIlmu : PKJREMK : Celik KewanganNilai : Patuh, BerhemahSlaid dialogKB : Menjana IdeaBCB - BacaanMekanisMembaca dialog1. Murid membaca dialog dengansebutan dan intonasi yang betul.2. Guru membimbing murid dariaspek sebutan dan intonasi.Nilai : Bekerjasama TKP : VerbalLinguistik: IinterpersonalLampiran 1Mencari makna perkataan1. Murid mencari makna perkataanyang dihitamkan dalam dialog.2. Murid membina ayatmenggunakan perkataantersebut secara lisan.KB : MenganalisisLampiran 1
  • 73. Kemahiran MembacaTahun 470AKTIVITI PENGISIAN KURIKULUM CATATANPenilaian1. Murid membaca petikan dialogbersama-sama rakan dengansebutan yang jelas dan intonasiyang betul.Nilai : Bekerjasama TKP : VerbalLinguistikLampiran 2Pemulihan1. Murid dibimbing membacapelbagai jenis ayat daripadapetikan dialog dengan sebutanyang jelas dan intonasi yangbetul.TKP : InterpersonalLampiran 3Pengayaan1. Murid membaca danmengasingkan pernyataan yangdiberi.Lampiran 4
  • 74. Kemahiran MembacaTahun 471Lampiran 1Sikap PemanduAmir : Eh, Hakim, lihat tu! Berani sungguh pemuda itu. Dia menunggangmotosikal dengan laju dan memotong bas di hadapannya.Hakim : Ya, betul! Berani sungguh dia.Adli : Ini bukan soal berani atau tidak , Amir. Ini soal keselamatan .Perbuatan pemuda itu boleh membahayakan dirinya danmengancam nyawa pengguna jalan raya yang lain.Hakim : Betul kata awak, Adli. Sikap suka menunjuk-nunjuk segelintirpengguna jalan raya inilah yang mengakibatkan kemalangan jalanraya. Setiap hari, berita tentang kemalangan dilaporkan dalamtelevisyen dan surat khabar.Adli : Jalan raya bukanlah tempat untuk berlumba. Kita sepatutnya bersikapberhati- hati semasa di jalan raya supaya tidak ditimpa kemalangan.Amir : Ya, Hakim. Kemalangan jalan raya berlaku disebabkan oleh beberapafaktor. Antaranya, kecuaian pengguna jalan raya itu sendiri.Hakim : Ya, selain itu, ada juga penunggang motosikal yang menjadikan jalanraya sebagai tempat berlumba.Amir : Sikap mereka ini akan menyusahkan diri sendiri, ibu bapa danpengguna jalan raya yang lain.Baca dan fahami petikan dialog di bawah.
  • 75. Kemahiran MembacaTahun 472Lampiran 2PenilaianBaca dialog di bawah dengan sebutan yangjelas dan intonasi yang betul.Muthu : Kamu hendak tahu, Ah Meng dan Kamil? Semalam, saya melihatsebuah kereta terbalik di persimpangan jalan masuk ke tamanperumahan kita.Kamil : Oh, ya! Bagaimanakah keadaan pemandunya?Muthu : Pemandu kereta itu cedera parah. Dia dihantar ke hospital besar.Ah Meng : Itulah akibatnya jika cuai ketika memandu. Sepatutnya patuhilahundang-undang keselamatan jalan raya.Muthu : Betul tu Ah Meng. Selain itu, keadaan kenderaan seperti tidakberlampu dan sisitem brek yang rosak merupakan salah satupenyumbang utama kemalangan di jalan raya juga. Tetapi padapendapat awaklah, apakah punca utama berlakunya kemalanganjalan raya?Ah Meng : Kemalangan jalan raya yang kerap berlaku sejak akhir-akhir iniberpunca daripada sikap pemandu yang suka memandu melebihihad laju yang ditetapkan.Muthu : Ya, saya setuju dengan pendapat awak. Pemandu haruslahberhati-hati di jalan raya dan memandu mengikut had laju yangditetapkan. Bak kata pepatah, janganlah sudah terhantuk barutengadah kerana apabila sesuatu kecelakaan sudah berlaku, tiadaguna mengesalinya lagi kerana nasi sudah.Kamil : Awak sebut perkataan bubur, saya terus berasa lapar. Mari kitabalik.Ah Meng : Ayuh, berhati-hati menunggang basikal tu.Jumpa lagi esok disekolah.
  • 76. Kemahiran MembacaTahun 473PemulihanAsingkan pernyataan yang diberi di bawahMalek, kenapa kamuberjalan kaki kesekolah hari ini?Ah Tan, basikal sayarosak. Breknya tidakberfungsi.Oh, ya ! Saya jugatidak berbasikalhari ini keranatayar basikal sayapula botak.Awak telahmelakukantindakan yangbijak. Kita tidaksepatutnyameungggangbasikal yangbolehmendatangkanbahaya kepadakita.Denganberjalan kakijuga kita dapatmenyihatkanb dMarilaj kita kesekolah. Nantilambat pula kitatiba.
  • 77. Kemahiran MembacaTahun 474Lampiran 4PengayaanAhmad selalu berhati-hatiketika memandu di jalanraya.Ahmad sering memandu denganlaju di jalan raya.Ahmad berhenti ketikalampu isyarat berwarnamerah.Ahmad menggunakan telefonbimbit semasa memandu kereta.Ahmad selalu memotongkenderaan lain semasamemandu di jalan raya.Ahmad sentiasa memastikanlampu isyarat pada keretanyaberfungsi dengan baik.Asingkan pernyataan yang diberi di bawahke dalam petak yang sesuai.
  • 78. Kemahiran MembacaTahun 475SIKAP BERHEMAH SIKAP TIDAK BERHEMAH...
  • 79. Kemahiran MembacaTahun 476TEMA KEMASYARAKATANTAJUK Hidup BerjiranMASASTANDARPEMBELAJARAN2.2.3Membaca dan memahami ayat yang mengandungiperkataan berimbuhan apitan daripada pelbagai sumberdengan sebutan yang betul.OBJEKTIFPada akhir pengajaran, murid dapat:i. membaca dan menyebut perkataan berimbuhan apitan dalamayat dengan sebutan yang betul.ii. membina ayat dengan perkataan berimbuhan apitan denganbetul.PENGISIANKURIKULUMElemen : Pendidikan Sivik, Celik KewanganNilai : Bekerjasama, PrihatinEMK : TMKTKP : Verbal Linguistik, KinestatikKB : Menjana Idea, MengecamBCB : Bacaan IntensifKontekstual : MengalamiSISTEM BAHASATatabahasa: Imbuhan ApitanSebutan dan IntonasiBAHAN BANTUBELAJARLampiran, radio, lembaran kerjaPENILAIANPENGAJARAN DANPEMBELAJARANMurid dapat membaca dan menyebut perkataan berimbuhan apitandalam ayat dengan sebutan yang betul.REFLEKSI
  • 80. Kemahiran MembacaTahun 477STRATEGI PENGAJARAN DAN PEMBELAJARANAKTIVITI PENGISIAN KURIKULUM CATATANBermain permainan “Susun Suai”1. Guru mengedarkan kotak yangberisi huruf.2. Murid menyusun semua hurufyang diambil membentukperkataan “Hidup Berjiran”.3. Murid membaca frasa yang telahdibina.4. Guru mengaitkan frasa dengantajuk.Nilai : Bekerjasama Bahan:Kad hurufTKP : VerbalLinguistikKB : Menjana IdeaKontekstual: MengalamiMembaca mekanis1. Murid membaca dengan sebutanyang betul petikan yang secaramekanis serta dibimbing olehguru.2. Murid membaca teks secarasenyap dengan menggunakanteknik bacaan mentalis.3. Murid dibimbing untuk mengenalpasti dan menggarisi perkataanberimbuhan apitan dalam petikan.4. Murid membaca perkataanberimbuhan apitan dengansebutan yang betul.Ilmu : Pendidikan Sivik BCB : Bacaan IntensifKB : MengecamLampiran 1Bermain permainan “ Kotak
  • 81. Kemahiran MembacaTahun 478AKTIVITI PENGISIAN KURIKULUM CATATANBeracun”1. Guru menyediakan sebuah kotakyang mengandungi kad katadasar.2. Setiap murid diberi lembarankerja.3. Guru memperdengarkan laguuntuk permainan bahasa. Apabilamuzik dimainkan, Muridmengedarkan kotak tersebut dandiminta memilih kad kata dasardan membaca perkataan yangtertulis pada kad kata dasar itu.4. Murid membina dan menulisperkataan dengan menggunakanimbuhan apitan pada lembarankerja.5. Setelah selesai semua kata dasardikeluarkan daripada kotak itu,guru dan murid menyemakperkataan yang telah dibinamenggunakan kata dasar.6. Murid membaca senarai perkataanyang telah dibina dengan sebutanyang betul.Ilmu : Dunia MuzikNilai : BekerjasamaEMK :Kreativiti dan InovatifTMKTKP : KinestetikLampiran 2Membaca untuk menyemak1. Murid diminta membaca secarakuat ayat-ayat yang mengandungiperkataan berimbuhan apitan.2. Murid menggarisi perkataanberimbuhan apitan.3. Guru dan murid menyemakperkataan yang digarisi.4. Guru dan murid berbincangIlmu : Pendidikan SivikIlmu : Celik KewanganKB : MengecamTKP : VerbalLinguistikLampiran 3
  • 82. Kemahiran MembacaTahun 479AKTIVITI PENGISIAN KURIKULUM CATATANtentang pengurusan wang( membeli keperluan yang pentingdi rumah seperti pemadamkebakaran ) untuk membantusemasa berlaku kebakaran bagimengelakkan kerugian hartabenda dan nyawa.Penilaian1. Murid membina ayat yangmengandungi perkataanbeimbuhan apitan dengan betul.Lampiran 4Pemulihan1. Murid dibimbing membacaperkataan berimbuhan apitandengan betul.BCB – BacaanIntensifLampiran 3Pengayaan1. Murid membaca petikan yangmengandungi pelbagai perkataanberimbuhan apitan.EMK :Kreativiti dan InovatifBCB : BacaanLuncuranLampiran 5
  • 83. Kemahiran MembacaTahun 480Lampiran 1Baca petikan di bawah dan garisi perkataan berimbuhanapitan.Encik Ammar baru berpindah rumah di sebuah taman perumahan. Dia tidaksuka bergaul dengan jiran-jiran baharunya. Selepas pulang dari tempat kerja,Encik Ammar akan menghabiskan masanya di rumah. Dia tidak berminat untukberkenalan atau beramah mesra dengan penduduk di taman perumahan tersebut.Dia beranggapan bergaul dan bercampur dengan jiran-jiran baharu hanyamembazirkan masanya.Pada suatu hari, bahagian dapur rumahnya terbakar. Mujurlah jiran-jirannya cepat bertindak. Mereka cuba memadamkan api yang sedang marak.Apabila Encik Ammar pulang ke rumah, dia mendapati bahagian dapur rumahnyahangus terbakar. Dia berterima kasih kepada jiran-jiran yang telah menolongmemadamkan kebakaran. Encik Ammar menyesal kerana bersikap sombongterhadap jiran-jirannya. Kini, dia sedar betapa pentingnya hidup berjiran.
  • 84. Kemahiran MembacaTahun 481Lampiran 2Perkataan Berimbuhan Kata Dasar Imbuhan ApitanSenaraikan perkataan berimbuhan yang diperolehidaripada permainan kotak beracun.
  • 85. Kemahiran MembacaTahun 482Lampiran 3A. Baca dan garisi perkataan berimbuhan apitan didalam ayat berikut.Jiran tersebut telah menghubungi pihak polis dan pencuri tersebut berjayaditangkap.Pada suatu hari, seorang jiran ternampak rumah Encik Ammar telahdicerobohi oleh pencuri.Encik Ammar tidak suka bergaul dengan jiran-jirannya. Masa lapangnyadipenuhi dengan melayari internet.Semenjak kejadian itu, dia insaf dan mula bergaul dan menyertai aktiviti yangdianjurkan oleh jiran-jiran di kawasan perumahannya.Encik Ammar baru berpindah ke rumah baru di sebuah taman permainanberdekatan dengan tempat kerjanya.Encik Ammar mengucapkan terima kasih kepada jirannya atas pertolongantersebut.
  • 86. Kemahiran MembacaTahun 483Lampiran 4PenilaianBina ayat menggunakan perkataanberimbuhan apitan yang diberi.perumahanmenghabiskanmemadamkanberkenalanmendapatiberanggapanmembazirkan
  • 87. Kemahiran MembacaTahun 484Lampiran 4PemulihanB. Baca perkataan berimbuhan apitan di dalam ayatberikut.Jiran tersebut telah menghubungi pihak polis dan pencuri tersebut berjayaditangkap.Pada suatu hari, seorang jiran ternampak rumah Encik Ammar telahdicerobohi oleh pencuri.Encik Ammar tidak suka bergaul dengan jiran-jirannya. Masa lapangnyadipenuhi dengan melayari internet.Semenjak kejadian itu, dia insaf dan mula bergaul dan menyertai aktiviti yangdianjurkan oleh jiran-jiran di kawasan perumahannya.Encik Ammar baru berpindah ke rumah baru di sebuah taman permainanberdekatan dengan tempat kerjanya.Encik Ammar mengucapkan terima kasih kepada jirannya atas pertolongantersebut.
  • 88. Kemahiran MembacaTahun 485Lampiran 5PengayaanBaca petikan di bawah dengansebutan dan intonasi yang betul.Jiran ialah orang yang tinggal paling hampirdengan tempat kediaman kita. Segala perkarayang berlaku pada diri kita terlebih dahuludiketahui oleh jiran. Oleh itu, jiran merupakanorang yang paling mudah memberikanpertolongan pada saat kita ditimpa bencana.Pertolongan seperti inilah yang amat diperlukanpada masa kecemasan sementara menunggubantuan pihak berwajib atau sanak saudara.Jiran yang berbeza latar belakangpekerjaan, pendidikan,agama dan budaya akanmemberikan manfaat yang besar kepada kita.Hal ini kerana mereka memiliki pengetahuan dankemahiran yang boleh kita kongsi bersama-sama. Di samping itu, jiran yang sepakat danbersatupadu mampu menjamin keselamatansetempat daripada sebarang ancaman sepertikecurian, penyalahgunaan dadah dan budayasamseng.
  • 89. Kemahiran MenulisTahun 486Standard Kandungan Kemahiran Menulis menentukan keupayaan murid menulis perkataan danayat, serta mengeluarkan idea melalui pelbagai jenis penulisan kreatif yang berkaitan denganilmu pengetahuan dan pengalaman peribadi dengan menggunakan ayat yang gramatis, tandabaca dan ejaan yang betul, serta tulisan yang jelas dan kemas. Murid juga digalakkanmenggunakan kreativiti mereka untuk menghasilkan penulisan bahan ilmu dan imaginasi untukmenghasilkan penulisan. Dalam strategi pengajaran dan pembelajaran kemahiran menulis,guru perlu menetapkan objektif yang perlu dicapai oleh murid dengan merujuk StandardKandungan dan Standard Pembelajaran Kemahiran Menulis.Standard Kandungan Kemahiran Menulis3.1 Asas menulis dengan cara yang betul.3.2 Menulis huruf, suku kata, perkataan, frasa dan ayat secara mekanis dengan betul dankemas.3.3 Membina dan menulis perkataan, frasa dan ayat dengan betul.3.4 Menulis imlak dengan tepat.3.5 Mencatat maklumat yang betul tentang sesuatu perkara daripada pelbagai sumber.3.6 Menulis untuk menyampaikan maklumat tentang sesuatu perkara denganmenggunakan bahasa yang santun.3.7 Menghasilkan penulisan kreatif dalam pelbagai genre dengan betul.3.8 Mengedit dan memurnikan hasil penulisan dengan betul.3.9 Menulis ulasan tentang pelbagai bahan sastera dan bukan sastera yang didengar,ditonton atau dibaca dengan betul.Standard Pembelajaran Kemahiran Menulis3.2.6 Menulis ayat dalam perenggan secara mekanis dengan betul dan kemas.3.2.7 Menulis ayat majmuk secara mekanis dalam bentuk tulisan berangkai dengan betuldan kemas.3.0 STANDARD KANDUNGAN DANSTANDARD PEMBELAJARAN KEMAHIRANMENULIS
  • 90. Kemahiran MenulisTahun 4873.3.3 Membina dan menulis jawapan pemahaman berdasarkan soalan yang bertumpu danbercapah dengan betul.3.3.4 Membina kerangka dan menulis pelbagai jenis karangan dengan betul.3.4.1 Menulis imlak perkataan berimbuhan pinjaman dengan ejaan yang tepat.3.4.2 Menulis imlak frasa dan ayat yang ada perkataan berimbuhan pinjaman dengan ejaandan tanda baca yang tepat.3.5.2 Mencatat maklumat yang betul mengikut urutan untuk membuat carta daripadapelbagai sumber.3.6.1 Menulis untuk menyampaikan maklumat yang betul dengan menggunakan idea utamadan idea sampingan serta menegaskan kesantunan berbahasa.3.6.2 Menulis untuk menyampaikan maklumat berbentuk surat, laporan dan berita denganjelas serta menggunakan bahasa yang santun.3.7.1 Menghasilkan rangka pendahuluan, isi dan penutup dalam penulisan kreatif denganbetul.3.7.2 Menghasilkan penulisan kreatif berbentuk imaginatif dan deskriptif dengan betul.3.8.2 Mengedit dan memurnikan hasil penulisan daripada aspek ejaan, tanda baca,penggunaan kata, imbuhan dan struktur ayat.3.9.1 Menulis ulasan tentang bahan bukan sastera yang didengar, ditonton atau dibacadengan jelas dan menggunakan bahasa yang gramatis..
  • 91. Kemahiran MenulisTahun 4883.0 STRATEGI PENGAJARAN DANPEMBELAJARAN KEMAHIRAN MENULISSemasa menyediakan strategipengajaran dan pembelajaran bagikemahiran menulis, guru perlumemberi pertimbangan aktiviti yangsesuai sebelum, semasa dan selepaskemahiran menulis yang diajar.Pengajaran dan pembelajarankemahiran ini boleh dilaksanakanmelalui pelbagai aktiviti secaraterancang bagi mencapai objektif yangtelah ditentukan. Guru bolehmerancang strategi pengajaran danpembelajaran dengan pelbagai caraseperti dalam contoh rancanganmengajar yang disediakan ini.
  • 92. Kemahiran MenulisTahun 489OBJEKTIFPada akhir pengajaran murid dapat :i. menulis imlak 3 daripada 5 ayat yang mengandungi perkataanberimbuhan pinjaman dengan ejaan dan tanda baca yang tepat.PENGISIANKURIKULUMIlmu : Pendidikan Kesihatan, Celik KewanganNilai : Bekerjasama, Peka, JujurEMK : Celik KewanganKB : Menjana Idea, MengecamBCB : Mendengar dengan berkesanSISTEM BAHASATatabahasa : Imbuhan PinjamanKosa kata : Jururawat, paramedik, prarawatanBAHAN BANTUBELAJARLampiran petikan, lembaran kerjaPENILAIANPENGAJARANDANPEMBELAJARANMurid dapat menulis imlak ayat yang mengandungi perkataanberimbuhan pinjaman dengan ejaan dan tanda yang betul.REFLEKSITEMA KESIHATANTAJUK Klinik 1MalaysiaMASASTANDARDPEMBELAJARANMenulis imlak frasa dan ayat yang ada perkataan3.4.2 berimbuhan pinjaman dengan ejaan dan tanda baca yangtepat.
  • 93. Kemahiran MenulisTahun 490STRATEGI PENGAJARAN DAN PEMBELAJARANAKTIVITIPENGISIANKURIKULUMCATATANBacaan mentalis.1. Murid membaca petikan “Klinik1Malaysia”.2. Guru bersoal jawab tentang petikan.3. Guru menerapkan ilmu pengurusankewangan.4. Murid mengimlak frasa yang disebutkanoleh guru;- Insuran Hayat- Insuran kesihatan dan lain-lain frasayang berkaitan dengan pengurusankewangan.5. Murid mengedit frasa yang dimlak olehrakan dengan bimbingan guru.Ilmu : PKNilai : BekerjasamaIlmu : CelikKewanganKB : Menjana IdeaLampiran 1Berbincang1. Guru membimbing murid memahamiperkataan berimbuhan pinjamandaripada aspek ejaan dan maknaberpandukan petikan yang dibaca.2. Murid mengimlak frasa yang adaperkataan berimbuhan pinjaman yangdisebutkan oleh rakan yang diambildaripada petikan yang dibaca.Nilai : Prihatin KB : Mengecam
  • 94. Kemahiran MenulisTahun 491AKTIVITIPENGISIANKURIKULUMCATATANMengimlak1. Murid menulis imlak frasa yangmengandungi kata imbuhan pinjamanyang disebut oleh guru2. Guru membimbing murid menyemakdan membetulkan jawapan mereka.3. Murid bertukar jawapan sesama rakanuntuk menyemak ejaan.Nilai : Jujur Lampiran 2Penilaian1. Murid mengambil imlak ayat yangdisebut oleh guru.BCB : MendengardenganberkesanLampiran 3Pemulihan1. Murid dbimbing mengambil imlakperkataan dan frasa yang dibaca olehguru.Lampiran 4Pengayaan1. Murid menulis imlak ayat yang adaperkataan berimbuhan pinjaman secaraberpasangan berdasarkan satuperenggan petikan yang lain.Lampiran 5
  • 95. Kemahiran MenulisTahun 492Lampiran 1Klinik 1MalaysiaKlinik 1Malaysia merupakan sebuah projek klinik yang telah dilancarkanoleh Perdana Menteri Malaysia, Datuk Seri Najib Tun Razak di rumah pangsaKampung Kerinchi, Kuala Lumpur. Perasmian 50 klinik 1Malaysia di seluruhMalaysia memberi makna besar tanggungjawab kerajaan kepada golonganmarhaen.Pengerusi Lembaga Pemegang Amanah Yayasan 1Malaysia,Dr. Chandra Muzaffar menyatakan rakyat semakin yakin terhadap klinik1Malaysia. Klinik Malaysia akan beroperasi setiap hari bermula dari pukul10.00 pagi hinggga 10.00 malam dengan dikendalikan oleh kumpulanparamedik yang terdiri daripada Penolong Pegawai Perubatan (MA) danjururawat terlatih yang berpandukan tatacara yang tertentu. Kerajaan secaraautomatik membenarkan Penolong Pegawai Perubatan (MA) memberikanprarawatan secara formal dan ubat bagi sakit yang ringan seperti antibiotik.Antara sakit yang dirawat ialah demam, batuk dan menjalanipemeriksaan darah serta tahap kandungan gula. Akta Perubatan 1971membenarkan jururawat dan HA menjalankan prosedur surgeri kecil denganmenggunakaan alat surgeri spesifik.Baca dan garisi frasa dan ayat yang ada katapinjaman dalam petikan di bawah.
  • 96. Kemahiran MenulisTahun 493Lampiran 21. 7.2. 8.3. 9.4. 10.5. 11.6. 12.Imlak frasa yang disebut oleh guru.
  • 97. Kemahiran MenulisTahun 494Lampiran 3PenilaianBacakan ayat di bawah untuk diimlak oleh murid.1. Klinik 1Malaysia dikendalikan oleh kumpulan paramedik.2. Kumpulan paramedik terdiri daripada jururawat terlatih.3. Klinik 1Malaysia dikendalikan berpandukan tatacara tertentu.4. Kerajaan secara automatik membenarkan Penolong Pegawai Perubatan memberikanprarawatan secara formal.5. Akta Perubatan 1971 membenarkan jururawat menjalankan prosedur surgeri kecil.
  • 98. Kemahiran MenulisTahun 495Lampiran 4Pemulihan_______________________________________________________________________________________________________________________________________________________________________________Mengimlak perkataan berimbuhanpinjaman.
  • 99. Kemahiran MenulisTahun 496Lampiran 5PengayaanBaca perenggan di bawah untukdiimlak oleh murid.Ketua Pegawai Eksekutif Gabungan Persatuan PenggunaMalaysia Mohd Yusof Abdul Rahman berpendapat Klinik 1Malaysiaamat wajar bagi tujuan penjagaan kesihatan golongan marhaen yangtinggal di luar bandar. Hal ini selaras dengan konsep Klinik1Malaysia yang diperkenal dan dilaksanakan oleh kerajaan yangbertujuan memastikan perkhidmatan kesihatan yang berkualitidengan mematuhi tatacara yang telah ditetapkan.Perkhidmatan kesihatan ini disediakan oleh paramedik yangbertatasusila dan diberi autonomi merawat penyakit ringan. Klinikini akan dipantau oleh Jabatan Kesihatan bagi memastikanperkhidmatan yang efisien dan bekalan ubat yang mencukupi sertakemudahan infrastruktur yang lengkap. Kes-kes yang di luar bidangperkhidmatan penolong pegawai perubatan akan dirujuk ke klinikkesihatan atau hospital berdekatan.
  • 100. Kemahiran MenulisTahun 497OBJEKTIFPada akhir pengajaran murid dapat:i. menulis sebuah karangan autobiografi dengan sekurang-kurangnya dua perenggan yang lengkap berdasarkan tajukyang diberiPENGISIANKURIKULUMIlmu : PKJR, Celik KewanganNilai : Patuh, Berwaspada, PrihatinEMK : Kreativiti dan InovasiKB : Menjana Idea, Menghubung Kait, Menyusun AturBCB : Mencatat NotaSISTEM BAHASATatabahasa : Tanda bacaKosa kata : Lampu isyarat, fungsi, lancar, bergerak, berwaspadaBAHAN BANTUBELAJARGambar, lembaran kerja, CD PKJRPENILAIANPENGAJARANDANPEMBELAJARANMurid dapat menulis sebuah karangan autobiografi yang lengkapberdasarkan tajuk yang diberi.REFLEKSITEMA KESELAMATANTAJUK Aku Sebatang Lampu IsyaratMASASTANDARDPEMBELAJARAN3.7.2Menghasilkan penulisan kreatif berbentuk imaginatif dandeskriptif dengan betul.
  • 101. Kemahiran MenulisTahun 498STRATEGI PENGAJARAN DAN PEMBELAJARANAKTIVITIPENGISIANKURIKULUMCATATANMencatat maklumat penting1. Murid menonton tayangan videosuasana di jalan rayadanmencatat maklumat yang penting.2. Murid menyatakan maklumat –maklumat yang telah dicatat.3. Murid dan guru berbincangtentang maklumat yang berkaitandengan;- apa yang dilihat- apa yang berlaku- kesan tidak mematuhiperaturanIlmu : PKJRNilai : Berwaspada,PatuhKB : Menjana IdeaCD PKJRMembina peta minda1. Guru dan murid berbincangtentang lampu isyarat jalan raya.- bentuk- fungsi- warna- lokasi2. Murid membina peta mindaberdasarkan maklumat untukmenulis karangan bertajuk ‘AkuSebatang Lampu Isyarat’.Nilai : PrihatinBCB : MencatatNotaLampiran 1Penilaian1. Murid secara individu menulis EMK : Kreativiti dan KB : Menghubung
  • 102. Kemahiran MenulisTahun 499AKTIVITIPENGISIANKURIKULUMCATATANkarangan dengan tulisan yangkemas berdasarkan maklumatdaripada peta minda.Inovasi KaitPemulihan1. Murid menyusun ayat mengikuturutan supaya menjadi karanganyang lengkap.KB : MenyusunAturLampiran 2Pengayaan1. Murid menulis lima ayat tentanggambar yang diberi.KB : Menjana IdeaLampiran 3
  • 103. Kemahiran MenulisTahun 4100Lampiran 1AkuSebatangLampuIsyaratLengkapkan peta minda di bawahberdasarkan tajuk yang diberi.
  • 104. Kemahiran MenulisTahun 4101Lampiran 2PemulihanAku Sebatang Lampu IsyaratAku selalu berada di setiap simpang jalan yang sibuk.Apabila aku berwarna kuning, kenderaan hendaklah bersedia untuk berhenti.Pada badan aku ada tiga warna iaitu kuning, merah dan hijau.Nama aku lampu isyarat.Sebaik sahaja aku berwarna merah, semua kenderaan mesti berhenti.Aku berasa sangat gembira menjalankan tugas aku ini.Tugas aku memastikan kenderaan bergerak dengan lancar.Semua kenderaan akan bergerak jika warna aku bertukar menjadi hijau....................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................Susun ayat di bawah mengikut urutansupaya menjadi ayat yang lengkap.
  • 105. Kemahiran MenulisTahun 4102Lampiran 3PengayaanBina lima ayat berdasarkangambar.
  • 106. Kemahiran MenulisTahun 4103TEMA KEMASYARAKATANTAJUK Cerianya TamankuMASASTANDARDPEMBELAJARAN3.3.3Membina dan menulis jawapan pemahaman berdasarkansoalan yang bertumpu dan bercapah dengan betul.OBJEKTIFPada akhir pengajaran, murid dapat:i. membina dan menulis jawapan berdasarkan soalanpemahaman yang bertumpu dan bercapah.ii. membaca petikan dengan sebutan dan intonasi yang betulPENGISIANKURIKULUMIlmu : Sivik, Celik KewanganNilai : Bekerjasama, Kebersihan, Prihatin, PatuhEMK : TMKKB : Menjana Idea, MengecamBCB : Bacaan MentalisSISTEM BAHASA Kosa kata : Ceria, mengeratkan, silaturahim, dipangkasBAHAN BANTUBELAJARLCD, benda maujud, lembaran kerjaPENILAIANPENGAJARANDANPEMBELAJARANMurid dapat membina dan menulis jawapan berdasarkan soalanpemahaman dengan betul.REFLEKSI
  • 107. Kemahiran MenulisTahun 4104STRATEGI PENGAJARAN DAN PEMBELAJARANAKTIVITIPENGISIANKURIKULUMCATATANMenama dan menulis peralatan danaktiviti1. Murid ditunjukkan alatan menjagakebersihan kawasan kelas sepertipenyapu, pemadam dan bakulsampah.2. Guru dan murid berbincang tentangkegunaan alatan tersebut dankaitannya dengan menjaga kebersihan.3. Guru membimbing murid menamakandan menulis pada papan tulis tentangalatan lain yang sesuai digunakanuntuk menjaga kebersihan kawasanrumah dan taman.4. Guru bersoal jawab dengan muridtentang sumber kewangan untukmenjayakan aktiviti gotong-royong.Ilmu : SivikNilai : KebersihanIlmu :Celik KewanganKB : Menjana IdeaKontekstual :MenghubungKaitMedia:Bahan MaujudMembina dan menulis jawapan1. Murid membaca petikan yangdipaparkanpada skrin dengan sebutan yang jelasdan intonasi yang betul.2. Murid menggarisi isi petikan yangmenjadi jawapan pada paparan skrindengan menggerakkan kursorberpandukan soalan yang diberi.3. Murid membina jawapan untuk soalanyang dikemukakan oleh guruEMK: TMK Lampiran 1
  • 108. Kemahiran MenulisTahun 4105AKTIVITIPENGISIANKURIKULUMCATATANberdasarkan petikan yang dibaca.Membina dan menulis ayat gramatis1. Murid melengkapkan ayat denganfrasa yang betul berpandukan soalanyang diberi.Nilai : Prihatin Lampiran 2Penilaian1. Murid menulis jawapan pemahamanmenggunakan ayat yang gramatisberdasarkan soalan yang diberi.KB : MengecamLampiran 3Pemulihan1. Murid menjawab soalan denganmengisi tempat kosong dalam ayatmenggunakan perkataan yang diberi.Lampiran 4Pengayaan1. Murid menjawab soalan pemahamanberdasarkan teks yang dibaca.BCB :Bacaan MentalisLampiran 5
  • 109. Kemahiran MenulisTahun 4106Lampiran 1Cerianya TamankuPada hujung minggu lepas, penduduk Taman Muhibbah telahmengadakan gotong-royong yang disertai oleh penduduk pelbagai kaum.Mereka mengadakan gotong-royong untuk membersihkan kawasanperumahan mereka. Antara alatan yang digunakan ialah penyapu, parang,kereta sorong, baldi, penyapu lidi, penyapu longkang, pongkes danpencakar.Untuk menjayakan aktiviti gotong-royong tersebut, pendudukkampung telah sepakat untuk mengadakan kutipan derma. Wang yangdiperoleh akan digunakan untuk membeli peralatan yang diperlukan danmengadakan jamuan.Kaum wanita menyediakan makanan dan minuman untuk pendudukkampung yang bergotong-royong. Mereka menyediakan nasi lemak, kuih-muih dan air sirap. Anak-anak pula sibuk membantu ibu dan bapa masing-masing. Ada juga yang menarik dahan-dahan yang dipangkas oleh kaumlelaki.Kini kawasan taman perumahan mereka kelihatan bersih dan ceria.Tidak ada lagi sampah-sarap dan tempat air bertakung yang bolehmembiakkan nyamuk aedes. Gotong-royong itu juga dapat mengeratkansilaturahim penduduk kampung yang selama ini sibuk dengan tugasmasing-masing.Baca dan fahami petikan di bawah.
  • 110. Kemahiran MenulisTahun 4107Lampiran 21. Apakah yang diadakan oleh penduduk Taman Muhibah?Penduduk kampung mengadakan ..................................................................................................................................................................................................................................2. Apakah alat yang mereka gunakan?Mereka menggunakan alatan seperti .............................................................................................................................................................................................................................3. Bagaimanakah mereka memperoleh wang untuk membeli peralatan?Mereka memperoleh wang untuk membeli peralatan ............................................................................................................................................................................................4. Siapakah yang terlibat dalam aktiviti gotong-royong itu?Gotong-royong itu melibatkan....................................................................................................................................................................................................................................5. Bagaimanakah Penduduk Taman Muhibbah boleh mengekalkan keceriaan taman itu?..........................................................................................................................................................................................................................................................................................A. Lengkapkan ayat dengan frasa yang betulberdasarkan petikan ‘Cerianya Tamanku’.
  • 111. Kemahiran MenulisTahun 4108Lampiran 21. Bilakah penduduk Taman Muhibbah mengadakan gotong-royong?........................................................................................................................................................................................................................................................................................2. Apakah alatan yang digunakan dalam gotong-royong?.........................................................................................................................................................................................................................................................................................3. Mengapakah kutipan derma perlu dilakukan?.........................................................................................................................................................................................................................................................................................4. Di manakah nyamuk aedes suka membiak?.........................................................................................................................................................................................................................................................................................5. Mengapakah gotong-royong diadakan pada hujung minggu?........................................................................................................................................................................................................................................................................................6. Apakah yang berlaku jika nyamuk aedes dibiarkan membiak?.......................................................................................................................................................................................................................................................................................Jawab soalan berdasarkan petikan.
  • 112. Kemahiran MenulisTahun 4109Lampiran 4Pemulihan1. Siapakah yang mengadakan gotong-royong?Penduduk Taman Muhibbah telah ............................................ gotong-royongmembersihkan taman perumahan.2. Apakah yang mereka cuci?Mereka ...................................... longkang yang tersumbat.3. Siapakah menaraik dahan-dahan yang dipangkas?Kanak-kanak ....................................... dahan-dahan yang dipangkas.4. Di mana nyamuk aedes bertelur?Nyamuk ........................................ bertelur di dalam air bertakung.5. Bagaimana keadaaan kawasan taman itu?Kawasan taman menjadi bersih dan .................................................... .aedesmengadakan ceriamenarik mencuciIsi tempat kosong denganperkataan yang betul.
  • 113. Kemahiran MenulisTahun 4110Lampiran 5PengayaanBaca dan fahami petikanberikut.Sekolahku BersihPada hari Sabtu yang lepas, sekolah saya telah mengadakan aktivitigotong-royong. Aktiviti ini disertai oleh warga sekolah, ibu bapa dan pendudukkampung. Aktiviti ini bermula pada pukul 8.00 pagi dan berakhir pada pukul 12tengah hari.Antara aktiviti yang dilakukan pada hari tersebut ialah mengecat dindingsekolah, membaiki perabot yang rosak, menanam pokok bunga, membersihkanlongkang, memotong rumput dan sebagainya. Aktiviti ini diadakan bagimenceriakan kawasan sekolah, mengeratkan silaturahim dan menanamkansikap cinta akan sekolah.Semasa gotong-royong ini, semua yang terlibat melakukan kerja masing-masing dengan bersungguh-sungguh. Hasilnya kawasan sekolah kelihatanbersih dan ceria. Guru Besar mengucapkan terima kasih dan berharap aktivitiseumpama ini akan dapat diadakan lagi pada masa hadapan.Sebelum bersurai, semua yang terlibat menikmati jamuan yang telahdisediakan oleh pihak sekolah di kantin.
  • 114. Kemahiran MenulisTahun 41111. Siapakah yang terlibat dalam aktiviti gotong-royong tersebut?.........................................................................................................................................................................................................................................................................................2. Tuliskan aktiviti-aktiviti yang dilakukan oleh mereka?.....................................................................................................................................................................................................................................................................................3. Mengapakah aktiviti gotong-royong diadakan?.......................................................................................................................................................................................................................................................................................4. Apakah hasil daripada gotong-royong tersebut?.........................................................................................................................................................................................................................................................................................Jawab soalan berdasarkanpetikan.
  • 115. Aspek Seni BahasaTahun 4112Standard Kandungan Aspek Seni Bahasa menentukan keupayaan murid mengungkapkankeindahan bahasa, memahami dan menghargai bahasa melalui pelbagai aktiviti seni bahasasecara kreatif. Guru perlu menyediakan aktiviti pengajaran dan pembelajaran ini secara didikhibur supaya dapat menarik minat murid dan membantu murid lebih berketrampilan sertamenghayati kandungan seni bahasa itu. Dalam strategi pengajaran dan pembelajaran senibahasa, guru harus menetapkan objektif yang perlu dicapai oleh murid dengan merujukStandard Kandungan dan Standard Pembelajaran Kemahiran Seni Bahasa yang disediakan.Standard Kandungan Seni BahasaMurid patut mengetahui dan boleh:4.1 Menyebut dan memahami unsur seni dalam lagu melalui nyanyian secara didik hibur.4.2 Mengujarkan bahasa yang indah dan menggunakan bahasa badan secara kreatifsemasa bercerita secara didik hibur.4.3 Mengujarkan bahasa yang indah dan menggunakan bahasa badan dengan kreatifmelalui lakonan secara didik hibur.4.4 Melafazkan dan memahami puisi dengan intonasi yang betul menggunakan bahasayang indah secara didik hibur.Standard Pembelajaran Seni Bahasa4.1.1 Menyebut dan memahami lirik lagu melalui nyanyian dan gerak laku.4.1.2 Memahami dan mengubah suai lirik lagu secara separa terkawal danmempersembahkannya melalui nyanyian secara didik hibur.4.2.1 Mengujarkan ayat yang gramatis dengan sebutan yang betul dan intonasi yang jelasserta susunan idea yang tepat semasa bercerita secara didik hibur.4.2.2 Mengujarkan cerita dengan menggunakan bahasa yang indah untuk menyampaikanidea dengan bahasa badan yang sesuai.4.3.1 Mengujarkan dialog dengan sebutan dan intonasi yang betul dan jelas dan bahasabadan yang sesuai dalam lakonan secara didik hibur.4.0 STANDARD KANDUNGAN DANSTANDARD PEMBELAJARAN ASPEK SENIBAHASA
  • 116. Aspek Seni BahasaTahun 41134.3.2 Mengujarkan dialog yang dihasilkan secara berpandukan untuk menyampaikanpengajaran dengan menggunakan bahasa yang indah serta bahasa badan yang sesuaimelalui lakonan.4.4.1 Mendeklamasi sajak dengan sebutan dan intonasi yang betul dan jelas secara didikhibur serta memahami maksud sajak tersebut.4.4.2 Membina sajak secara terkawal dan mendeklamasikannya dengan sebutan danintonansi yang betul dan jelas secara didik hibur.
  • 117. Aspek Seni BahasaTahun 41144.0 STRATEGI PENGAJARAN DANPEMBELAJARAN ASPEK SENI BAHASASemasa menyediakan strategipengajaran dan pembelajaran SeniBahasa, guru perlu memberipertimbangan aktiviti yang sesuai danmenarik sebelum, semasa dan selepaspengajaran dan pembelajaran senibahasa yang diajar. Pengajaran danpembelajaran kemahiran ini bolehdilaksanakan melalui pelbagai aktivitisecara terancang bagi mencapaiobjektif yang telah ditentukan. Guruboleh merancang strategi pengajarandan pembelajaran dengan pelbagaicara seperti dalam contoh rancanganmengajar yang disediakan ini.
  • 118. Aspek Seni BahasaTahun 4115TEMA KESIHATANTAJUK Hidup Bebas Tanpa DadahMASASTANDARDPEMBELAJARAN4.4.2Membina sajak secara terkawal dan mendeklamasikannyadengan sebutan dan intonansi yang betul dan jelas secaradidik hibur.OBJEKTIFPada akhir pengajaran murid dapat:i. melengkapkan sajak dengan perkataan yang sesuai.ii. mendeklamasi sajak yang dibina dengan sebutan jelas danintonasi yang betul secara didik hibur.PENGISIANKURIKULUMIlmu : Pendidikan Kesihatan, SivikNilai : Kasih Sayang, MenghargaiEMK : Kreativiti dan InovasiBCB : Mendengar dengan berkesanKB : Menjana ideaTKP : Verbal linguistikSISTEM BAHASA Kosa kata : Menghayalkan, hina, sejahtera dan bersuaBAHAN BANTUBELAJARBahan edaranPENILAIANPENGAJARANDANPEMBELAJARANMurid dapat melengkapkan dan mendeklamasikan sajak dengansebutan yang jelas dan intonansi yang betul.REFLEKSI
  • 119. Aspek Seni BahasaTahun 4116STRATEGI PENGAJARAN DAN PEMBELAJARANAKTIVITIPENGISIANKURIKULUMCATATANMendengar1. Murid mendengar rakaman contohdeklamasi sajak.Ilmu : KesihatanEMK : ICTBCB :Mendengardengan berkesanLampiran 1Berbincang1. Murid dibimbing menyatakanmaklumat yang terdapat dalam sajakyang telah mereka dengar.- Mesej yang terkandung dalamsajak tersebut- Nilai yang dimuatkan dalam sajakini.- Kesan penyalahgunaan dadah: kesihatan terjejas: hilang pekerjaan: jenayah meningkatNilai : Kasih SayangIlmu : SivikKB : Menjana IdeaLampiran 2Membina sajak secara terkawal.1. Murid secara kumpulan dibimbingmembina sajak berkenaan anti dadahsecara terkawal iaitu menukarkanbeberapa perkataan dalam sajak yangdiberi dengan perkataan lain yangsesuai.2. Murid dan guru bersoal jawab untukmemahami sajak yang dibina.3. Murid secara individu, berpasangandan kumpulan diminta mendeklamasisajak yang diubah suai denganNilai : Kasih Sayang,MenghargaiEMK : Kreativiti danInovasiTKP – VerbalLinguistikTahun 4N
  • 120. Aspek Seni BahasaTahun 4117AKTIVITIPENGISIANKURIKULUMCATATANsebutan dan intonasi yang betul danjelas secara bergilir-gilir.Penilaian1. Murid melengkapkan sajakberdasarkan tema dadah dengan ayatsendiri.2. Murid mendeklamasikan sajak yangdibina dengan sebutan dan intonasiyang betul secara didik hibur.3. Guru menilai kreativiti dalampemilihan kata yang kreatif dalamkandungan sajak.EMK :Kreativiti danInovasiLampiran 3
  • 121. Aspek Seni BahasaTahun 4118Lampiran 1SAJAK: JAUHI DADAHDadah, engkau najis yang hinaMerosakkan kehidupan manusiaMengkhayalkan kehidupan manusiaManusia akan lupa akan diri merekaLupa akan ayah, ibu dan keluarga.Oleh itu, wahai kawanku semuaJauhilah dadah dari kehidupan kitaKatakan tidak jika bersua dengannyaLaporkan kepada pihak berkuasaKelak nanti hidup akan sejahtera.Dengar dan baca sajak di bawah
  • 122. Aspek Seni BahasaTahun 4119Lampiran 2SAJAK: ANTI DADAHDadah, engkau najis yang hinaMerosakkan kehidupan manusiaMengkhayalkan kehidupan manusiaManusia akan lupa akan diri merekaLupa akan ayah, ibu dan keluarga.Oleh itu wahai kawanku semuaJauhilah dadah dari kehidupan kitaKatakan tidak jika bersua dengannyaLaporkan kepada pihak berkuasaKelak nanti hidup akan sejahtera.Tukarkan perkataan yang digarisidengan perkataan yang sesuai.
  • 123. Aspek Seni BahasaTahun 4120Lampiran 2SAJAK: ANTI DADAHDadah, .....................najis yang ......................................................................... kehidupan manusia................................................ kehidupan manusiaManusia akan ............................ akan diri merekaLupa akan ayah, ibu dan keluarga.Oleh itu wahai ................................... semua.............................dadah dari ...............................kitaKatakan tidak jika ....................................dengannya..........................................kepada pihak berkuasaKelak nanti hidup akan ..............................................Tukarkan perkataan yang digarisidengan perkataan yang sesuai.
  • 124. Aspek Seni BahasaTahun 4121Lampiran 3Penilaian1. engkau __________________________________2. hina __________________________________3. merosakkan __________________________________4. mengkhayalkan __________________________________5. kawanku __________________________________6. jauhi __________________________________7. kehidupan __________________________________8. bersua __________________________________9. sejahtera __________________________________Tukar perkataan yang digarisi dengan perkataan yangsesuai.
  • 125. Aspek Seni BahasaTahun 4122TEMA KESELAMATANTAJUK Tragedi di SungaiMASASTANDARDPEMBELAJARAN4.2.2Mengujarkan cerita dengan menggunakan bahasa yang indahuntuk menyampaikan idea dengan bahasa badan yang sesuai.OBJEKTIFPada akhir pengajaran, murid dapat:i. bercerita menggunakan bahasa yang indah dan ayat yanggramatis serta bahasa badan secara didik hibur.ii. menyatakan nilai murni yang terdapat dalam cerita.PENGISIANKURIKULUMIlmu : Pendidikan Sivik, Celik KewanganNilaI : Patuh, Berwaspada/ Berhati-hatiEMK : Kreativiti dan InovasiBCB : Bacaan MekanisKB : Menjana IdeaSISTEM BAHASASebutan dan IntonasiKosa kata : Seronok, pengawasan, berenangBAHAN BANTUBELAJARPetikan cerita, patung boneka, borang penilaianPENILAIANPENGAJARANDANPEMBELAJARANMurid dapat bercerita menggunakan bahasa yang indah dan ayat yanggramatisREFLEKSI
  • 126. Aspek Seni BahasaTahun 4123STRATEGI PENGAJARAN DAN PEMBELAJARANAKTIVITIPENGISIANKURIKULUMCATATANMembaca dan berbincang1. Murid diberi petikan cerita.2. Murid membaca dan berbincanguntuk memahami dan mengenal pastinilai yang terdapat dalam cerita.3. Murid menyatakan nilai yang terdapatdalam cerita.Nilai : Berwaspada,PatuhEMK : Celik KewanganBCB : BacaanMekanisKB : Menjana ideaLampiran 1Bercerita secara didik hibur1. Guru membimbing murid berceritadengan sebutan, intonasi dan carayang sesuai.2. Beberapa orang murid dipilih secararawak untuk bercerita di hadapankelasLampiran 1Penilaian1. Murid secara bergilir-gilir bercerita dihadapan kelas dengan sebutan,intonasi, bahasa badan dan gayayang betul dengan menggunakanboneka.2. Beberapa orang murid dilantikmenjadi hakim.3. Murid menulis nilai murni yangterdapat dalam cerita.EMK:Kreativiti dan InovasiLampiran 2Tahun 4N
  • 127. Aspek Seni BahasaTahun 4124Lampiran 1Pada suatu hari, Aminah dan adiknya, Hakim berjalan di tepi sebatang sungai.Setelah penat berjalan, mereka berehat sebentar di bawah sebatang pokok. “Eh, sayapenatlah! Mari kita mandi di sungai itu, kakak,” kata Hakim."Jangan Hakim, di situ telah ditulis dilarang mandi. Lagi pun ibu telah berpesansupaya kita jangan mandi di sungai tanpa pengawasan orang dewasa,” kata Aminah."Ah, kakakkan ada. Marilah kakak,” Hakim tidak mendengar nasihat kakaknya laluterjun ke dalam sungai itu.“Kakak, marilah mandi. Seronok mandi di sini,” kata Hakim. Tanpa disedari,Hakim telah berenang jauh dari tepi sungai. Tiba-tiba kedengaran suara Hakimmeminta tolong. “Tolong! Tolong! Tolong!” jerit Hakim. Kelihatan Hakim tenggelamtimbul kelemasan di tengah sungai. Aminah terus menjerit meminta tolong. Seorangpemuda yang kebetulan sedang memancing di situ telah mendengar jeritan Aminah.Tanpa membuang masa, pemuda itu telah terjun ke dalam sungai dan menyelamatkanHakim yang hampir lemas. Hakim terus dibawa ke hospital.Rakan-rakan Hakim yang mendengar tentang peristiwa itu melawatnya dihospital. Aisyah, Siva dan Ai Ling membawa buah tangan untuknya “Hakim, ini adasedikit sumbangan daripada rakan-rakan sekolah kita.” “Terima kasih, Aisyah, Siva danAi Ling. Duit ini akan saya simpan di bank untuk kegunaan saya pada kemudian hari.”Sejurus selepas itu, ibu dan kakak Hakim tiba. “Maafkan saya kerana tidakmendengar nasihat kakak dan ibu,” ujar Hakim ketika dilawati oleh keluarganya dihospital. “Jadikan ini pengajaran kepada kamu. Lain kali, kita hendaklah mendengarnasihat dan menjaga keselamatan diri kita sendiri,” nasihat Aminah kepada adiknya.L i 1Baca dan ceritakan petikan di bawah.
  • 128. Aspek Seni BahasaTahun 4125Lampiran 2AMINAH HAKIMBuat boneka dengan menggunakankertasBoneka Contoh
  • 129. Aspek Seni BahasaTahun 4126Lampiran 3Borang PenilaianNAMA MURID SEBUTAN (A,B,C)GAYAPENCERITAAN(A,B,C)
  • 130. Aspek Seni BahasaTahun 4127TEMA KEMASYARAKATANTAJUK DamaiMASASTANDARDPEMBELAJARAN4.1.1Menyebut dan memahami lirik lagu melalui nyanyian dangerak laku.OBJEKTIFPada akhir pengajaran, murid dapat:i. menyebut lirik lagu “Damai” dengan betul melalui nyanyiansecara didik hibur.ii. menyatakan maksud lirik lagu dan nilai murni yang terdapatdalam lirik lagu yang dinyanyikan.PENGISIANKURIKULUMIlmu : Dunia Muzik, Celik KewanganNilai : Disiplin, Kerjasama, Berjimat-cermatEMK : Kreativiti dan InovasiBCB : Kenestetik, Mendengar dengan BerkesanKMD : Meramal dan AnalisisSISTEM BAHASAKosa Kata : Terjebak, damai, prinsip, tatatertib, berbudi,semarakkanBAHAN BANTUBELAJARVideo, lirik lagu, alatan muzikPENILAIANPENGAJARAN DANPEMBELAJARANMurid dapat menyanyi dan menyebut lirik lagu dengan betul.REFLEKSI
  • 131. Aspek Seni BahasaTahun 4128STRATEGI PENGAJARAN DAN PEMBELAJARANAKTIVITIPENGISIANKURIKULUMCATATANMendengar dan menyebut lirik1. Murid mendengar lagu yangdirakam.2. Murid membaca lirik lagu yangdipaparkan.Ilmu : Dunia MuzikNiali : Berdisiplin,PatuhEMK : TMKBCB : MendengardenganberkesanLampiran 1Menyanyi1. Murid menyanyikan lagu mengikutlirik dan melodi yang didengardengan bimbingan guru.2. Murid menyanyi sambil membuatgerakan.Nilai : BekerjasamaEMK :Kreativiti dan InovasiBCB : KinestatikBerbincang1. Secara kumpulan, murid berbincangtentang nilai murni yang terdapatdalam lirik lagu.2. Wakil kumpulan akan melaporkanhasil perbincangan di hadapankelas.3. Murid berbincang tentang faedahbercucuk tanam dari segi ekonomi.- menambah sumber kewangan- menabungNilai : Berjimat-cermatEMK : Celik KewanganKMD : MenjangkaakibatN
  • 132. Aspek Seni BahasaTahun 4129Lampiran 1DAMAITanam-tanam ubi, tak perlu dibajaOrang berbudi, kita berbahasaNaik kereta api, turun padang tembakKalau tak hati-hati, kita kan terjebak(Chorus)Semarakkan hari iniKita nyanyi ramai-ramaiGoyang badan gerak kakiLaungkan lagu damaiJangan ambil mudah, jangan rasa mudahMenang bukan kekal, kalah jangan kesalMasa masih muda, tenaga pun adaHidup ada prinsip, ikut tatatertibYeah yeah yeah yeah yeahCarik bulu ayam, akan bercantum juaLupakan hal semalam, esok pasti ceria(Ulang Chorus)Mula langkah kanan, senang cari makanHidup berdikari, buat amal baktiSolat jangan lupa, tiang agamaIngat masa depan, pilih kawan-kawanAmalan yang baik, untuk orang cerdikYeah yeah yeah yeah yeah(Ulang perenggan 1)(Ulang chorus 2x)x Melodi : Upin & Ipin – PengembaraanDengar rakaman dan nyanyikan lagu ini.
  • 133. Aspek TatabahasaTahun 4130Standard Kandungan Aspek Tatabahasa yang digubal bertujuan menentukan keupayaanmurid menguasai asas berbahasa dengan nahu yang betul. Guru perlu melaksanakanpengajaran dan pembelajaran aspek tatabahasa ini secara penggabungjalinan dengankemahiran-kemahiran lain seperti kemahiran lisan, membaca atau menulis. Aspektatabahasa yang perlu dikuasai oleh murid ialah golongan kata, pembentukan kata danpembinaan ayat. Oleh itu, pengajaran dan pembelajaran tatabahasa in harus diajar secaraberfokus dan terancang. Dalam strategi pengajaran dan pembelajaran seni bahasa, guruperlu menetapkan objektif yang mesti dicapai oleh murid dengan merujuk StandardKandungan dan Standard Pembelajaran aspek Tatabahasa yang disediakan.Standard Kandungan Aspek TatabahasaMurid patut mengetahui dan boleh:5.1 Memahami dan menggunakan golongan kata dengan betul mengikut konteks.5.2 Memahami dan menggunakan pembentukan kata yang sesuai dalam pelbagaisituasi dengan betul.5.3 Memahami dan membina ayat yang betul dalam pelbagai situasi.Standard Pembelajaran Aspek Tatabahasa5.1.1 Memahami dan menggunakan kata nama am konkrit dan penjodoh bilangandengan betul mengikut konteks.5.1.2 Memahami dan menggunakan kata nama khas tak hidup dengan betul mengikutkonteks.5.1.3 Memahami dan menggunakan kata ganti nama tunjuk dengan betul mengikutkonteks.5.1.4 Memahami dan menggunakan kata kerja pasif dengan betul mengikut konteks.5.1.5 Memahami dan menggunakan kata adjektif dan kata penguat dengan betulmengikut konteks.5.0 STANDARD KANDUNGAN DANSTANDARD PEMBELAJARAN ASPEKTATABAHASA
  • 134. Aspek TatabahasaTahun 41315.1.6 Memahami dan menggunakan kata hubung pancangan keterangan dengan betulmengikut konteks.5.1.7 Memahami dan menggunakan kata bantu, kata perintah dan kata pemeri denganbetul mengikut konteks.5.2.1 Memahami dan menggunakan imbuhan akhiran -an, -kan, -i, imbuhan apitan padakata kerja, kata nama dan kata adjektif serta imbuhan pinjaman dengan betuldalam pelbagai situasi.5.2.2 Memahami dan menggunakan kata ganda separa dengan betul dalam pelbagaisituasi.5.2.3 Memahami dan menggunakan kata majmuk bentuk yang telah mantap denganbetul dalam pelbagai situasi.5.3.1 Memahami dan membina ayat tunggal dengan peluasan subjek dan predikat yangbetul dalam pelbagai situasi.5.3.2 Memahami dan membina ayat aktif dan ayat pasif dengan betul dalam pelbagaisituasi.
  • 135. Aspek TatabahasaTahun 41325.0 STRATEGI PENGAJARAN DANPEMBELAJARAN KEMAHIRANTATABAHASASemasa merancang strategipengajaran dan pembelajaran bagiaspek tatabahasa, guru perlu memberipertimbangan pada aktiviti yang sesuaidilaksanakan sebelum, semasa danselepas pengajaran dan pembelajaranyang diajar. Pengajaran danpembelajaran kemahiran ini bolehdilaksanakan melalui pelbagai aktivitisecara terancang bagi mencapaiobjektif yang telah ditentukan. Guruboleh merancang strategi pengajarandan pembelajaran dengan pelbagaicara seperti dalam contoh rancanganmengajar yang disediakan ini.
  • 136. Aspek TatabahasaTahun 4133TEMA KESIHATANTAJUK Amalan Pemakanan SeimbangMASASTANDARDPEMBELAJARAN5.1.4Memahami dan menggunakan kata kerja pasif dengan betulmengikut konteks.OBJEKTIFPada akhir pengajaran murid dapat:i. menyenaraikan kata kerja pasif dengan betul secara lisan danbertulis.ii. membina ayat menggunakan kata kerja pasif mengikut konteksdengan betul.PENGISIANKURIKULUMIlmu : Pendidikan Kesihatan, Celik KewanganNilai : Mementingkan KesihatanEMK : Kreatif dan InovatifKB : Menjana Idea, MengecamBCB : Bacaan IntensifSISTEM BAHASA Tatabahasa: Kata kerja pasifBAHAN BANTUBELAJARLembaran kerja, benda maujudPENILAIANPENGAJARANDANPEMBELAJARANMurid dapat menyenaraikan lima kata kerja pasif secara lisan danbertulis dengan betul.REFLEKSI
  • 137. Aspek TatabahasaTahun 4134STRATEGI PENGAJARAN DAN PEMBELAJARANAKTIVITIPENGISIANKURIKULUMCATATANBerbual1. Murid diminta untuk mengambil contohmakanan yang terdapat di dalam kotakdan berbual tentangnya- Kepentingan makanan seimbang- Kesan pengambilan makananseimbang: tidak diserang penyakit: tidak perlu mengeluarkanperbelanjaan untuk mendapatkanrawatanIlmu : PendidikanKesihatanNilai :MementingkanKesihatanIlmu :Celik KewanganBenda maujudKB : MenjanaIdeaLampiran 1Membaca teks dan berbincang1. Murid diberikan teks syarahan untukdibaca secara intensif.2. Guru dan murid berbincang tentang teks.3. Murid diberi penerangan tentang katakerjapasif.4. Murid diminta menggarisi kata kerja pasifyang terdapat dalam teks.EMK :Kreatif dan InovatifLampiran 2BCB : BacaanIntensifKB : MengecamPenilaian1. Murid menukarkan ayat kata kerja aktifkepada ayat kata kerja pasif.Lampiran 3
  • 138. Aspek TatabahasaTahun 4135AKTIVITIPENGISIANKURIKULUMCATATANPemulihan1. Murid menuliskan kata kerja pasif yangbetul berpandukan kata kerja aktif yangdiberi.Lampiran 4Pengayaan1. Murid menulis satu perenggan beritamengenai kesihatan denganmenggunakan beberapa ayat yangmengandungi kata kerja pasif.Lampiran 5
  • 139. Aspek TatabahasaTahun 4136Lampiran 1Guru perlu menyediakan bekas-bekaskecil yang diisi dengan pelbagai jenismakanan dan dimasukkannasi buahlimaukacangrotisayurtelursusu
  • 140. Aspek TatabahasaTahun 4137Lampiran 2Terima kasih Tuan Pengerusi Majlis, Yang Dihormati Guru Kelas 4Baiduri, Puan Iffah Humaira dan rakan-rakan yang dikasihi.Saya ingin menyampaikan syarahan tentang “AmalanPemakanan Seimbang dan Kesannya Terhadap Kesihatan”.Kesihatan diri amatlah penting. Sekiranya kesihatan tidak dijaga, kitaakan mudah mendapat penyakit. Zat makanan diperlukan oleh tubuhkita. Zat makanan yang utama seperti karbohidrat, protein, vitamin,lemak dan mineral.Pengambilan makanan yang seimbang hendaklah diamalkan,apatah lagi sistem pertahanan diri dapat diperkukuh dan penyakitboleh dihindari. Saya berharap kawan-kawan menjadikan amalanpemakanan seimbang dan beriadah sebagai budaya hidup.Sekian, terima kasih.Baca teks syarahan di bawah.
  • 141. Aspek TatabahasaTahun 4138Lampiran 4Penilaian1. Wahidah mencuci pinggan di dapur.………………………………………………………………………………….2. Mereka meraikan hari lahir Puan Maizura.………………………………………………………………………………….3. Pak Sawardi menangkap ikan di laut.……………………………………………………………………………….…4. Negara Malaysia telah mengalahkan Singapura dalam perlawananbola sepak itu.…………………………………………………………………………….……5. Tun Dr. Mahathir Mohamad telah memajukan negara kita.…………………………………………………………………………………6. Cikgu Julia menasihati murid-muridnya agar mengulang kajipelajaran.………………………………………………………………………..………7. Putra Arif membaca buku cerita untuk mengisi masa lapangnya.………………………………………………………………………………8. Tukang kebun sedang mencantas pokok bunga...……………………………………………………………………………..Tukarkan ayat aktif di bawah menjadiayat pasif.
  • 142. Aspek TatabahasaTahun 4139LampiranPemulihanKATA KERJA AKTIF KATA KERJA PASIFMemancingMemasakMenghidangMenggorengMerebusMenutupMenjagaMenghindariTukarkan kata kerja aktif di bawahmenjadi kata kerja pasif.
  • 143. Aspek TatabahasaTahun 4140Lampiran 5PengayaanKelas Empat Rajin mempunyai murid seramai 40 orang. Pada minggu ini seorangmurid telah diserang penyakit demam malaria. Dua orang lagi telah..........................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................dimasukkan diberi dinasihatkan dilarangditemani diserang dibenarkanKarangkan sebuah cerita denganmenggunakan perkataan-perkataandiberi.
  • 144. Aspek TatabahasaTahun 4141TEMA KESELAMATANTAJUK Keselamatan di Jalan rayaMASASTANDARDPEMBELAJARAN5.3.2Memahami dan membina ayat aktif dan ayat pasif denganbetul dalam pelbagai situasi.OBJEKTIFPada akhir pengajaran murid dapat:i. menulis ayat pasif dengan betul berdasarkan ayat aktif yangdiberi.ii. memberi pendapat tentang maklumat yang terdapat dalamposterPENGISIANKURIKULUMIlmu : PKJR, Celik KewanganNilai : Berhati-hati, PatuhEMK : Kreativiti dan InovasiKB : Menjana Idea, Mengelas,Membanding Beza, Menyusun AturSISTEM BAHASA Tatabahasa : Ayat aktif, ayat pasif.BAHAN BANTUBELAJARPoster, keratan akhbar, lembaran kerja, senarai semakPENILAIANPENGAJARANDANPEMBELAJARANMurid dapat menulis ayat pasif berdasarkan ayat aktif yang diberidengan betul.REFLEKSI
  • 145. Aspek TatabahasaTahun 4142STRATEGI PENGAJARAN DAN PEMBELAJARANAKTIVITIPENGISIANKURIKULUMCATATANBersoal jawab1. Murid dan guru bersoal jawab tentangposter keselamatan jalan raya yangditunjukkan .2. Guru dan murid berbual tentanginsuran hayat dan insuran kenderaanserta kepentingannya sekiranyaberlaku kemalangan.Ilmu : PKJRNilai : Berhati-hatiIlmu:Celik KewanganKB : Menjana IdeaLampiran 1Membina ayat1. Murid membina ayat aktif berdasarkanposter.2. Murid membaca ayat aktif yang dibina.3. Guru menerangkan tentang ayat pasif.4. Murid dibimbing membina ayat pasifberdasarkan ayat aktif yang tersedia.KB : Menjana IdeaLampiran 1‘Dengar dan Catat’1. Beberapa orang murid dimintamengambil kad ayat di dalam kotak danmembacakan ayat tersebut.2. Murid lain menentukan sama ada ayattersebut ayat aktif atau ayat pasifdengan mencatatkan dalam senaraisemak yang disediakan.Lampiran 2(i) , 2(ii)KB - Mengelas
  • 146. Aspek TatabahasaTahun 4143AKTIVITIPENGISIANKURIKULUMCATATANPenilaian1. Murid membina ayat pasifberdasarkan ayat aktif yang diberi.Lampiran 3Pemulihan1. Murid menyusun semula perkataanmenjadi ayat pasif yang betul.KB : Menyusun AturLampiran 4Pengayaan1. Guru mengedarkan satu keratanakhbar.2. Murid membaca keratan akhbar secaramentalis dan mengenal pasti ayat aktifdan ayat pasif.3. Murid menyalin ayat aktif dan ayat pasifpada ruangan yang betul.KB : MembandingBezaLampiran 5(i), 5(ii)
  • 147. Aspek TatabahasaTahun 4144Lampiran 1Teliti dan bincang maklumat dalam posterkeselamatan jalan raya yang ditunjukkan dibawah ini.
  • 148. Aspek TatabahasaTahun 4145Lampiran 2(i)Baca dan fahami ayat aktif dan ayatpasif di bawah ini.6. Pembuli jalan raya itu telah ditangkap.4. Kakak membelikan ibu seutas rantai.1. Pekerja membaiki jalan yang rosak itu.3. Rumah itu dilanggar oleh lori pada bahagian depannya.2. Sampah sarap dibakar oleh ayah pagi tadi.5. Gadis itu menjahit sehelai baju untuk adiknya.
  • 149. Aspek TatabahasaTahun 4146Lampiran 2(ii)SENARAI SEMAKDengar bacaan kawan kamu dan tanda ( / ) pada ayat aktif dan ( X ) padaayat pasif.Ayat Aktif Pasif123456Lengkapkan borang di bawah.
  • 150. Aspek TatabahasaTahun 4147Lampiran 3PenilaianTukarkan ayat aktif kepada ayat pasif yangdiberi di bawah ini.Ayat aktif : Saya mencuci kasut sekolah.Ayat pasif : _____________________________________________ .Ayat aktif : Awak mesti menyerahkan surat itu.Ayat pasif : _____________________________________________ .Ayat aktif : Cikgu Ramlan mengarahkan murid-murid supaya beratur.Ayat pasif : _____________________________________________ .Ayat aktif : Saya akan memetik bunga itu.Ayat pasif : _____________________________________________ .Ayat aktif : Kami sudah menyusun jadual itu.Ayat pasif : _____________________________________________ .
  • 151. Aspek TatabahasaTahun 4148Lampiran 4Pemulihan1. ibu dipakai Topi keledar oleh itu_____________________________________________________________.2. jalan Peraturan mesti kita raya patuhi_____________________________________________________________ .3. disaman cuai Pemandu polis yang itu kereta oleh_____________________________________________________________ .4. dibawa Mangsa oleh kemalangan hospital itu Pak Abu ke_____________________________________________________________ .5. oleh ditunggang Basikal itu cermat adik dengan_____________________________________________________________ .6. tuntun jalan raya semasa Adik saya melintas____________________________________________________________ .Susun perkataan di bawah menjadi ayat pasif yanglengkap.
  • 152. Aspek TatabahasaTahun 4149Lampiran 5(i)PengayaanPENIAGA MAUT KERETA LANGGAR TIANG ELEKTRIKKAJANG, 13 Mac– Seorang peniaga maut terlanggar tiang elektrik. Kejadiantersebut berlaku ketika hujan lebat petang semalam.Mangsa Azmi bin Daman, 38 tahun, memandu kereta itu dengan laju.Rakannya Mahadzir bin Salleh, 36 tahun, cedera di bahagian kepala dandilaporkan stabil selepas dirawat di Hospital Serdang. Difahamkan, beliautelah dirawat oleh seorang doktor pakar. Ketika kejadian tersebut berlaku,mangsa bersama rakannya dalam perjalanan pulang dari Kuala Lumpurselepas balik dari tempat kerja.Menurut beberapa orang saksi yang melihat kejadian tersebut, keretamangsa dipandu dengan laju. Kelajuan itu menyebabkan kereta terbabasdan melanggar tiang elektrik.Ibu mangsa, Sharifah binti Yusoff, 58 tahun telah dihubungi oleh pihakpolis. Beliau tidak menyangka akan sikap anaknya yang tergesa-gesa mahupulang itu adalah petanda bahawa dia akan kehilangan anak sulungnya buatselama-lamanya.Baca dan fahami berita di bawah.Kemudian, garisi ayat aktif dan ayat pasif.
  • 153. Aspek TatabahasaTahun 4150Lampiran 5(ii)Ayat Aktif1. ………………………………………………………………………………………….............…………………………………………………………………………………………………….. .2. …………………………………………………………………………………………………….…………………………………………………………………………………………………… .3. …………………………………………………………………………………………………….……………………………………………………………………………………………………. .150150Ayat Pasif1. ………………………………………………………………………………………….............…………………………………………………………………………………………………….. .2. …………………………………………………………………………………………………….…………………………………………………………………………………………………… .3. …………………………………………………………………………………………………….……………………………………………………………………………………………………. .Tulis ayat aktif dan ayat pasif yangdiperoleh daripada keratan akhbar dalamruangan yang betul.
  • 154. Aspek TatabahasaTahun 4151TEMA KEMASYARAKATANTAJUK KebakaranMASASTANDARDPEMBELAJARAN5.1.6Memahami dan menggunakan kata hubungpancangan keterangan dengan betul mengikutkonteks.OBJEKTIFPada akhir pengajaran murid dapat:i. melengkapkan ayat dengan menggunakan kata hubungpancangan keterangan dengan betul mengikut konteks.ii. menulis ayat dengan kata hubung yang betul mengikutkonteks.PENGISIAN KURIKULUMIlmu : Sivik, Celik KewanganNila : Berhati-hati, pekaEMK : Kreativiti dan InovasiKP : InterpersonelKB : Menjana IdeaSISTEM BAHASAKosa kata: kata hubung pancangan keterangan -kerana,andai kata, manakala, ketika, agar, supayaBAHAN BANTUBELAJARPetikan berita, lembaran kerja, kad perkataanPENILAIANPENGAJARAN DANPEMBELAJARANMurid dapat melengkapkan ayat dengan menggunakan katahubung pancangan keterangan dengan betul.REFLEKSI
  • 155. Aspek TatabahasaTahun 4152STRATEGI PENGAJARAN DAN PEMBELAJARANAKTIVITI PENGISIAN KURIKULUM CATATANMembaca1. Guru bersoal jawab tentangbunyi siren yangdiperdengarkan untukmengaitkannya dengan tajukkebakaran.2. Murid membaca secaramekanis petikan yangdiedarkan.3. Murid menerangkan risiko yangdihadapi jika harta benda tidakdilindungi dengan bimbinganguru.4. Bersoal jawab tentang caramembantu mangsa bencana.Ilmu : SivikNilai : pekaKB : menjana ideaLampiran 1Menyenaraikan kata hubung1. Guru memberi penerangantentang kata hubungpancangan.2. Murid menyenaraikan katahubung berdasarkan petikan.3. Murid membaca ayat yangmengandungi kata hubungpancangan keterangandaripada petikan.KP - InterpersonelLampiran 1
  • 156. Aspek TatabahasaTahun 4153AKTIVITI PENGISIAN KURIKULUM CATATANMembina ayat1. Murid dibahagikan kepadabeberapa kumpulan.2. Wakil setiap kumpulan dimintamemilih perkataan kata hubungdi dalam sampul surat yangdiberi.3. Murid diminta membaca kadperkataan tersebut danseterusnya membina ayatmenggunakan kata hubungtersebut secara spontan.4. Murid yang lain dimintamencatat ayat yang dibina olehrakan mereka.Nilai : Bekerjasama KB – MenjanaIdeaSampul suratKad perkataanMenyusun perkataan1. Murid menyusun kad perkataanyang diberi supaya menjadiayat majmuk yang lengkap.2. Wakil kumpulan menampal kadperkataan yang telah disusunpada papan kapur.EMK :Kreativiti dan InovasiKB – MenyusunAturKad PerkataanPenilaian1. Murid melengkapkan ayatdengan kata hubung pancanganketerangan dengan betul.Lampiran 2Pemulihan1. Murid menggariskan katahubung pancangan dalam ayatyang diberi.KB : MengecamLampiran 3
  • 157. Aspek TatabahasaTahun 4154AKTIVITI PENGISIAN KURIKULUM CATATANPengayaan1. Murid diminta mencari katahubung pancangan daripadamaklumat yang diberi.2. Murid membina ayatmenggunakan kata hubungtersebut.KB :MengecamMenjana IdeaLampiran 4
  • 158. Aspek TatabahasaTahun 4155Lampiran 1Sebuah Keluarga Tinggal Sehelai SepinggangTAPAH, 18 September – Suasana gembira sebuah keluargamenjelang hari raya bertukar menjadi sedih kerana satu kebakaran telahmemusnahkan rumah mereka awal pagi tadi.Ketua Polis Batang Padang menjelaskan terdapat dua orangkanak-kanak tercedera sewaktu kejadian itu. Manakala ibu merekahanya mengalami kecederaan ringan ketika cuba menyelamatkanmereka.Kebakaran itu dipercayai berpunca daripada penggunaan ubatnyamuk. Tiada apa-apa yang dapat diselamatkan daripada kebakarantersebut kerana api marak terlalu cepat.Pegawai Operasi Bomba dan Penyelamat menasihatkan orangramai agar lebih berhati-hati supaya kejadian seumpama itu dapatdielakkan.Pihak Bomba menghadapi kesukaran untuk memadamkankebakaran kerana tekanan air di kawasan tersebut rendah manakala airsungai yang berhampiran pula cetek.Api hanya dapat dikawal dalam masa 30 minit. Pada masa yangsama penduduk di kawasan itu melancarkan derma kilat untukmembantu mangsa kebakaran tersebut.Baca dan sebutkan perkataan berwarna dibawah.
  • 159. Aspek TatabahasaTahun 41561.2.3.4.5.keranaDiatidakdemamkesekolahpanasbahawamemberitahu sihatsayaAzri tidakdiaituLocengberbunyiapabilasaya menekannyaawal tidak supaya BangunlahbasketinggalanSusun semula kad perkataan yang diberisupaya menjadi ayat majmuk atau dengancara klik dan seret.berdoa agar Ramlah anaknya cergassihatdan
  • 160. Aspek TatabahasaTahun 4157Lampiran 2Penilaian1.2.3.4.5.sementara bahawa supayakerana ketikaZila membaca buku _______________ menunggu loceng berbunyi.Permainan itu ditangguhkan _______________hujan turun denganlebatnya.Kebakaran itu berlaku ____________ mereka sedang tidur.Kita harus ingat ___________ rajin dan usaha ialah tangga kejayaan.Razak mengurangkan makanan bergula _______________ tidak mendapatpenyakit kencing manis.Lengkapkan ayat di bawah dengan katahubung pancangan keterangan yang sesuai.
  • 161. Aspek TatabahasaTahun 4158Lampiran 3Pemulihan1.2.3.4.5.6.Garisi kata hubung pancangandalam ayat di bawah.Dia belajar dengan tekun agar lulus dalam peperiksaan.Azim berlari lintang- pukang apabila dikejar oleh anjing.Adam dimarahi oleh ibunya kerana malas belajar.Karim duduk sahaja manakala orang lain sibuk mengemaskan bilik darjah itu.Dia sering bersenam supaya badannya sentiasa sihat.Azam mengalami kemalangan ketika pulang dari sekolah.
  • 162. Aspek TatabahasaTahun 4159Lampiran 4PengayaanLangkah-langkah keselamatan untuk mencegah kebakaran.x Kita mestilah memastikan semua suis elektrik dimatikan ketika…………………………………………………………………………………………x Pastikan setiap rumah memiliki alat pencegah kebakaran agar…………………………………………………………………………………………x Pastikan mancis disimpan di tempat yang selamat supaya ………………….………………………………………………………………………………………….x Kita harus cepat bertindak andai kata …………………………………………….………………………………………………………………………………………….x Elakkan daripada menggunakan barangan elektrik yang telah rosak kerana………………………………………………………………………………………….Bina ayat menggunakan katahubung yang diperoleh di bawah.
  • 163. BAHAGIAN 3PEMETAAN RANCANGAN MENGAJARMINGGUAN
  • 164. 163MINGGUTEMA/TAJUKHARI1HARI2HARI3HARI4HARI51Tema:KESIHATANTajuk:FaedahBersukanDemamDenggiWabakMembunuhKlinik1MalaysiaHidupBebasTanpaDadahAmalanPemakananSeimbangSTANDARDPEMBELAJARANMENDENGARDANBERTUTURSTANDARDPEMBELAJARANMEMBACASTANDARDPEMBELAJARANMENULISSTANDARDPEMBELAJARANSENIBAHASASTANDARDPEMBELAJARANASPEKTATABAHASA1.7.2Berbincangdanmengemukakanpendapattentangsesuatuperkaradaripadapelbagaisumberdenganmenggunakanayatyanggramatissecarabertatasusila.2.4.3Membacadanmemahamimaklumatyangtersuratdantersiratdengantepatdaripadapelbagaibahanuntukmembuatpenilaiandenganbetul.3.4.2Menulisimlakprasadanayatyangmengandungiperkataanberimbuhanpinjamandenganejaandantandabacayangtepat.4.4.2Membinasajaksecaraterkawaldanmendeklamasikannyadengansebutandanintonasiyangbetuldanjelassecaradidikhibur.5.1.4Memahamidanmenggunakankatakerjatransitifpasifdenganbetulmengikutkonteks.PEMETAANBAHASAMALAYSIASEKOLAHKEBANGSAANTAHUN4
  • 165. 164MINGGUTEMA/TAJUKHARI1HARI2HARI3HARI4HARI52Tema:KESELAMATANTajuk:BanjirSikapPemanduAkuSebatangLampuIsyaratTragedidiSungaiKeselamatandiJalanRayaSTANDARDPEMBELAJARANMENDENGARDANBERTUTURSTANDARDPEMBELAJARANMEMBACASTANDARDPEMBELAJARANMENULISSTANDARDPEMBELAJARANSENIBAHASASTANDARDPEMBELAJARANASPEKTATABAHASA1.3.3Mendengar,memahamidanmemberikanresponsdenganmenyampaikanpesananmengikuturutandenganbetul.2.3.1Membacapelbagaibahanyangmengandungipelbagaijenisayatsecaramekanisdenganlancar,sebutanyangjelasdanintonasiyangbetul.3.7.2Menghasilkanpenulisankreatifberbentukimaginatifdandeskriptifdenganbetul.4.2.2Mengujarkanceritadenganmenggunakanbahasayangindahuntukmenyampaikanideadenganbahasabadanyangsesuai.5.3.2Memahamidanmembinaayataktifdanayatpasifdenganbetuldalampelbagaisituasi.PEMETAANBAHASAMALAYSIASEKOLAHKEBANGSAANTAHUN4
  • 166. 165MINGGUTEMA/TAJUKHARI1HARI2HARI3HARI4HARI53Tema:KEMASYARAKATANTajuk:BudiBahasaAmalanKitaHidupBerjiranCerianyaTamankuDamaiKebakaranSTANDARDPEMBELAJARANMENDENGARDANBERTUTURSTANDARDPEMBELAJARNMEMBACASTANDARDPEMBELAJARANMENULISSTANDARDPEMBELAJARANSENIBAHASASTANDARDPEMBELAJARANASPEKTATABAHASA1.4.2Berbualtentangsesuatuperkaramenggunakankatagelaranyangsesuaidalamsituasitidakformalsecarabertatasusila.2.2.3Membacaayatyangmengandungiimbuhanapitandalampetikandengansebutanyangbetuldaripadapelbagaisumberdanmemahamiperkarayangdibaca.3.3.3Membinadanmenulisjawapanpemahamanberdasarkansoalanyangbertumpudanbercapahdenganbetul4.1.1Menyebutdanmemahamiliriklagumelaluinyanyiangeraklaku.5.1.6Memahamidanmenggunakankatahubungpancanganketerangandenganbetulmengikutkonteks.PEMETAANBAHASAMALAYSIASEKOLAHKEBANGSAANTAHUN4
  • 167. BAHAGIAN 4
  • 168. 169Aaabadabaiabaikanacuada-adaadatadat resamadindaaduanaerobikaibakuanakhbarakhiranakhiratakhlakakrabalamat (petanda)aliranalisalu-aluanalunanamal baktiampaiampaiananakandaanak pinakancamancamanandaiananduhanggapangkasa lepasangkasawanangkatanangkuhaniayaanugerahanutapa-apaapartmenartisarusarwahasarasasasidasramaatlasatletatomatur caraauratautobiografiautomatikautomobilawalanayahandaayakayuBbbabakbagindabahawabakabakalbakhilbakteriabakubalaibalai berlepasbalai ketibaanbalai rayabalakbalapanbalutanbandulbandungbangkaibangsalbaranganbarangkalibaratbarat dayabarat lautbasah kuyupbasuhanbatasbatu permatabatu-batanbayanganbayubebasbebaskanbecakbedahbelakabelangabelantarabelasanbelitbelukarbelutbencanabendulbengkang-bengkokbengkelbendulbenihbentengberadatberadu (lawan)berahsiaberakhlakberalahberalunberamalberambuberangberangkaiberangkatberarak
  • 169. 170berasramaberatapkanberawanberawasberbahagiaberbahasaberbalas(-balas)berbandingberbaraberbecaberbelahberbelit(-belit)berbelokberbelok-belokberbilangberbingkaiberbintangberbonggolberbongkahberborakberburubercambahbercangkungbercapbercintaberdagangberdalihberdamaiberdayaberdebar(-debar)berdegilberdengkiberdengkurberdendamberdikariberdukaberdukacitaberdustaberedarberenjinberentakberentapberesberfesyenberfirmanberformatbergantibergasbergaulbergayutbergegarbergelarbergeligabergelombangbergemabergoncangberhajatberhakberharapberhartaberhawaberhempas-pulasberhiburberibu bapaberikhtiarberiklimberimanberingatberistirahatberjela(-jela)berjenakaberjenamaberjengketberjerebuberjersiberjogetberjuangberjudiberjuntaiberkaitanberkasberkedutberkeladakberkenanberkepitberkhatanberkhidmatberkisarberkobar-kobarberladamberlagaberlagakberlangsungberlapisberlemakberlengahberleterberlianberliku-likuberlindungberlingkarberlonggokberlorekberlunjurbermasalahbermegahberminggu-minggubermuka-mukabermurambermurungbernasberolehberotiberpada-padaberpaduberpalingberpanduberpangkatberpatutanberpautanberpekertiberpeluangberpenatberpendapatberpengetahuanberpesta
  • 170. 171berpidatoberpihakberpisahberpuncaberputarbersajakbersalam-salamanbersalin (beranak)bersebelahanbersedekahberselangberseleraberselerakbersemangatbersembangbersendirianbersenjatabersilatbersirambersuarabersuka riabersungutbersusah payahbersusunbersyukurbertabiatbertahanbertahun-tahunbertalu-talubertanambertandabertandatanganbertani pertanianbertaruhbertekadbertekakbertenggekbertengkarbertenunberteriakbertihbertikam(-tikaman)bertimbang rasabertindakbertindak balasbertindihbertinjubertitahbertolak ansurbertolak-tolakanbertumitbertungkus-lumusberturut-turutberubanberwaspadaberziarahbesar-besaranbestaribetabetapabidalanbidangbijihbikarbila-bilabimbangbimbitbingkaibingungbinokularbiodatabiografibisulbiusboleh jadibondabongkahbongkakbongkarbonus borakborekboyotbuah pinggangbuanganbudimanbuncitbundarkanburubusaCccabarancacicaciancaloncambahcangkerangcangkukcangkungcantascantasancapcarikcartacarutcascebiscebisancekcelahcelakacelciuscemarcencangcengkamcengkamancerakincerewetcetakcicitcinggeciri(-ciri)ciumancogan katacolek
  • 171. 172compang-campingcontengancorongcubitancuciancucundaculikcuramcurangcuri-curiDddadahdadardadihdaerahdaftardagangdagangandahulu kaladalihdamakdarjah (unit)dasardatardayadaya usahadayangdebungadedakdedaludedaundefinisideklamasidemidemokrasidengkurdentumanderiadestardestinasidetektifdetikdi sampingdinamodiskaundongakdozenduburdustaduyungEeedaranejeneksperimeneksportendahengselentah-entaherameratkanesakestetFffakirfaktafaktorfardufaunafirmanfizikalfloraformatfotosintesisGggabusgadinggaganggagaugalakgalakangamamgandumganjagarigaringgaulgaunggayutgeargegargegarangejalagegargelarangeletekgeligagelombanggemagementargemilanggempagempa bumigemuruhgendalageografigerabakgerhanagerungesekgesekangilinggimnasiumgimnastikgimramagiziglobglosarigolf
  • 172. 173golongangoncanggrafgramgrilgudwaragugurguntingangunung berapigurunHhhabuanhadamhadirathadishafazhajathakhakishakisanhalanganhalkumhamahambathamilhamishampahancinghangithantukhanyirhapakharapanhartahartawanhasadhasilhasrathastahemisferahempaphempashempeduhentakherbaherbivorherethiburanhidrogenhidupanhikayathikmathiruphormat-menghormatihubungihubungkanhuru-haraIiibaratidamidamanigauikhtiariklimimportinaiinapindividuindustriintaiintipaniparirasistilahistirahatisyakJjjaguhjahiljajahjalarjam randikjamahjampijangan-janganjangkaujaringanjawatankuasajedajejakjejakajeljelagajelmajemuranjenamajerangjerawatjerebujeritanjersijilidjinjinjingjinjitjiwajolokanjudijulung(-julung)junjunganjuntaijurangjurulatihKkkacau-bilaukacipkadangkalakadar
  • 173. 174kadbodkadetkadikagumkahakkaiskajangkajiankakitangankakukaliskamarkampitkancingkandarkanserkantakaramkarangan (bunga)karbohidratkarbonkarbon dioksidakarnivorkaromkarutkasihikata-kata hikmatkatodkaum kerabatkaunterkayakke hadapankeamanankeayuankebakarankebenciankebetulankebiadabankebodohankebolehankecemasankecergasankeceriaankecewakecuramankecutkedamaiankedegilankedekutkedengarankediamankedudukankedutkedutankeenakankegagalankegigihankegunaankehabisankehadirankehandalankehidupankeikhlasankeinginankeizinankejernihankejikekasarankekecewaankekeringankekokkekosongankekuningankelabkeladakkelahirankelajuankelakkelambatankelambukelapangankelarkeledarkelengkapankelepasankelicinankelincahankelirukelongkelukeluhkeluhankelulikemahuankemajuankemakmurankemaluankemarahankematiankemenangankemeriahankemikkemudahan awamkemuncakkenankendikenitkenyitkepadatankepahlawanankepandaiankepentingankepingankepitkepompongkerabatkeracunankerajaankerandakerangkakerdilkeriangankerikilkerjasamakerosakankesal
  • 174. 175kesegarankesibukanketajamanketakutanketepatanketibaanketurunankeuntungankewajipankeyakinankhalayakkhatamkhatulistiwakhianatkhidmatkhuatirkhususkiamatkiankijangkikiskiraikisarkitarkondominuimkoyak-rabakkraf tangankreatifkriketkubahkudupkuizkulatkulumkumiskunang-kunangkunjungikunyitkurunkutubkutub selatankutub utaraLlladamlagalagaklajaklakarlakaranlalu (langsung)lalu lintaslaluanlambailantanglantunlapangan (bidang)laporlaporanlaporkanlaras (pb)laratlautanlavalayaklayananlecurlekitlelonglemaklemaulembahlembar (pb)lembinglengahlesaplesungleterleteranletupletupanliatligatlikulilitlilitanlincahlindunglingkarlingkaranlintahlintasanlitarliterlogamlogolombonglompat kijanglondehlonggoklonggokanlontar lembingloreklosenlotluar biasalunjurluruhMmmaghribmagnetmahagurumaharajamahirmahligaimakamaklummalaikatmalariamamaliamampumanakalamana-manamara
  • 175. 176marmarmasyarakatmata airmata-matamayangmegahmekanikmekarmelainkanmelajukanmelakarmelakonkanmelalakmelambaimelambaikanmelambangkanmelambatkanmelampaumelandamelantunmelantunkanmelapangkanmelaporkanmelaratmelariskanmelebarkanmelebihimelecurmelegakanmelekitmelelehmelengahkanmelengkapkanmelesapkanmelilitkanmelindungimelintangmelombongmelonggokkanmelorekkanmeluluskanmeluncurmelunjurkanmemadaimemajukanmemaklumkanmemalingkanmemalsukanmemalumemalukanmemancarmemancarkanmemancungmemancutmemandai(-mandai)memangkumemaniskanmemanjakanmemanjangkanmemapahmemarangmemasarkanmemastikammematikanmembanggakanmembangunkanmembanyakkanmembasahimembasahkanmembebaskanmembedahmembekumembekukanmembelakangkanmembelanjakanmembeliakkanmembencimembengkokmembengkokkanmembentangkanmembezakanmembiasakanmembimbingmembimbitmembinasakanmembincangkanmembisikkanmembisumembiusmembodohkanmembohongimembolehkanmembongkarmemboroskanmembotakkanmembotolkanmembrekmembrekkanmembundarkanmemburumembusukkanmemendamkanmementingkanmemerangimemeranjatkanmemercikmemeriahkanmemerintahmemerintahkanmemfotostatmemihakmemimpinmeminatimempercayaimempercepatmemperdengarkanmemperjuangkanmemperkayamemperkemasmemperkenalkanmemperolehmempersilakanmempertajammempertahankanmempesonakanmemuja
  • 176. 177memulakanmemulasmemungkirimemusnahkanmemusuhimemvarnismenadahmenadahkanmenagihmenakjubkanmenakutkanmenamatkanmenambahmenambahkanmenambunmenamparmenampimenanamkanmenandatanganimenangkismenayangkanmencacakkanmencacatkanmencacimencalonkanmencangkukmencangkungmencantasmencantumkanmencarikmencarutmencekikmencelahmencelupmencemarkanmencemaskanmencencangmencengkammencepatkanmenceriakanmenculikmendaftarmendahuluimendahulukanmendapatimendapatkanmendekatimendekatkanmendeklamasikanmendengkimenderamenderaskanmendoakanmendobimendongakmendudukimenegakmenegakkanmenegukmenekankanmenekapmenelentangmenelitimenempatkanmenempelmenempuhmenengahmenengkingmenentangmenentumenepimenepikanmenerkammenerpamenerusimenetapkanmenetaskanmengabaikanmengaburkanmengacarakanmengadilimengadukanmengagakmengagumkanmengaibkanmengaismengaitkanmengajimengakhirimengakuimengalahmengalamimengalu-alukanmengampaimengampunkanmengancammengandaikanmengandungmenganggapmenganggurmenganiayamenganutmengarakmengaratkanmengawasimengayakmengayakanmengecap (cap)mengecasmengecewakanmengecilmengecilkanmengejimengejutmengejutkanmengeksportmengelakmengelakkanmengelarmengelirukanmengelokkanmengeluhmengembungmengenamengenaimengenakan
  • 177. 178mengenakkanmengendahkanmengenyangkanmengenyitmengepamkanmengepitmengerammengeratkanmengetinkanmenggagalkanmenggagaumenggalakkanmengganggumenggarimenggarisimenggaulmenggaulkanmenggegarkanmenggelarkanmenggeletekmenggeliatmenggelincirmenggemarimenggembirakanmenggemukkanmenggerunkanmenggesekmenggilingmenggolongkanmenggoncangmenggoyangkanmenghadamkanmenghadiahimenghafazmenghakimkanmenghambatmenghampirimengharapkanmenghasilkanmenghebohkanmenghembuskanmenghempapmenghempaskanmenghentakmenghentakkanmengheretmenghidupkanmenghinggapimenghirupmenghumbanmengigaumengikatkanmengikismengikutimengilatkanmengimportmenginapmengingatimenginginkanmengintaimengintipmengiraimengirimkanmengisarmengubah suaimengugutmengukirmengukirkanmengulasmengumumkanmengundimengusahakanmengx-raymenikmatimenimbangmenimbulkanmenimbunkanmenimbusmeninggalkanmeninggikanmeningkatmeninjumenipiskanmenitiskanmeniupkanmenjadi-jadimenjajahmenjalanimenjalarmenjamahmenjampimenjangkaumenjangkitimenjatuhimenjauhimenjawatmenjejakmenjelangmenjelingmenjentikmenjerangmenjernihkanmenjinakkanmenjinjingmenjinjitmenjulangmenjunjungmenolehmensia-siakanmentaatimenterjemahkanmentertawakanmenuaimenubuhkanmenugaskanmenujukanmenumpahkanmenumpulkanmenunaikanmenuntutmenurunimenurunkanmenurutimenurutkanmenusukmenyakiti
  • 178. 179menyalahkanmenyambungmenyampaikanmenyandarkanmenyayangimenyeberangimenyedapkanmenyediakanmenyedihkanmenyegarkanmenyekolahkanmenyelitkanmenyelukmenyembelihmenyembuhkanmenyembunyikanmenyemburmenyentuhmenyepahkanmenyeretmenyesalmenyibukmenyusuimenzalimimerabameracaumeragukanmerakamkanmeramalmerangkamerapatkanmerasaimerasakanmerasmikanmerayumeredakanmereka ciptamerendangmerentapmerentasmerenungmeresapmerindukanmerintihmerosotmerungutmesramewajibkanmeyakinkanmindamineralminimisalnyamodalmodenmotivasiMuharammujurmungkirmurkamurnimurungmuslihatmutiaraNnnabinahasnanahnatnenekanda/nendaneracanikmatnipahnotisnovelnutriennyanyiannyanyuknyaringnyaris(-nyaris)nyiurnyonyaOooatobjektiforientasiPppacakpacatpadahpadatpaderipahalapaletpalupaluanpanaupancarpancitpancungpancutpancutanpandanganpanggung wayangpangkalpangkatpangkinpangkupangsapuripanjipanjutpantangpapapapahparasparauparaupari-pariparu-parupaspasif
  • 179. 180pastipatikpawagampayapayaupayung terjunpedagangpeguampejalpejuangpekanpelaminpelanggaranpelombongpelukanpelumbapelupapemakanpemakananpemanahpemanggilpemangsapemantunpembalakpembancuhpembantupembasuhpembawapembayangpembedahanpemberatpembesarpembesaranpembinaanpemborospembuanganpembukapembukaanpemburupemelukpemergianpemeriksapemeriksaanpemimpinpemutihpenapenafasanpenagihpenamatpenanampenanamanpenanda wacanapencangkukpencaripencatatpencegahanpencemaranpenceritapencukurpendahuluanpendapatanpendatangpendekarpendengaranpenebukpenenunpenerbitpengacarapengakappenganggurpengangkutanpenganutpengaruhpengasihpengatpengayakpengeksportpengeluarpenggantipenggilingpenggunapenghabisanpenghadamanpenghiburpenghulupengikispengikutpengimportpenginapanpengintippengirimpenglihatanpengumumanpeninjupenitipeniuppenjagaanpenjurupenukulpenulispenumbukpenuntutpenuturpenyayangpenyekpenyeluk sakupepatahpepejalperahsiaperakperakamperananperancangperasaperbelanjaanperbendaharaanperbincanganpercapercikpercikanpercubaanpercutianperdaganganperdanaperdana menteriperdu
  • 180. 181peredaranpergaulanperindustrianperingkatperintahperisaperisaiperisikperkampunganperkelahianperkhidmatanperkuburanpermatapermatangpermulaanperosakperpaduanperpisahanperpuluhanpersamaanpersekolahanpertemuanpertengahanpertengkaranpertiwipertukaranperubahanperubatanperusahaanpetempatanpetinjupetrolpetunjukpewarnapidatopihakpindah-randahpinggirpinjamanpintapitaplagplanetplayarpolisterenapongkesposkodprogrampuakapudarpujapujaanpulau (daratan)pulau (sisih)punggukpungutpuntungpupuspusakaputaranRrracauradasragbirakamrakamanRamadanramah-tamahramalramalanramburanggirasmirawan (pb)rayurayuanrebanaredarehalrekaanremajarencanarendarenekrentakrentaprentasrentungreptiliaresahresapresipirezekiriarimrimasrimbarimbunrintihrisalahrisikrombusronggaruasrumah bandungrumah tanggarumbiarumirumpairumpunruncingruncitrungutrupa-rupa(nya)Sssagasagusagu hatisaingsajiansaktisalah faham
  • 181. 182salah sangkasaluransamansamar-samarsambilansaratsatu persatusayang-menyayangisayusebagaimanasebaik-baiksebaik-baiknyasebarangsebatisebilangansehabisseharusnyaseiaseirasseisisejadahsejumlahsekaliansekawansekianselselagiselambaselarisemalamansemangatsenja kalasenyumanseolah-olahsepandai-pandaisepanduksepanjangsepatutnyaserangkaiseratserba-serbiserkupserpihserpihansertakansesalsesamasesekalisesetengahsesikusesuka hatisetsetahusetakatsetempatsetentangsetibasetidak-tidaknyasetinggansferasimpang-siursinarsinaransindirsindiransingkatansingsingsiratansisisiulansiungskuasysokongansolarsotospringsubuhsukatansukusuku-sakatsulitsuluhsulursumbersumpitsumpitansuntikansurat permohonansurisuriasurutsusah payahsusunansuterasyaitansyarahansyaratTttabiattabirtadahtagihtahanantahaptakattakburtakdirtakhtatakjubtaliantambuntampahantampitanggungantanggungjawabtangisantanjaktarikantasbihtaskatatatertibtaufantauntawan
  • 182. 183tawarantebingtebukantegaptegasteguktekadtekanantelatahtelentangtelititembakautemberangtembikartempahtempatantempetempelengtempiastempeltempohtenggaratenggektengiktengkingtengkoraktenistentangtentangantenusutepukanterabaiteraba-rabaterang-benderangterangkanterasateratakterbawaterbelahterbelitterbengkalaiterbentukterbiarterbongkarterbongkok-bongkokterbuangterbukatercabartercabuttercacaktercampurtercari-caritercatattercekiktercemartercengangtercintaterciptaterdahuluterdayaterendakteresak-esaktergamamtergeliattergelincirtergendalatergolongterhadapterhempapterhempasterhiburterhimpitterhiristerhitungterhutangteriakterikteritipterjejasterkamanterkehelterkorbanterkurangterlajakterlebihterlindungtermasukternamaternanti-nantiterpaparterpautterpendamterpengaruhterperinciterpesonatersebuttersediatersedu-seduterseliuhtersendiritertanya-tanyatertawantertentutertimbustertulistertumpahtertunggu-tungguterubatterus-menerustidak-tidaktimbang rasatindak balastingkah lakutisutitahtocangtolak-menolaktolehtombaktonggektongkoltoniktradisitrelertsunamituai
  • 183. 184tuankutugasantukultunaitunasUuubah suaiubanubat-ubatanubun-ubunugutugutanujaruji kajiukirukiranulas (hurai)ulasanulungumatumbiumpamaumumundangundanganungkapurutanususutaraVvvarnisvirusWwwajawaraswartawartawanwaspadawaswaswatakwawancarawayarleswayang kulitwudukYyyisyogurtyongtaufuZzzuhur
  • 184. 185Bil Simpulan Bahasa Makna1 Ada gaya Ada ciri–ciri yang memperlihatkan kebolehannya2 Ada jalan Ada cara untuk menyelesaikan sesuatu perkara3 Ayam tambatanOrang yang banyak pengalaman dan menjadiharapan4 Bahasa istana Ragam bahasa istana5 Bahasa pasar Bahasa Melayu yang tidak betul tatabahasanya6 Berat sebelah Tidak adil7 Beri muka Memanjakan secara berlebihan8 Buah hati Kekasih, orang yang dicintai9 Campur tangan Terlibat dalam urusan orang lain10 Cari jalan Berikhtiar menyelesaikan sesuatu perkara11 Dalam tangan Sesuatu yang pasti akan dimiliki12 Darah daging Anak dan saudara-mara dari keturunan sendiri13 Durian runtuhMendapat keuntungan dengan tidak disangka-sangka14 Harga diri Maruah, Kehormatan diri15 Ikat perut Mengurangkan makan kerana kemiskinan16 Isi hati Perasaan atau apa-apa yang terfikir17 Jejak langkah Mencontohi perbuatan seseorang18 Juling air Juling sedikit19 Lepas tanganTidak bertanggungjawab atas sesuatu yang telahdilakukan
  • 185. 186Bil Simpulan Bahasa Makna20 Makan hatiBerasa sedih yang teramat sangat sehinggamerosakkan diri sendiri21 Naik angin, naik darah Terlalu marah22 Nyawa-nyawa ikan Hampir-hampir mati, Nazak23 Pasang telinga Mendengar dengan teliti24 Pekak badak Pura-pura tidak mendengar25 Putih tulang Mati26 Putih mata Kecewa kerana harapan tidak tercapai27 Serkap jarang Tuduhan yang dibuat tanpa usul periksa28 Telinga nipis Orang yang lekas marah29 Titik peluh Hasil usaha sendiri30 Tahi lalat Bintik hitam pada pakaian atau badan
  • 186. 187Bil Perumpamaan Makna1 Bagai bertepuk sebelah tangan Cinta tidak berbalas2 Bagai bulan jatuh ke riba Mendapat untung yang besar3 Bagai dihiris sembilu Sangat sedih4 Bagai duri dalam daging Sesuatu yang tidak menyenangkan hati5 Bagai itik pulang petangBerjalan sangat lambat dan berlenggang-lenggok6 Bagai kumbang putus tali Terlepas daripada kesengsaraan7 Bagai mencurah air di daun keladiTidak mahu mendengar nasihat atau ajaranorang8Bagai menatang minyak yangpenuhMemelihara anak dengan penuh kasihsayang9 Bagai murai tercabut ekor Orang yang suka bercakap banyak10 Bagai tikus membaiki labuOrang yang cuba membaiki sesuatu yangtidak diketahui tambah merosakkan11 Bagai melepaskan anjing tersepitMenolong orang yang tidak tahu membalasjasa12 Seperti cincin dengan permata Jodoh yang sesuai benar13 Seperti kaca jatuh ke batuHati yang hancur kerana amat berdukacita14 Seperti kacang lupakan kulit Orang yang tidak tahu mengenang budi15 Seperti kera dapat bungaOrang yang mendapat sesuatu yang tidakdapat digunakan16 Seperti pinang dibelah dua Sama cantik dan sama padan17 Seperti rusa masuk kampung Tercengang kehairanan
  • 187. 188Bil Bidalan Makna1 Indah khabar dari rupaPerkhabaran tentang sesuatu perkara yangdilebih-lebihkan.2 Nasi sudah menjadi buburPerbuatan yang telah terlanjur dan tidakdapat ditarik kembali.3 Ukur baju di badan sendiriMelakukan sesuautu hendaklah mengikutkemampuan sendiri.4 Sediakan payung sebelumhujanBerjaga-jaga sebelum ketibaan sesuatubencana.5 Masuk ke telinga kanankeluar di telinga kiriNasihat atau pelajaran yang tidakdimasukkan ke dalam ingatan.
  • 188. 189Bil Pepatah Makna1Berani kerana benar, takut keranasalah.Berani kerana berada dipihak yangbenar.2Hendak seribu daya, tak hendakseribu dalih.Kalau ada kemahuan, maka adajalan untuk melakukannya.Sebaliknya jika hati tidak mahu,maka ada saja alasan untuk tidakmelakukan sesuatu.Rujukan:1. Peribahasa Sekolah Menengah – Asiah Abdul Rahman (DBP)2. Kamus Peribahasa Bergambar.– Asraf, Rosnita Abdullah, Sunah Adam(Sasbadi)
  • 189. 190Bil Kata Hikmat Makna1 Masa itu emas Masa sangat berharga.2 Ilmu pelita hidup Ilmu pengetahuan.
  • 190. 191Bil. Perkataan Maksud Dalam Konteks Dokumen Standard1. aspek (aspék)segi, sudut, bahagian untuk diberikanperhatian dan sebagainya.2. ayat songsangsusunan ayat yang berlawan daripada pola biasa yangmana predikat mendahului subjek. (Rujuk tata bahasadewan muka surat 436 – 437)3. bahan grafikbahan yang memuatkan maklumat ataupaparan yang terdiri daripada lukisan,gambar rajah, simbol dan lain-lain untukmenyatakan atau menyampaikan idea4. bahan prosakarangan yang ditulis dengan bahasa biasa tidakberbentuk puisi.5. berbicara bercakap untuk mengemukakan pendapat6. berbual-bual berborak atau beromong7. bercerita bercakap, berbual mengisahkan sesuatu8. bertatasusila adat sopan santun dan budi pekerti yang baik9. bertutur bercakap atau berkata-kata10. deskriptif keterangan yang bertujuan memberi gambaran11. diftong (lin)gabungan dua bunyi vokal yang disebutdalam satu suku kata akibat perubahankedudukan lidah seperti ai, au dan oi.12. digrafdua huruf berturut-turut yang mewakilisatu bunyi seperti ng, ny, sy13. diksipemilihan dan penggunaan kata yang tepat danberkesan untuk mengungkapkan idea secara lisan danbertulis
  • 191. 192Bil. Perkataan Maksud Dalam Konteks Dokumen Standard14. ekstensif (éksténsif) luas liputannya.15. frasakumpulan kata yang membentuk unit –unit sintaksissesuatu klausa16.gerak lakutingkah laku atau gerak geri, perbuatan atau kelakuan17.grafik maklumat atau paparan yang terdiri daripada lukisan,gambar rajah, simbol dan lain-lain untuk menyatakanatau menyampaikan idea18.gramatis berasaskan atau mengikut prinsip-prinsip nahu atautatabahasa19.ideabuah fikiran, gagasan20.ideasampinganidea dalam bentuk huraian dan contoh bagi menyokongdan menerangkan idea utama21.idea utama buah fikiran yang penting menerangkan maksudkeseluruhan perenggan22. imaginatiftercipta daripada daya khayalan dan imaginasi ataudaya kreatif berasaskan khayalan23.jeda atauberjedaberhenti sebentar24.karanganberpandukarangan berpandu ialah satu penulisan karanganberdasarkan panduan guru atau murid bebasmengeluarkan idea dengan panduan atau batasanyang diberi25.karanganterkawalkarangan terkawal ialah segala isi dan bahasanyasedia terkawal oleh guru (menurut Salleh Akib,1975:135) atau susunan dikawal ketat dan sedikit-sedikit dipimpin ke arah karangan bebas
  • 192. 193Bil. Perkataan Maksud Dalam Konteks Dokumen Standard26. kata gelarani. gelaran kehormat yang diberi kerana jasaseseorang.ii. gelaran yang digunakan untuk merujukketurunan/taraf.iii. rujukan kehormat yang digunakan kepada gelarankehormat.27. klasifikasipenyusunan mengikut kelas atau susunan sistematik kedalam kumpulan menurut kriteria yang ditetapkan28. konsep pengertian am atau idea yang mendasari sesuatu29.kreatifmempunyai kebolehan mengembangkan sesuatu idea30. kritistidak dengan begitu sahaja menerima ataumempersetujui sesuatu (menimbangkan buruk baiknyaterlebih dahulu)31. melakar melukis rangka secara kasar32. memurnikanmembersihkan atau menulis semula perkataan, frasaatau ayat yang betul hasil daripada pengeditan33. menaakulhal membuat pertimbangan dan penilaian denganmenggunakan akal atau tinjauan akal atau membuatpertimbangan dengan logik34. menceritakanmengisahkan sesuatu kepada/mengkhabarkan/memberitahu/mengatakan35. mengajuk meniru36. mengecam kenal atau ingat sesuatu yang dilihat dan didengar37. mengeditmenyunting atau menandai kesalahan pada perkataan,frasa atau ayat
  • 193. 194Bil. Perkataan Maksud Dalam Konteks Dokumen Standard38.mengimlakmenyebut atau membaca supaya ditulis oleh orang lain39.mengujarkan mengatakan, mengucapkan, menuturkan ataumenyebutkan40. menjana ideamenghasil, melahirkan, mengeluarkan buahfikiran/idea.41.modulunit atau bahagian tersendiri yang lengkap dengankomponennya yang melaksanakan fungsi tertentu dandapat dirangkaikan dengan unit-unit lain dalam sesuatuyang lebih besar42.multimediapelbagai media seperti media cetak dan mediaelektronik atau bahan elektronik yang mengandungipelbagai media seperti animasi, data, suara, gerakandan sebagainya yang bersifat interaktif43. naratif cerita peristiwa atau pengalaman44. pandangananggapan, pendapat, tanggapan, fikiran pada sesuatuyang dilihat, dibaca dan didengar45. pendapatkesimpulan yang dibuat atau diperolehi daripadaberfikir pada sesuatu yang dilihat, dibaca dan didengar46.pendekatanmodularpendekatan yang mana kurikulumdistrukturkan kepada struktur yang lebihkecil yang dinamakan sebagai modul47. pengumuman pemberitahuan kepada orang ramai48. penilaianperbuatan menilai sesuatu untuk dijadikan ukuran ataubandingan.49. perasaanperihal merasa(i) dalam hati atau batin, hasil atauperbuatan merasa dalam hati atau batin, sentimensuka, minat, ingin tahu
  • 194. 195Bil. Perkataan Maksud Dalam Konteks Dokumen Standard50. pertautan ideapertalian atau perhubungan idea antara dua ayat ataudua perenggan51. pola ayatcontoh atau model ayat yang dibina atau rangka dasarayat. Terdapat 4 pola ayat dasar. (Rujuk tata bahasadewan muka surat 418 – 419)52. prinsipasas atau dasar yang menjadi pokok sesuatupemikiran, kajian, tindakan, atau hukum sesuatu teoridan lain-lain53. prosakarangan yang bertulis dengan bahasa yang biasabukan dalam bentuk puisi54. ramalan Sesuatu yang diramalkan, dugaan, telahan dan tekaan.55. respons reaksi56.soalanbercapahsoalan yang berpecah daripada sesuatu tumpuan57.soalanbertumpu soalan yang memerlukan jawapan yang bersifat objektifdan dinyatakan dalam teks58. transformasiperubahan bentuk atau sifat, rupa, keadaan dan lain-lain59.tulisanmekanis(mékanis)melakukan sesuatu tanpa perlu berfikir dan hanyameniru dan menyalin sahaja60. urutansusunan {kejadian) yang berturut-turut, susunan yangteratur, rentetan61. wacanaa. Unit bahasa yang melebihi batas ayat. Wacanaboleh terdiri daripada ayat, ceraian, dialog dansebagainya.b. kesatuan fikiran yang utuh dalam bentuk lisan atautulisan

×