• Share
  • Email
  • Embed
  • Like
  • Save
  • Private Content
184755ind
 

184755ind

on

  • 568 views

 

Statistics

Views

Total Views
568
Views on SlideShare
568
Embed Views
0

Actions

Likes
0
Downloads
6
Comments
0

0 Embeds 0

No embeds

Accessibility

Categories

Upload Details

Uploaded via as Adobe PDF

Usage Rights

© All Rights Reserved

Report content

Flagged as inappropriate Flag as inappropriate
Flag as inappropriate

Select your reason for flagging this presentation as inappropriate.

Cancel
  • Full Name Full Name Comment goes here.
    Are you sure you want to
    Your message goes here
    Processing…
Post Comment
Edit your comment

    184755ind 184755ind Document Transcript

    • Laporan Dunia UNESCO CLT.2009/WS/9 Berinvestasi dalam KeanekaragamanRingkasan Budaya dan DialogEksekutif Antarbudaya
    • Laporan Dunia UNESCO Pendahuluan 1Berinvestasi BAGIAN I – Keanekaragaman Budaya:dalam Apa Yang Dipertaruhkan? 5Keanekaragaman Bab 1 – KEANEKARAGAMAN BUDAYA Keanekaragaman budaya dalam dunia yangBudaya semakin global 6 Identitas nasional, agama, budaya dandan Dialog multi identitas 7 Prakarsa regional dan internasional terkaitAntarbudaya keanekaragaman budaya 8 Bab 2 – DIALOG ANTARBUDAYA Interaksi budaya 9 Stereotip dan intoleransi budaya 9 Tantangan dialog dalam dunia multikultur 9 Pemberdayaan 10 Ringkasan BAGIAN II – Beberapa Wahana Utama Keanekaragaman Budaya 11 Eksekutif Bab 3 – BAHASA Dinamika bahasa kini 12 Bahasa dan identitas 12 Tantangan dalam telaah dan revitalisasi bahasa 13 Multilingualisme, terjemahan, dan dialog antarbudaya 13 Bab 4 – PENDIDIKAN Relevansi metode dan konten pendidikan 15 Masyarakat pembelajar dan hak memperoleh pendidikan 16 Pembelajaran partisipatif dan kompetensi antarbudaya 17 Bab 5 – KOMUNIKASI DAN KONTEN BUDAYA Globalisasi dan tren media baru 18 Dampak komunikasi dan produk-produk budaya 19 Kebijakan yang mendorong keanekaragaman budaya 19 Bab 6 – DAYA KREASI DAN PASAR Kreasi seni dan ekonomi kreatif 20 Kerajinan dan pariwisata internasional 21 Keanekaragaman budaya dan dunia bisnis 22 BAGIAN III – Memperbarui Strategi Internasional Terkait Pembangunan dan Perdamaian 23 Bab 7 – KEANEKARAGAMAN BUDAYA: ASPEK UTAMA PEMBANGUNAN BERKELANJUTAN Pendekatan budaya dalam pembangunan 24 Persepsi mengenai kemiskinan dan pengentasan kemiskinan 25 Keanekaragaman budaya dan kelestarian lingkungan 26 Bab 8 – KEANEKARAGAMAN BUDAYA, HAK ASASI MANUSIA DAN PEMERINTAHAN DEMOKRATIS Keanekaragaman budaya dan hak asasi manusia yang diakui secara universal 27 Keanekaragaman budaya: Sebuah parameter kohesi sosial 28 Tantangan keanekaragaman budaya bagi pemerintahan yang demokratis 29 Kesimpulan 31 Rekomendasi 34
    • PendahuluanKeanekaragaman budaya mulai mendapat perhatian serius pada pergantian abad ini. Namunmakna sesungguhnya dari terminologi yang luas ini sering diartikan bermacam-macam danjuga berubah-ubah. Sebagian memandang keanekaragaman budaya sebagai sesuatu hal yangpositif karena bertujuan untuk berbagi kekayaan yang dikandung dalam tiap budaya di du-nia dan, oleh karenanya, menyatukan kita semua melalui berbagai proses pertukaran dan dialog.Sebagian yang lain menganggap perbedaan budaya mengakibatkan hilangnya rasa kemanusiaanyang kita miliki sehingga menjadi akar dari berbagai konflik. Anggapan kedua tersebut sekarangini menjadi semakin terbukti sejak globalisasi mengakibatkan peningkatan interaksi dan gesekanantarbudaya yang menyebabkan meningkatnya berbagai ketegangan, tarikan dan klaim yangterkait identitas, khususnya masalah agama yang dapat menjadi sumber perdebatan potensial. Olehkarena itu, yang menjadi tantangan mendasar adalah bagaimana menawarkan suatu visi yangkoheren mengenai arti keanekaragaman budaya yang dapat menjelaskan bagaimanahal itu dapat bermanfaat untuk aksi masyarakat internasional, dan bukan sebagai ancaman.Hal inilah yang menjadi tujuan utama dari laporan ini.Sejak awal UNESCO telah diyakinkan akan pentingnya keanekaragaman budaya dan nilai-nilaiyang terkandung di dalamnya. Dalam Konstitusi UNESCO (1945) tertulis ‘keanekaragamanbudaya dunia yang saling memberi manfaat’ (‘fruitful diversity of the world’s cultures’). Pendapatini masih sangat relevan di masa kini dan selamanya, meskipun definisi budaya telah menjadisemakin luas dan pengaruh globalisasi telah mengubah banyak hal, dibandingkan pada saatKonstitusi tersebut disahkan pada tahun 1945 pada akhir Perang Dunia Kedua.Laporan Dunia UNESCOSelaras dengan pendapat UNESCO mengenai pentingnya ‘keanekaragaman budaya dunia yang salingmemberi manfaat’ dan nilai-nilai yang terkandung di dalamnya, sebagaimana tercantum dalamKonstitusi UNESCO (1945), beberapa tujuan dari Laporan Dunia tentang Keanekaragaman Budaya adalah: untuk menganalisa keanekaragaman budaya dari segala aspek dengan mencoba menunjukkan kerumitan proses terjadinya sekaligus juga berupaya mengidentifikasi benang merah dari berbagai macam interpretasi yang mungkin; untuk menunjukkan pentingnya keanekaragaman budaya dalam berbagai bidang (bahasa, pendidikan, komunikasi dan kreativitas) yang walaupun memiliki fungsi intrinsik yang berbeda-beda, namun dapat dianggap penting untuk perlindungan, pelestarian, dan promosi keanekaragaman budaya; dan untuk mengajak para pengambil keputusan dan pemangku kepentingan agar memahami pentingnya berinvestasi dalam keanekaragaman budaya sebagai aspek penting dalam dialog antarbudaya, karena hal ini dapat memperbarui berbagai pendekatan kita terhadap pembangunan berkelanjutan, memastikan terlaksananya hak asasi manusia secara efektif dan kebebasan yang diakui secara universal, serta memperkuat kohesi sosial dan pemerintahan yang demokratis. Seorang pendetaberpakaian tradisional,Osaka, Jepang Bagian depan sebuah tokokecil di Naivasha, Kenya
    • 2 . BERINVESTASI DALAM KEANEKARAGAMAN BUDAYA DAN DIALOG ANTARBUDAYALaporan Dunia ini bertujuan untuk representasi keanekaragaman tertentu berlangsungmempertimbangkan berbagai pandangan baru yang terus tanpa batas waktu. Hal ini melandasimuncul dari pemikiran mengenai berbagai tantangan kemampuan untuk menerima dan menyikapikeanekaragaman budaya sehingga dapat perubahan budaya, sambil tidak menganggapnyamenentukan berbagai pendekatan baru untuk sebagai ketentuan nasib. Laporan dari Komisimemonitor dan membentuk berbagai perubahan yang Kebudayaan dan Pembangunan Dunia jugasedang terjadi. Dengan demikian, Laporan Dunia ini berargumen yang kira-kira sama bahwatidak bertujuan untuk memberikan berbagai keanekaragaman budaya bukan hanya merupakansolusi yang siap pakai untuk memecahkan berbagai sebuah aset yang perlu dilestarikan namunmasalah yang membebani para pengambil keputusan. merupakan sumber daya yang harus dipromosikan,Namun, lebih bertujuan untuk menyoroti kerumitan dengan mempertimbangkan potensinya di berbagaidari masalah ini, yang tidak bisa diatasi dengan bidang, termasuk dalam bidang-bidang yangkeinginan politis semata, melainkan dengan secara relatif jauh dari bidang budaya dalammengajak untuk lebih memahami fenomena pengertiannya yang kaku. Laporan ini berupayadibaliknya dan kerjasama internasional yang lebih mengembangkan pemikiran berdasarkan berbagaibesar, terutama melalui pertukaran praktik-praktik kesimpulan utama laporan terdahulu.terbaik dan menyepakati panduan bersama. Dalam beberapa tahun ini, berbagai argumentasi yangLaporan Dunia ini juga tidak akan memberikan suatu dikembangkan oleh UNESCO terkait pemikirannyainventori global tentang keanekaragaman budaya, mengenai keanekaragaman budaya telahyang dibuat berdasarkan beberapa indikator yang diadopsi dalam sejumlah besar program danada dalam Laporan Pengawasan Global Pendidikan badan-badan di Perserikatan Bangsa-Bangsa danuntuk Semua UNESCO (Education for All (EFA) Global institusi Bretton Woods. Bank Dunia, contohnya, dalamMonitoring Report). Meskipun di dalam Laporan beberapa kesempatan mengikuti kepeloporanDunia ini terdapat satu Lampiran Statistik berupa 19 UNESCO dalam konteks Dekade Kebudayaan dantabel berisi hal yang menyangkut kebudayaan dan Pembangunan Dunia (1988–1997) dalam pencariannyasatu bab yang hanya berisi berbagai metodologi akan keterkaitan antara budaya dan pembangunan.pemikiran yang berhasil dikumpulkan melalui Program Pembangunan Perserikatan Bangsa-Bangsakerjasama dengan Institut Data Statistik UNESCO (UNDP) dan Program Lingkungan Hidup Perserikatan(UIS) di Montreal, namun pengembangan Bangsa-Bangsa (UNEP) juga telah mempublikasikanberbagai indikator di bidang keanekaragaman beberapa laporan penting. Selanjutnya, Laporanbudaya barulah mencapai tahap awal. Untuk Kelompok Tingkat Tinggi untuk Aliansi Peradabantujuan-tujuan inventori semacam itu, perlu telah menempatkan pentingnya berbagai inisiatifdilaksanakan suatu telaah sungguh-sungguh yang mempromosikan dialog antara orang,tentang keanekaragaman budaya yang mencakup budaya dan peradaban yang belum pernah diposisikanseluruh dunia, dengan persetujuan dari Negara sepenting itu sebelumnya. Laporan ini jugaAnggota UNESCO. Hal ini merupakan suatu tugas bertujuan untuk berkontribusi kepada pemikiranbesar yang membutuhkan sumber-sumber dayayang lebih dari yang diperlukan bagi laporan ini,namun hal itu dapat suatu saat dilakukan olehsebuah badan Observatorium Dunia untukKeanekaragaman Budaya (World Observatory onCultural Diversity), yang pembentukannya menjadirekomendasi laporan ini.UNESCO berharap dengan cara ini dapat turutberperan dalam pembaruan pemikiran tentangkeanekaragaman budaya yang kini sedang terjadi,selaras dengan kerjanya pada 1950-an dan berbagaikesimpulan dalam Our Creative Diversity(Keanekaragaman Kreatif Kita) yang merupakanlaporan dari Komisi Kebudayaan dan Pembangunan Papan iklanDunia (1996). Dalam naskah yang berjudul Race mengiklankan operatorand History (Manusia dan Sejarah) yang ditulis telepon genggam diuntuk UNESCO pada 1952, ahli antropologi Perancis Nigeriabernama Claude Lévi-Strauss berargumentasi bahwaperlindungan terhadap keanekaragaman budaya Festival Berber di Gurunseharusnya tidak hanya terbatas padamempertahankan status quo namun Sahara, Maroko Selatan‘keanekaragaman itu sendirilah yang harus Tenunan perempuandiselamatkan, bukan bentuknya yang tampakmaupun representasi budaya yang selama ini Zápara, Ekuador atau Peruditampilkan dalam setiap periode’. Dengan demikian,perlindungan keanekaragaman budaya berarti Pria Pasifik Selatanmemastikan bahwa keanekaragaman tersebut akanterus ada, dan bukan berarti bahwa suatu keadaan/
    • PENDAHULUAN . 3 dan penelitian terhadap program-program dari rekanan dan badan-badan UNESCO, terutama yang terkait dengan pembangunan. Apakah keanekaragaman budaya? Keanekaragaman budaya tak lain merupakan suatu fakta tentang keberadaan begitu banyak ragam budaya yang berbeda satu sama lain, yang dapat dibedakan berdasarkan pengamatan etnografis. Kesadaran adanya keanekaragaman tersebut semakin terasa di masa kini berkat komunikasi global dan meningkatnya kontak antarbudaya. Walaupun kesadaran yang semakin besar bukan merupakan jaminan atas kelestarian keanekaragaman budaya, namun hal tersebut menjadikan topik ini semakin mengemuka. Keanekaragaman budaya semakin menjadi masalah sosial yang besar, terkait dengan semakin tumbuhnya keanekaragaman aturan sosial di dalam dan di antara masyarakat (yang berbeda). Ketika berhadapan dengan keanekaragaman aturan dan tampilan tersebut, Negara terkadang bingung dalam bagaimana menyikapi atau menempatkan keanekaragaman budaya sebagai kepentingan bersama. Untuk dapat menanggapi secara spesifik situasi seperti ini, laporan ini berupaya menyediakan suatu kerangka kerja berdasarkan pemahaman terkini akan berbagai tantangan yang terkandung dalam keanekaragaman budaya, dengan mengidentifikasi beberapa kendala teoretis dan politis yang tak terpisahkan darinya. Satu kesulitan yang pertama adalah terkait dengan sifat khusus budaya dalam bentuk keanekaragaman ini. Banyak kalangan yang meninjau keanekaragaman melalui beragam bentuk representasi budaya, khususnya karakterisasi etnis dan bahasa, untukKeanekaragaman memahami budaya mereka yang heterogen. Tantangan yang pertama adalah meneliti berbagaibudaya tidak kebijakan yang terkait tanpa melupakan topik yang sesungguhnya, yaitu keanekaragaman budaya danhanya merupakan bukan representasinya yang terkadang melemahkan. Salah satu solusinya adalah dengan mengadopsiaset yang harus definisi budaya yang paling luas, yang sejalan dengan kesepakatan UNESCO dalam Deklarasi Mexico Citydilindungi namun tentang Kebijakan Budaya 1982, yang mendefinisikansumber daya budaya sebagai ‘perpaduan menyeluruh dari berbagai fitur spiritual, material, intelektual, dan emosionalyang harus yang masing-masing memiliki karakter tersendiri yang membedakan suatu masyarakat atau kelompokdipromosikan... sosial’ termasuk di dalamnya ‘tidak hanya seni dan huruf, tetapi juga cara-cara hidup, hak-hak asasitermasuk di manusia, sistem nilai, tradisi, dan kepercayaan’. Definisi ini memiliki kelebihan karena tidak mengadopsiwilayah yang definisi budaya yang terlalu sempit maupun yangjauh dari hanya memusatkan perhatian pada aspek tertentu saja (misalnya: agama) dalam upaya mendefinisikan budaya.budaya dalam Kesulitan yang lain adalah terkait pengidentifikasianpemahamannya bagian-bagian dari keanekaragaman budaya. Terkait dengan hal ini, terminologi ‘budaya’,yang kaku ‘peradaban’, dan ‘masyarakat’ memiliki konotasi yang berbeda tergantung dari konteks, contohnya konteks ilmu pengetahuan atau politik. Apabila ‘budaya’ mengacu pada entitas yang cenderung tidak bisa lepas dari hubungannya dengan manusia lain,
    • 4Yang diperlukanadalahpendekatan baruterhadapkeanekaragamanbudaya yangmementingkansifat dinamisnyadan berbagaitantanganidentitas dikaitkandenganperubahanbudaya Papan iklan di jalan rayaSuva, Fiji terminologi ‘peradaban’ mengacu pada budaya-budaya Pemikiran ini condong pada suatu pendekatan yang sepakat bahwa nilai-nilai atau pandangannya baru atas keanekaragaman budaya yaitu terhadap dunia adalah universal dan mengadopsi pendekatan yang memberi perhatian pada sifat pendekatan ekspansionis terhadap mereka yang dinamis dan tantangan dari identitas yang tidak (atau belum) memeluk pemahaman yang sama. diasosiasikan dengan sifat permanen dari Oleh karena itu, upaya untuk mempersatukan berbagai perubahan budaya. Hal ini perlu diikuti oleh pusat peradaban yang berbeda untuk hidup perubahan besar peran UNESCO dalam situasi tersebut. berdampingan secara damai merupakan suatu Berhubung perhatian Organisasi ini selama ini lebih tantangan yang tidak mudah. Sebagaimana tertuju pada perlindungan dan pemeliharaan situs, dicetuskan oleh UNESCO, ‘peradaban’ perlu dipahami praktik, dan ekspresi budaya yang terancam punah, sebagai sesuatu yang masih berjalan, sebagai maka kini Organisasi ini harus belajar mempertahankan akomodasi dari tiap kebudayaan di dunia, yang perubahan budaya dalam rangka membantu individu berlandaskan kesetaraan, di dalam proyek universal dan kelompok mengelola keanekaragaman secara yang sedang berjalan. Hal ini sama sekali berbeda lebih efektif. Yang menjadi tantangan terbesarnya dengan pemikiran dari berbagai bentuk ideologi adalah: mengelola keanekaragaman. yang meramalkan ‘benturan peradaban’. Kesulitan ketiga adalah terkait hubungan berbagai kebudayaan yang terus berubah. Diperlukan hampir lebih dari tujuh dekade dalam abad ke-20 sebelum kebudayaan mulai dipahami sebagai sesuatu yang terus berubah. Sebelumnya, ada kecenderungan untuk memandangnya sebagai sesuatu yang tidak berubah, dimana konten budaya ‘diturunkan’ dari satu generasi ke generasi berikutnya melalui berbagai cara, seperti pendidikan atau berbagai jenis kegiatan pengenalan. Kini, kebudayaan semakin dipahami sebagai suatu proses dimana masyarakat perlahan mengalami perubahan di jalur yang khusus diperuntukkan bagi mereka. Konsep perbedaan digambarkan secara tepat oleh dinamika tersebut, dimana budaya berubah namun juga tetap sama. Yang diperlukan selanjutnya adalah menentukan berbagai kebijakan yang menempatkan ‘perbedaan budaya’ pada sisi positif sehingga kelompok dan individu yang Seorang pria sedang saling berhubungan memahami bahwa dalam Sekelompok perempuanmemainkan terompet dikawasan kota tua , New ‘perbedaan’ ini perlu adanya suatu dorongan untuk sedang berlatih tarianOrleans, Amerika Serikat terus berevolusi dan berubah serta tidak menutup diri. tradisional di Shanghai, Cina
    • BAGIAN I :Keanekaragamanbudaya:Apa yangdipertaruhkan?Dalam konteks globalisasi danmeningkatnya migrasi dan urbanisasi,tantangan yang saling terkait dalammelindungi identitas budaya,melestarikan keanekaragamanbudaya, dan mempromosikan dialogantarbudaya menjadi semakin pentingdan mendesak. Laporan Dunia inidiawali dengan melihat danmempertimbangkan berbagaidampak dari proses globalisasi yangsemakin cepat terhadap berbagaibentuk keanekaragaman budaya,dengan menyoroti bagaimanaberbagai dorongan yang homogenbertemu dengan berbagai macamtren. Laporan ini juga menelaah peranpenting dari dialog antarbudayadalam menjembatani berbagaiperbedaan budaya, yang secarabersamaan juga memeliharakeanekaragaman berbagai ekspresibudaya melalui berbagai prosesinteraksi, saling dukung, danmemberdayakan satu sama lain.
    • 6 . BAGIAN I  KEANEKARAGAMAN BUDAYA: APA YANG DIPERTARUHKAN? Bab 1: Keanekaragaman tertanam begitu dalam dan kebanyakan tidak tergapai oleh bermacam pengaruh dari luar. Dengan budaya pertimbangan tersebut, sebaiknya globalisasi dipandang sebagai suatu proses multidimensi dan Perkembangan komunikasi dan jaringan informasi, multiarah yang melibatkan aliran segala macam peningkatan permasalahan ekonomi nasional, hal (modal, komoditas, informasi, ide, kepercayaan, perkembangan pasar transnasional dan semakin manusia) yang semakin kencang dan meningkat meluasnya berbagai bentuk hubungan antarbudaya di sepanjang aksis yang terus-menerus menciptakan berbagai tantangan baru bagi berubah secara perlahan. keanekaragaman budaya. Secara umum, globalisasi pertukaran internasional Keanekaragaman budaya dalam dunia yang mengarah pada integrasi berbagai pertukaran semakin global multikultural di hampir semua konteks nasional, Sementara erosi budaya menjadi masalah yang yang menghubungkan dan menumbuhkan tren semakin menjadi sorotan dunia mengingat dampak menuju beraneka ragam afiliasi budaya dan suatu yang muncul dari berbagai paradigma Barat yang ‘pembauran kompleks’ identitas-identitas budaya. dipengaruhi teknologi, hubungan antara globalisasi Namun demikian, berbagai dampak negatif dari dengan standardisasi dan homogenisasi budaya dorongan globalisasi terhadap keanekaragaman seringkali berlebihan. Transfer barang dagang dan praktik-praktik budaya tidak dapat diabaikan. budaya selalu melibatkan proses-proses adaptasi dan biasanya tidak terjadi secara unilateral di dalam Salah satu efek utama dari globalisasi adalah suatu lingkungan internasional yang semakin melemahnya hubungan keterkaitan antara satu kompleks dan interaktif. Terlebih lagi, akar budaya fenomena budaya dan lokasi geografisnya dengan membawa berbagai kegiatan, pengaruh, dan pengalaman dari lingkungan luar ke lingkungan kita sendiri. Dalam beberapa kesempatan, melemahnya hubungan tersebut dipandang sebagai sumber peluang, sedangkan dalam kesempatan lain, dipandang sebagai hilangnya kejelasan dan identitas. Fenomena yang juga terjadi secara bersamaan adalah pertumbuhan migrasi internasional, yang dalam beberapa kasus mengarah pada berbagai ekspresi budaya yang unik dan menarik, yang memperlihatkan bahwa keanekaragaman sedang terjadi. Pertumbuhan angka wisatawan internasional merupakan fenomena lain yang berdampak besar terhadap keanekaragaman budaya. Biarpun pariwisata semacam itu serba lengkap dan konsekuensinya terhadap penduduk setempat bermacam-macam, namun pengaruhnya dalam hal menambah pengetahuan dan pemahaman tentang lingkungan dan praktik budaya yang beragam tampak positif. Berbagai kontak antarbudaya yang semakin meningkat juga mengakibatkan peningkatan berbagai bentuk baru keanekaragaman budaya dan Penenun di Pulau Taquile, praktik-praktik bahasa yang terutama disebabkanDanau Titicaca, Peru oleh kemajuan teknologi digital. Oleh karena itu, dibanding mencoba untuk melindungi Alunan polifonik suku keanekaragaman dalam segala bentuknya, sebaiknyaAka Pygmies di Afrika yang menjadi fokus adalah bagaimana menerapkanTengah strategi baru yang mempertimbangkan berbagai perubahan tersebut sambil memberdayakan penduduk yang rentan untuk ‘mengelola’ perubahan budaya secara lebih efektif. Setiap tradisi yang masih dipraktikkan akan terus menerus mengalami Sekelompok wisatawan di depan Giza Sphinx di Mesir
    • Keanekaragaman budaya Bab 1 : K E A N E K A R A G A M A N B U D AYA . 7perubahan. Keanekaragaman budaya, sebagaimana budaya seringkali terbentuk dari berbagai sumber; Lantunan senandunghalnya identitas budaya, terkait erat dengan semakin luwesnya identitas budaya tercermin pada Hudhud Suku Ifugao diinovasi, kreativitas, dan keterbukaan pada semakin kompleksnya aliran manusia, barang, dan Filipinapengaruh-pengaruh baru. informasike berbagai penjuru dunia. Dalam suatu lingkungan multikultur, sekelompok orang akan Seorang nenek di Surgut, memilih untuk mengadopsi bentuk identitas tertentu, RusiaIdentitas nasional, agama, budaya, dan multi sekelompok yang lain memilih hidup di dua bentukidentitas identitas, dan sisanya menciptakan identitas campuran.Pertanyaan mengenai identitas – baik identitas nasional, Banyak penulis masa kini tertarik pada tema migranbudaya, etnik, bahasa, berdasar gender, berdasar yang dihadapkan pada suatu lingkungan budaya barukonsumen, dll. – sekarang menjadi begitu penting dan mendapat tantangan menciptakan identitas budayabagi individu dan kelompok yang memandang baru bagi dirinya. Semakin tersamarnya batas-batasglobalisasi dan perubahan budaya sebagai ancaman dalam konteks globalisasi memberikan angin segaratas kepercayaan dan cara hidup mereka. Ketegangan bagi jiwa nomadik yang dapat dianggap sebagaiyang semakin memuncak terkait identitas, yang cakrawala baru eksperimentasi budaya masa kini. Ada kecenderunganseringkali merupakan hasil dari kulturalisasi klaimpolitik, bertolak-belakang dengan kecenderungan umum ke arahyang lebih umum yaitu munculnya berbagai identitas dinamikayang dinamis dan memiliki banyak sisi. Aktivitas politikterkait identitas agama bisa menjadi penanda kuat dan identitas yangadanya identitas dan perbedaan budaya. Dalamkonteks ini, terdapat risiko adanya penghujatan memiliki banyakterhadap agama yang dijadikan alat untuk mencapai sisi dalam kontekstujuan politik dan agenda lain. Hal tersebut berpotensimemicu konflik antar agama dan perpecahan di globalisasi, yangdalam masyarakat yang demokratis. Ada suatu mendukung padakecenderungan untuk menyamakan keanekaragamanbudaya dengan keanekaragaman budaya nasional. kemunculan jiwaNamun identitas nasional dalam batasan tertentumerupakan suatu konstruksi, yang kadang yang nomaden Tetua suku Aboriginbagian-bagiannya terbentuk berdasarkan apa yang menggunakan teleponterjadi di masa lalu dan adanya rasa kesamaan dalam genggam, Australia Tengahdiri kita. Dalam dunia yang semakin global, identitas
    • 8 . BAGIAN I  KEANEKARAGAMAN BUDAYA: APA YANG DIPERTARUHKAN? Prakarsa regional dan internasional hanya sebatas ekspresi-ekspresi material/berwujud Dalam dunia yang semakin ditandai oleh pembauran atas keanekaragaman budaya dunia tetapi juga antarbudaya, berbagai upaya untuk melindungi manifestasi warisan budaya takbenda yang berbagai bentuk keanekaragaman budaya menjadi mencakup tradisi oral, seni pertunjukan, dan demikian penting bagi pemerintah nasional dan juga pengetahuan tradisional. Bersamaan dengan itu, masyarakat internasional. Dalam beragam bidang terjadi pergeseran penekanan dari sekedar budaya (seperti: warisan budaya benda, warisan pencantuman suatu properti/situs yang memiliki budaya tak-benda, ekspresi budaya, pertukaran ‘nilai universal yang istimewa’ (Outstanding budaya, dan perdagangan benda budaya secara Universal Value) dalam Daftar Warisan Dunia, ilegal), berbagai kesepakatan dan peraturan/acuan kepada upaya untuk memberikan pengakuan di tingkat regional dan internasional telah disusun atas contoh-contoh terbaik warisan budaya sebagai upaya untuk melindungi dan mempromosikan takbenda yang mencerminkan identitas para beberapa pemahaman kunci mengenai praktisinya dan kemampuan warisan budaya keanekaragaman budaya dan penanda identitas takbenda tersebut untuk terus ada (keberlanjutan). budaya. UNESCO, sebagai satu-satunya badan PBB Perkembangan ini mencerminkan dua pergerakan. yang memiliki mandat dalam bidang kebudayaan, Yang pertama mengarah pada pemahaman telah memainkan peran utama dalam menyusun, tentang ‘warisan bersama’ (common heritage) dimana mempromosikan, dan mengimplementasikan banyak masyarakat internasional bersama-sama mengemban aturan dan kesepakatan terkait kebudayaan. tugas melindungi berbagai ekspresi dari warisan bersama umat manusia. Yang kedua mengarah pada Perkembangan yang berawal sejak Konvensi pemahaman tentang kekhususan budaya dimana Den Haag untuk Perlindungan terhadap Properti/ masing-masing manifestasi budaya harus dihargai Benda Budaya (1954), hingga Konvensi mengenai dan dianggap penting meskipun mereka dapat Cara-cara Pelarangan dan Pencegahan Impor, Ekspor, berubah dan keberadaannya mungkin hanya dan Pengalihan Kepemilikan Properti Budaya secara sementara. Seorang peminta-minta Ilegal (1970) dan Konvensi mengenai Perlindunganberlalu di depan iklan Warisan Budaya dan Alam Dunia (1972), Konvensi Suatu era baru dalam eksplorasi terhadap konsepjalanan di Athena, Yunani mengenai Perlindungan Warisan Budaya Bawah Air keanekaragaman budaya telah dimulai dengan (2001) serta Konvensi mengenai Perlindungan terhadap diadopsinya ‘Deklarasi Universal mengenai Warisan Budaya Takbenda (2003), mencerminkan Keanekaragaman Budaya’ (Universal Declaration on perluasan pemahaman yang demikian maju atas Cultural Diversity) pada tahun 2001 dan ‘Konvensi konsep warisan budaya. Konsep ini mencakup tidak mengenai Perlindungan dan Promosi Keanekaragaman Ekspresi Budaya’ (Convention on the Protection and Promotion of the Diversity of Cultural Expressions)Budaya merupakan dua hal, yaitu keanekaragaman yang diadopsi pada tahun 2005. Konvensi 2005 bertujuan untuk melestarikan berbagai kekhasankreatif yang berada dalam ‘budaya-budaya’ dan dorongan budaya sambil mempromosikan perkembangan-kreatif yang berada di pusat keanekaragaman ‘budaya-budaya’ nya dalam skala global melalui pertukaran dan komersialisasi. Tentu saja, budaya memiliki dua arti yang berbeda namun saling melengkapi. Pertama, budaya (dalam bentuk jamak) merupakan keanekaragaman kreatif yang ada dalam ‘budaya-budaya’ tertentu, dengan keunikan tradisi dan ekspresi mereka dalam bentuk benda dan takbenda. Kedua, budaya (dalam bentuk tunggal) mengacu pada suatu dorongan kreatif yang menjadi sumber keanekaragaman ‘budaya-budaya’ tersebut. Dua arti dari budaya – yang satu mengacu ke dalam diri sendiri, sedangkan yang lain mengacu ke luar dirinya – adalah saling berhubungan dan saling mempengaruhi serta memberi jalan untuk interaksi positif bagi semua orang dalam konteks globalisasi. Para imigran Afrika mengantri di pelabuhan Lampedusa sebelum diberangkatkan ke Sisilia, Italia
    • D I A LO G A N TA R B U D AYA . 9 Dialog antar budaya Bab 2: Berbagai proses globalisasi semakin meningkatkan Jembatan Mostar hubungan budaya, pinjam-meminjam budaya, dibangun kembali setelah dan pertukaran budaya secara sistematik. perang yang melanda Hubungan transkultural baru ini berpotensi untuk menjadi fasilitator yang sangat kuat atas terjadinya Bosnia dialog antarbudaya. Dengan mempertimbangkan berbagai kategori budaya dan mengakui berbagai sumber yang mempengaruhi terbentuknya identitas kita, hal ini membantu mengalihkan fokus kita dari ‘perbedaan’ ke arah kemampuan bersama untuk berkembang melalui berbagai interaksi. Kesadaran akan sejarah dan pemahaman akan aturan budaya merupakan hal penting untuk mengatasi masalah stereotip budaya dalam perjalanan menuju dialog antarbudaya.Bab 2: Dialog antarbudaya Stereotip dan intoleransi budayaDalam dunia dengan beragam budaya, penting Stereotip budaya, selain berfungsi memisahkanuntuk mengembangkan berbagai pendekatan satu kelompok dari kelompok asing ‘lain’, jugabaru untuk dialog antarbudaya yang melampaui mengandung risiko yaitu dialog dapat terhentibatas-batas dari paradigma ‘dialog diantara disebabkan oleh perbedaan dan perbedaan tersebutperadaban’. Pendekatan tersebut perlu mem- dapat menyebabkan intoleransi. Budaya-budayap e r t i mba n g k a n ba gaimana k ebudayaan- yang berasal dari tradisi peradaban yang berbedakebudayaan tersebut saling berhubungan satu sangat rentan terhadap mutual stereotyping.sama lain, kesadaran akan adanya kesamaan Karavan unta di Mingshabudaya dan tujuan bersama, dan bagaimana Berbagai ketegangan antarbudaya seringkali terkait Shan di Dunhuang, Cinamengidentifikasi tantangan yang akan dihadapi dengan berbagai konflik yang terjadi di masa lalu,ketika menengahi perbedaan budaya. beragam pemahaman akan kejadian di masa lalu, dan Tari Samba de Roda yang konflik nilai-nilai terutama nilai-nilai agama. Selama berasal dari Recôncavo diInteraksi budaya belum dikalahkan oleh keinginan untuk menguasai daerah Bahia, BrazilBudaya bukanlah entitas yang berdiri sendiri dan mendominasi, dialog tetap merupakan kunciatau statis. Salah satu tantangan mendasar untuk menyelesaikan pertikaian yang telah tertanamuntuk mengembangkan dialog antarbudaya adalah dan untuk mengubah berbagai ungkapan politikpandangan bahwa budaya itu sesuatu yang yang seringkali keji. Tantangan budaya yangsudah baku. Salah satu dari keberatan utama dihadapi setiap masyarakat yang multibudaya adalahatas pemikiran yang dilontarkan oleh Samuel bagaimana mendukung pengakuan, perlindungan,Huntington tentang ‘benturan peradaban’ (clash dan penghormatan terhadap keunikan budayaof civilizations) adalah bahwa pemikiran itu melalui pengakuan dan promosi nilai-nilai yangberlandaskan pada afiliasi masyarakat manusia dianut bersama secara universal yang munculsebagai suatu hal yang tunggal dan bukan dari interaksi yang saling mempengaruhi dariafiliasi yang jamak antara masyarakat manusia budaya-budaya yang unik tersebut. Dalam upayadengan masyarakat manusia yang lain. mengatasi tantangan ini, ketegangan antaraSelain itu, pemikiran ini juga gagal dalam berbagai identitas yang berbeda dapat menjadimemasukkan unsur ketergantungan dan interaksi kekuatan pendorong bagi pembaruan persatuanbudaya. Budaya, sebagaimana halnya individu, nasional berdasarkan pemahaman bahwa kohesihidup karena adanya hubungan satu dengan sosial merupakan integrasi dari berbagai komponenyang lain. budaya yang beragam.Percampuran budaya terjadi sepanjang sejarahdan hal ini terjadi melalui beragam bentuk dan Tantangan dialog dalam dunia multikulturcara seperti pinjam-meminjam dan pertukaran Dialog antarbudaya sangat tergantung padabudaya (Jalan Sutra) hingga penjajahan budaya kompetensi antarbudaya, yang didefinisikanmelalui peperangan, penguasaan, dan penjajahan. sebagai perpaduan antara berbagai kemampuan Umat Islam sedangBahkan dalam situasi ekstrem seperti perbudakan, yang diperlukan untuk berinteraksi secara wajar beribadah di Jakarta,pertukaran terjadi dimana proses tertentu dengan mereka yang berbeda dengan individu Indonesiaseperti enkulturalisasi terbalik tanpa disadari tersebut. Kemampuan ini pada dasarnya bersifatberasimilasi dengan budaya yang mendominasi. komunikatif, namun juga melibatkan upayaPengakuan atas hak-hak asasi manusia meninjau ulang pandangan dan pemahaman kitauniversal di masa kini memungkinkan kita tentang dunia; karena sesungguhnya bukanuntuk berpikir (setidaknya secara teori) bahwa budaya yang terlibat dalam proses dialog melainkanpertukaran budaya terjadi berlandaskan manusia sebagai individu dan kelompok, dengankesetaraan antara semua budaya di dunia. segala kerumitan dan komitmennya pada kelompok yang bermacam-macam. Hal yang menentukan kesuksesan dari dialog antarbudaya adalah
    • 10 . BAGIAN I  KEANEKARAGAMAN BUDAYA: APA YANG DIPERTARUHKAN?Dialog kemampuan dasar untuk mendengarkan, fleksibilitas memperlihatkan bahwa apa yang membedakan kognitif, empati, kerendahan hati, dan keramahan. kita juga dapat menyatukan kita, dalam perenunganantarbudaya mengenai ingatan sejarah bersama umat manusia.memerlukan Berdasarkan hal itu, dilakukanlah berbagai upayapemberdayaan yang bertujuan untuk menciptakan dialog dan Pemberdayaan empati di antara generasi muda dari budaya yang Promosi dialog antarbudaya menyatu secara signifikanbagi para peserta ber beda, melalui k egiata n s e k o la h da n dengan pendekatan ‘identitas beragam’. Dialogmelalui program-program pendidikan serta pertukaran yang seharusnya tidak dipandang sebagai penghilangan bersifat partisipasi budaya, seni, dan kegiatan jati diri melainkan sebagai proses untuk memahamipeningkatan olahraga. Seni dan kreativitas pada khususnya diri dari satu kerangka acuan ke kerangka acuan lain.kapasitas dan memperlihatkan begitu dalam da n luwe s nya Perlu adanya pemberdayaan bagi semua pesertaproyek-proyek/ hubungan antarbudaya serta bentuk saling dialog melalui pelatihan dan proyek-proyek yang memperkaya yang terkandung di dalamnya. Hal-hal mendukung proses interaksi tanpa penghilangankegiatan yang demikian juga membantu meningkatkan pluralisme identitas personal atau kolektif. Selain itu jugamendorong budaya. Demikian pula, latihan dan acara yang perlu adanya pengakuan tentang cara-cara melibatkan beragam suku bangsa seperti jejaring etnosentris dimana budaya umum seringkaliinteraksi tanpa ‘global city’, karnaval, dan festival budaya dapat berjalan dan menyediakan ruang bagi sistemmenghilangkan membantu melewati batasan wilayah dengan cara pemikiran yang mengakui bentuk pengetahuanidentitas personal terlibat dalam acara kumpul dan hiburan bersama ‘eksoterik’ dan ‘esoterik’. Sebuah contoh yang patut masyarakat. dicatat dalam hal ini adalah pemetaan komunitas,atau kolektif. yang sudah sangat berhasil dalam membantu memberdayakan penduduk asli dalam upayanya untuk mengembalikan hak-hak mereka atas tanah leluhur dan sumber-sumber daya serta menentukan nasib perkembangannya sendiri yang diakui dunia internasional. Sebuah kendala utama dalam mengakomodasi suara-suara baru dalam lingkup dialog antarbudaya adalah meluasnya subordinasi wanita dengan interpretasi tradisi budaya dan agama yang didominasi oleh kaum pria. Di berbagai konteks sosial, perempuan memiliki peran khusus dalam promosi keanekaragaman budaya, karena seringkali perempuan merupakan ‘pembawa nilai’ dalam menyampaikan secara turun-temurun bahasa, aturan etika, sistem nilai, kepercayaan agama, dan pola-pola sikap. Ketidaksetaraan gender adalah multiaspek dan bersinggungan dengan kesukuan, sosial, ekonomi, dan bentuk ketidaksetaraan lain. Kunci dari keberhasilan dialog antarbudaya dan antar agama terletak pada kesetaraan harga diri dari peserta dialog. Hal tersebut dapat terlaksana jika Musik polifoni, tarian Ingatan yang berbeda telah menjadi sumber dari terdapat pengakuan dan penghormatan terhadapdan ritual tradisional dari banyak perseteruan sepanjang sejarah. Walaupun berbagai bentuk pengetahuan dan cara-cara merekawilayah Shoplouk, Bulgaria dialog antarbudaya tidak diharapkan dapat berekspresi, adat, dan tradisi peserta serta upaya menyelesaikan semua konflik dalam lingkup politik, untuk membangun konteks budaya-netral untuk ekonomi, dan sosial dengan sendirinya, namun dialog yang memungkinkan masyarakat untuk Seorang pria di Niamey, melalui dialog dapat terbangun basis ingatan mengekspresikan diri mereka secara bebas.Nigeria bersama dengan cara mengakui kesalahan dan Hal ini terutama terjadi dalam hal dialog antar membuka perdebatan mengenai ingatan yang agama. Dialog antar agama merupakan aspek saling bertentangan. Pengemasan kisah sejarah penting dalam mencapai pemahaman internasional umum menjadi sangat penting dalam strategi dan penyelesaian konflik. Dialog antar agama yang mencegah konflik dan pasca konflik, untuk bertujuan untuk mendamaikan berbagai sudut meringankan luka dari ‘masa lalu yang masih pandang yang berbeda harus berupaya untuk membekas’. Komisi Kebenaran dan Rekonsiliasi memasukkan unsur pertukaran dalam berbagai Afrika Selatan dan proses-proses rekonsiliasi bentuknya, termasuk melalui jejaring lokal dan nasional di Rwanda merupakan contoh-contoh masyarakat informal, dan melibatkan rekanan baru, terkini dari aplikasi politik dengan strategi terutama penduduk asli, kaum perempuan, penyembuhan yang demikian. Pengemasan dan generasi muda. ‘tempat-tempat bersejarah’ – seperti Penjara Pulau Robben di Afrika Selatan, Jembatan Mostar di Bosnia dan Buddha Bamiyan di Afghanistan – juga
    • BAGIAN II:BeberapawahanautamakeanekaragamanbudayaMeskipun segala aktivitas manusia memilikidampak pada keanekaragaman budaya,prospeknya semakin menyatu dengan masadepan bahasa, pendidikan, komunikasi,dan isi budaya, serta kreativitas dan pasar.Keempat bidang ini dibahas lebih mendalamdalam empat bab berikut dengan tujuanuntuk mengidentifikasi kecenderungandan faktor yang berdampak pada kondisikeanekaragaman budaya dan memperbaikiagenda politik kita agar dapat mengikutikompleksnya kenyataan dunia di masa kini.
    • 12 . BAGIAN II  BEBERAPA WAHANA UTAMA KEANEKARAGAMAN BUDAYA Bahasa Inggris hanya terbatas pada tujuan tertentu, seperti transaksi dan komunikasi fungsional. Globalisasi juga telah mendorong berbagai pendekatan yang lebih plural dan beragam terhadap Bahasa Inggris. Hal ini memperlihatkan cara yang semakin kompleks dimana bahasa, identitas, dan hubungan saling berinteraksi dan bagaimana para penutur mengadaptasi berbagai bentuk bahasa warisan kepada konteks budaya baru dan untuk tujuan baru. Banyak masyarakat bahasa sekarang berpencar ke seluruh penjuru dunia melalui migrasi, ekspansi kolonial, perpindahan pengungsi atau pergerakan kaum profesional. Sejalan dengan begitu meningkatnya keterkaitan antara bahasa dan tempat, pola-pola komunikasi menjadi semakin be r a ga m , di ta n da i o le h pe rge s e r a n k o d e, multilingualisme, perbedaan penerimaan, dan kompetensi produktif pada bahasa atau dialek yang berbeda, serta ditandai oleh perpaduan kemahiran baik secara penuh, parsial, dan khusus. Dengan demikian, perluasan jejaring menggunakan telepon genggam, broadband internet, dan teknologi informasi dan komunikasi (ICTs) menciptakan bentuk baru interaksi antarmanusia pada skala dan fleksibilitas yang tidak terbayangkan, melintasi kota, bangsa, dan budaya. Hal ini pada gilirannya mendorong munculnya bentuk-bentuk dan praktik-praktik bahasa baru yang terkait dengan identitas budaya baru yang semakin memperlebar dan merubah batasan-batasan yang ada di ruang publik/privat dan Pendongeng di hadapan Bab 3: Bahasa aspek sosial, budaya, dan pendidikan.orang banyak di LapanganJemaa el-Fna di Marrakesh, Bahasa menjadi perantara pengalaman, intelektual, Bahasa dan identitasMaroko dan lingkungan budaya, alat untuk berhubungan Terlepas dari kompleksitas dunia masa kini, dengan kelompok manusia, sistem nilai, aturan sebagian besar bahasa tetap ‘sempit lingkup’ dan sosial, dan rasa memiliki kita, baik secara kolektif ‘spesifik terhadap budaya tertentu’. Bahasa maupun personal. Dari sudut pandang beradaptasi dengan lingkungan ekologis tertentu, keanekaragaman budaya, keanekaragaman seperti halnya makhluk hidup. Selain itu bahasa bahasa mencerminkan adaptasi kreatif kelompok juga memiliki catatan sejarah, seperti halnya artefak manusia terhadap perubahan fisik dan lingkungan budaya. Bahasa memiliki fungsi penting sebagai sosialnya. Dari sudut pandang ini, bahasa tidak penanda batas antara berbagai kelompok sosial hanya sebagai alat komunikasi namun juga yang berbeda; dan ketika suatu bahasa punah, mewakili bagian dari ekspresi budaya, pembawa identitas, nilai, dan pandangan dunia. Dinamika bahasa di masa kini Ahli bahasa percaya bahwa sebagian besar bahasa di dunia akan punah dalam abad ini. Setengah dari bahasa yang ada sekarang (diperkirakan antara 6.000 sampai 8.000 bahasa) dituturkan oleh kurang dari 10.000 orang, dan satu dari bahasa yang semacam ini dikatakan punah setiap dua minggu. Sementara pertumbuhan bahasa penghubung (Bahasa Inggris khususnya) yang dikaitkan dengan proses globalisasi memberikan dampak besar pada bahasa-bahasa dunia. Bahasa-bahasa bergeser dalam tanggapannya terhadap berbagai kondisi politik, sosial, ekonomi, dan budaya, dan berbagai efek dari globalisasi terhadap keanekaragaman bahasa jauh dari sederhana dan seringkali bertentangan. Dalam banyak contoh kejadian, perpindahan bahasa minoritas bukanlah kepada Bahasa Inggris melainkan Pendongeng cerita kepada bahasa-bahasa lawan dan dialek daerah. Halkepahlawanan, Kyrgyzstan ini memperlihatkan bahwa penyebaran penggunaan
    • BAHASA . 13jauh lebih sulit memulihkannya dibanding Pelestarian dan perlindungan terhadap bahasa-bahasa Bahasa bukan hanyapenanda identitas lain. Bahasa-bahasa dominan minoritas merupakan tanggung jawab bersamamemiliki daya tarik bagi penutur bahasa minoritas. masyarakat mayoritas dan minoritas. Masalah berfungsi sebagaiKaum muda pada khususnya cenderung meleburkan hak-hak bahasa masih menjadi perdebatan,identitasnya dengan menggunakan bahasa mayoritas sementara berbagai langkah untuk melindungi alat komunikasidalam berkomunikasi. Hal tersebut menjadi penyebab bahasa-bahasa minoritas tersirat dalam berbagaipunahnya banyak bahasa asli bersama dengan dokumen kesepakatan. Dewan Eksekutif UNESCO tetapi juga mewakilikeanekaragaman budaya yang dikandungnya setelah sedang memperdebatkan kelayakan dokumen komponenbeberapa generasi. Terlebih lagi, bahasa-bahasa kesepakatan mengenai acuan standar baru untuk Bahasa Bab 3:tradisional terhubung dengan ekosistem di sekitarnya, bahasa. Pada saat yang bersamaan juga mendasar yangsehingga kepunahannya kemudian berdampak mempertimbangkan apakah akan memusatkanpada keanekaragaman lingkungan dan ekologi. perhatian pada perlindungan terhadap hak-hak membentuk ekspresiDari sudut pandang ini, ada kebutuhan mendesak bahasa secara umum atau hanya terhadap bahasauntuk mengambil langkah-langkah melindungi kelompok-kelompok tertentu yang rentan. budaya, pembawadan mempromosikan bahasa setempat, sambilmendukung pelajaran bahasa pengantar yang Multilingualisme, penerjemahan dan dialog identitas, nilai,menawarkan akses kepada komunikasi dan antarbudaya dan cara pandangpertukaran informasi secara cepat. Multilingualisme (yaitu kemampuan berbicara menggunakan beberapa bahasa) memenuhi dua terhadap duniaTantangan meneliti dan merevitalisasi bahasa fungsi yaitu memfasilitasi komunikasi antara individuBanyak anggapan bahwa vitalitas bahasa merupakan dengan latar belakang budaya berbeda dan turutsuatu patokan keanekaragaman budaya. Anggapan ini melestarikan bahasa-bahasa yang hampir punah.muncul karena setiap aspek penting budaya manusia Penerjemahan berperan untuk menjembatani– dari klasifikasi kekerabatan hingga agama – tampak banyaknya bahasa yang sangat berbeda yang tidakbergantung pada bahasa untuk penyampaiannya. dapat dijembatani oleh multilingualisme.Namun bahasa tidak sama dengan budaya. Banyak Keduanya merupakan komponen penting dalamcontoh peristiwa dimana bahasa yang sama dituturkan suatu masyarakat pluralistik.oleh kelompok-kelompok yang tata cara budayadan pandangan tentang dunianya sangat berbeda. Multilingualisme di sekolah sudah dilaksanakan diBerbagai pendekatan tradisional dalam banyak negara, yang salah satu tujuan pendidikanmendokumentasi dan meneliti pergeseran bahasa nasionalnya adalah menjadikan kohesi sosial sebagaiselama ini masih berpusat pada linguistik dan salah satu prioritas dari investasi publik di bidangcenderung tidak memperhatikan konteks realita pendidikan. Kebijakan mengenai bahasa yangsosial-ekonomi dan politik. Namun demikian, mendukung multilingualisme, pelajaran bahasa,punahnya bahasa merupakan bentuk awal dari dan bahasa-bahasa yang hampir punahpengikisan budaya yang mengindikasikan terjadinyaproses lunturnya budaya dengan cepat. Berbagaikeadaan di seputar vitalitas bahasa dan prospekrevitalisasi jika bahasa dalam keadaan hampir punahsangat tergantung pada konfigurasi sosial-budaya,ekonomi, politik, dan sejarah unik yang terkandungdalam tiap bahasa. Alasan tersebut menampikanggapan dan analisa umum yang ada. Meskipunbanyak dari pendekatan terhadap revitalisasi danpelestarian bahasa minoritas mengakui danmenyatukan berbagai faktor ini, prosesnya masihsangat bersifat politis. Tentunya, perlindungan Jasa penerjemah danaktif terhadap bahasa yang hampir punah pengetikan di Hyderabad,dianggap bersaing dengan budaya dan nilaipenting dari bahasa yang menggantikannya. IndiaPunahnya bahasa bisa disebabkan oleh faktor luar(globalisasi, tekanan politik, keuntungan ekonomi,dll.) maupun dalam (memperlihatkan sikap negatifmasyarakat terhadap bahasa) atau, seringkali,kombinasi dari keduanya. Gengsi bahasa utama danyang banyak dipakai dalam kehidupan masyarakatluas dapat menyebabkan suatu masyarakatmemandang rendah bahasanya sendiri. Oleh karenaitu, revitalisasi bahasa sangat bergantung pada rasabangga masyarakat akan identitas budayanya sendiri.Teknologi informasi dan komunikasi terkini dapatmemiliki dampak positif terhadap upaya-upayarevitalisasi, terlebih lagi jika media turut sertadalam keseluruhan upaya tersebut.
    • 14 . BAGIAN II  BEBERAPA WAHANA UTAMA KEANEKARAGAMAN BUDAYA suatu bentuk perlindungan bahasa-bahasa asli dan bahasa-bahasa yang hampir punah. Di tingkat internasional, tujuan tersebut terbagi dalam dua pendekatan: 1) untuk melestarikan keanekaragaman bahasa dunia sebagai prasyarat bagi keanekaragaman budaya, dan 2) untuk mempromosikan multilingualisme dan penerjemahan (termasuk bidang administrasi, pendidikan, media, dan dunia maya) untuk mendorong dialog antarbudaya. Bab 4: Pendidikan Pendidikan sering dikaitkan dengan transmisi pengetahuan dan pengembangan perilaku dan keterampilan sosial yang pemahaman mengenainya seringkali diseragamkan. Pendidikan juga merupakan transmisi nilai, baik di generasi yang sama maupun antar generasi dan lintas budaya. Buku-buku Harry Potter merupakan hal penting bagi keberlanjutan Berbagai kebijakan di bidang pendidikanyang ditulis J.K. Rowling jangka panjang keanekaragaman budaya. berdampak besar terhadap berkembangnya ataudalam terjemahan Bahasa menurunnya keanekaragaman budaya. Oleh T i n g g i ny a k e t i d a k s e i m b a n g a n p e n y e b a r a n karena itu, kebijakan pendidikan harus berupayaItalia, Jerman, Spanyol, penerjemahan di seluruh dunia mencerminkan tidakKatalan, dan Czech mempromosikan pendidikan melalui dan untuk meratanya keterwakilan budaya, orang, dan bahasa di dunia. Data yang dikumpulkan oleh Index keanekaragaman. Hal ini menjamin hak atas Translationum menunjukkan bahwa 55 persen dari pendidikan dengan mengakui keanekaragaman seluruh buku terjemahan adalah merupakan kebutuhan para pelajar (terutama kelompok-kelompok terjemahan dari Bahasa Inggris, dibandingkan minoritas, asli, dan nomaden) dan dengan dengan 6,5 persen yang merupakan terjemahan mengintegrasikan keanekaragaman metode dan ke dalam Bahasa Inggris. Hierarki antara bahasa- isi yang saling berhubungan. Dalam masyarakat bahasa mayoritas dan minoritas menentukan multikultural yang semakin kompleks, pendidikan penyebaran terjemahan. Terjemahan dari dan ke harus membekali kita dengan kompetensi dalam bahasa asli jarang sekali ada. Ketika antarbudaya yang akan memungkinkan kita hidup terjemahan sastra mengalami penurunan, terjemahan teknik yang menggunakan Bahasa bersama dalam perbedaan budaya dengan tidak Inggris sebagai sumber bahasa utama di negara- saling membenci. Empat prinsip pendidikan negara industri besar mengalami peningkatan. Sistem penerjemah otomatis, yang juga semakinAda kebutuhan banyak, sebagian besar masih melayani bahasa mayoritas sebagai sumber atau bahasa yang disasar.untuk melindungi Mengingat pentingnya peran terjemahan dalam meningkatkan keanekaragaman budaya, hal inikeanekaragaman dapat dijadikan alasan untuk pengembangan kebijakan penerjemahan dalam skala global.bahasa dunia Secara umum, kebijakan dan perencanaan bahasasebagai prasyarat baru-baru ini saja menyesuaikan dengan berbagai perubahan sosial yang terjadi selama beberapakeanekaragaman dekade terakhir abad ke-20 ini. Untuk memastikan kelangsungan jangka panjang bahasa-bahasa dibudaya dan juga dunia, kita harus menemukan cara-cara baik untuk melindungi keanekaragaman bahasa denganmempromosikan melindungi dan merevitalisasi bahasa-bahasa danmultilingualisme dan mempromosikan multilingualisme dan terjemahan dengan membuat berbagai kebijakan di tingkat Tulisan pada papan dipenerjemahan untuk nasional yang mendorong penggunaan secara luar sebuah sekolah di Dar fungsional semua bahasa yang digunakan oleh Es Salaam, Tanzania.mendorong dialog masyarakat. Dua tujuan tersebut saling terkait karena peningkatan multilingualisme yangantarbudaya memasukkan pendidikan bahasa ibu merupakan
    • PENDIDIKAN . 15 berkualitas sebagaimana tertulis dalam laporan Komisi Dunia tentang Pendidikan untuk Abad ke-21 yaitu ‘belajar untuk menjadi’, ‘belajar untuk mengetahui’, ‘belajar untuk melakukan’ dan ‘belajar untuk hidup bersama’ hanya dapat berhasil dilaksanakan jika keanekaragaman budaya mendapat perhatian utama. Relevansi metode dan konten pendidikan Sebuah kurikulum yang dibuat berdasarkan proses standarisasi pembelajaran dan isi yang menggunakan pendekatan ‘pukul rata’ (one size fits all) tidak akan memenuhi kebutuhan seluruh peserta didik dan juga tidak akan merespon sesuai konteks latar-belakang kehidupan mereka. Hal ini menjadi semakin terlihat karena semakin banyak negara yang mencari jalur Pendidikan Bab 4: alternatif di dalam sistem pendidikan. Namun, informasi tentang bentuk pendidikan yang diajarkan di seluruh dunia dan bagaimana pendidikan tersebut berbeda di setiap (dan kadang di dalam) negara-negara, belum dikumpulkan dan dievaluasi secara sistematis. Demi pendidikan berkualitas, yang harus mencakup dua hal yaitu layak (dapat diterima secara budaya) dan fleksibel (dapat beradaptasi sesuai dengan perubahan dalam masyarakat), pengembangan kurikulum ditujukan untuk peningkatan pendidikan yang relevan dengan menyesuaikan proses belajar, isi pendidikan, pelatihan untuk guru, dan manajemen sekolah sesuai kebutuhan peserta didik. Hal ini mencakup pengembangan kurikulum multibudaya dan multibahasa, berdasarkan pada beragam perspektif dan pendapat dan mengacu pada sejarah dan budaya dari semua kelompok dalam masyarakat. Pendekatan yang peka terhadap keanekaragaman peserta didik juga harus siap dengan langkah-langkah khusus untuk menjangkau kelompok-kelompok yang rentan dan terpinggirkan dan untuk memperbaiki lingkungan sekolah dan pendidikan, khususnya untuk anak perempuan. Tujuan utamanya adalah pemberdayaanDi dalam masyarakat terkait penghormatan terhadap peningkatan hak-hak asasi manusia, peningkatan kewarganegaraanmultibudaya yang yang demokratis dan pelaksanaan pembangunansemakin kompleks, berkelanjutan. Mengembangkan pendidikan yangpendidikan harus bisa peka budaya tidak hanya memerlukan pakar bidang studi saja, tetapi para guru yang memilikimemampukan kita pengetahuan luas dan peka terhadap perbedaanmemperoleh kompetensi budaya. Keinginan untuk mempromosikan metode pengajaran yang relevan untuk seluruh pesertainterkultural yang akan ajar telah menyebabkan diversifikasi media danmembuat kita dapat metode pendidikan yang belum pernah terjadihidup bersama dengan Sekolah terbuka di sebelumnya, tidak terkecuali di sektor swasta, dan terkadang dalam kemitraan dengan LSM.saling menerima Omo Selatan, Ethiopiaperbedaan budaya kita Koridor sekolah dasar di Manfaat pendekatan multibahasa berbasis bahasa Hanoi, Viet Nam ibu di semua tingkat pendidikan formal dan non-formal dapat digambarkan oleh pendidikan dasar di sejumlah negara berkembang. Program-program pendidikan dwibahasa diterapkan di hampir seluruh
    • 16 . BAGIAN II  BEBERAPA WAHANA UTAMA KEANEKARAGAMAN BUDAYAkonteks pembelajaran dan dapat berperan penting (termasuk pengetahuan lokal dan tradisional), Kegagalan untukdalam meningkatkan kualitas pendidikan dan keyakinan pada teori-teori bebas-nilai danmemperluas kesempatan bagi kelompok marginal konseptualisasi tidak berkaitan dengan lingkungan memperhitungkandan kurang terlayani, termasuk penduduk pendatang. sosial tempat mereka tumbuh. Selama wacanaKetika sebagian besar negara mungkin masih arus utama pendidikan masih menganggap bentuk-bentuk darijauh dari mencapai tujuan mengajarkan bahasa ilmu pengetahuan bersifat universal, maka bentuknasional, lokal/daerah, dan internasional dalam pengetahuan ‘tradisional’ atau lainnya cenderung akan belajar yang tidakkurikulum resmi mereka (sebagaimana disorot terkotak-kotak. Namun demikian, strategi yangdalam suatu analisa mengenai jadwal dalam mempromosikan pengakuan atas bentuk-bentuk umum akan lebihpendidikan bahasa), tujuan ini sangat penting pengetahuan tradisional dan bahkan pengetahuan meminggirkanbaik untuk pelestarian keanekaragaman bahasa yang paling halus sekali pun dapat membuka jalanmaupun untuk fungsi intelektual lainnya. untuk pelestarian masyarakat yang rentan sambil populasi yang ingin memperluas ruang lingkup pengetahuan ‘mainstream’.Masyarakat pembelajar dan hak atas pendidikan diberdayakan melaluiPeningkatan hak atas pendidikan, sebagaimana Masyarakat internasional semakin menyadariditegaskan dalam prinsip-prinsip Pendidikan untuk bahwa cara-cara tradisional dan pragmatis dalam pendidikanSemua (Education for All / EFA), serta perlindungan pembelajaran dapat menjadi seefisien pendekatandan promosi keanekaragaman budaya menjadikan didaktik Barat. Pendongeng misalnya, adalahpluralisme sebagai suatu persyaratan penting penyumbang vitalitas budaya lisan, sementara strategipendidikan. Pluralisme bertentangan dengan melek aksara dapat menyebabkan devaluasi yang tidakkecenderungan sistem pendidikan untuk menjadi diinginkan terhadap budaya tersebut. Manfaat lainnya,sumber standardisasi. Kegagalan untuk pendidikan informal dan adat dapat berkontribusimemperhitungkan bentuk pembelajaran yang pada bentuk-bentuk pembelajaran yang lebihbukan merupakan mainstream atau arus utama partisipatif, yang tidak begitu bersifat analitis melainkan(misalnya kearifan lokal dalam mengelola sumber adaptif. Pendidikan memiliki banyak keuntungandaya), dipadukan dengan kendala pasar kerja, akan dari pendekatan belajar yang pluralistik yangberisiko semakin meminggirkan penduduk yang mengingatkan kita bahwa hak atas pendidikanmenjadi sasaran pemberdayaan melalui pendidikan. sejalan dengan hak para orang tua untukMeskipun pengakuan akan pentingnya ‘memilih jenis pendidikan yang akan diberikankeanekaragaman pengetahuan semakin meningkat kepada anak-anak mereka’ (UDHR, pasal 26). Seorang anak perempuan suku asli di kelas di High Orenoque, Venezuela
    • PENDIDIKAN . 17Pe m b e l a j a ra n p a r t i s i p a t i f d a n ko m p e t e n s iantarbudayaDalam masyarakat yang multibudaya salah satutantangan utama yang dihadapi pendidikan seumurhidup melibatkan kemampuan kita untuk belajaruntuk hidup bersama. Dengan demikian, pendidikanmultibudaya harus dilengkapi dengan pendidikanantarbudaya. Seni dan pendidikan humaniora,kegiatan multimedia, museum, dan wisata akanmembantu dalam mengembangkan keterampilanpenting yang sangat diperlukan untuk memerangipandangan yang bersifat sepihak, untuk beradaptasidengan lingkungan sosial dengan budaya beragamdan menanggapi tantangan dalam dialog antarbudaya.Mengajak orang untuk memahami keanekaragamanbudaya lebih merupakan masalah pendekatan, konten budaya Konunikasi dan Bab 5:metode, dan sikap daripada asimilasi isi. Toleransiharus dipraktikkan terlebih dahulu, sebelum dapatmenjadi suatu keahlian.Prinsip-prinsip utama UNESCO terletak pada keyakinanbahwa pendidikan merupakan hal yang fundamental Bab 5: Komunikasi dan Seorang murid di kelas sekolah Ferdeusi di Kabul,untuk mengatasi ketidaktahuan dan ketidakpercayaan konten budaya Afghanistanyang merupakan sumber konflik manusia. Berhubungprasangka didasarkan antara lain pada ketidaktahuan Ketika dunia secara perlahan berubah menjadikita atau prasangka yang salah, memfasilitasi budaya sebuah ‘desa global’, pemandangan yang meliputiketerbukaan adalah kunci untuk mendorong pers, buku, radio, televisi, bioskop, internet, dandialog antarbudaya dan mencegah ‘benturan berbagai macam perangkat digital memainkanketidakpedulian’. Humaniora dan ilmu-ilmu sosial peran besar baik dalam meningkatkan keberhasilanmendorong peserta didik untuk menyadari keanekaragaman budaya maupun dalamkeberpihakan mereka sendiri dan untuk merenungi membentuk selera, nilai-nilai, dan pandangankembali asumsi mereka. Masuknya agama-agama dunia kita. Seberapa jauh sarana-sarana ekspresidunia dan kepercayaan dalam kurikulum dapat tersebut dapat menerjemahkan realitas,membantu menghilangkan kesalahpahaman yang kompleksitas, dan dinamika keanekaragamandapat membuat hidup bersama menjadi bermasalah. budaya ini layak untuk dipertimbangkan.Seni merupakan alat yang kuat dan universal untuk Jenis-jenis media baru tanpa diragukan lagimeningkatkan saling pengertian dan perdamaian, dapat lebih memfasilitasi akses kita kepadadan mempraktikkan seni adalah cara yang ampuh keanekaragaman budaya, membuka peluang yanguntuk bersosialisasi dengan orang lain. Pengajaran lebih besar untuk dialog antar umat beragama, danseni membantu menghubungkan proses ilmiah danemosional dengan intuisi yang merupakan satukomponen penting untuk menanamkan sikap yangmenyukai keterbukaan antarbudaya.Pendidikan seni juga dapat membantu mengatasietnosentrisme, bias budaya, stereotipe, prasangka,diskriminasi, dan rasisme.Dengan demikian pengembangan kompetensiantarbudaya tidak hanya terbatas di dalamruang kelas saja melainkan harus meluas ke‘universitas kehidupan’. Sifat inklusif harus dipupukbaik di kelas maupun di lingkungan sekolahsecara umum, serta melalui keterlibatan orang tuadan masyarakat setempat.
    • 18 . BAGIAN II  BEBERAPA WAHANA UTAMA KEANEKARAGAMAN BUDAYA diversifikasi suara. Namun demikian, kesenjangan konglomerasi film besar (terkecuali Bollywood dan yang tersirat dari penggunaan media digital dapat industri film Perancis yang didukung secara nasional). membatasi kemungkinan terjadinya pertukaran Sebagian besar negara berkembang masih belum budaya secara murni. Selain itu, banyak dan dalam posisi secara penuh memanfaatkan kapasitas beragamnya pilihan media dan tantangan budaya kreatif mereka untuk pembangunan di sektor ini. yang dikandungnya dapat mendorong berbagai Saham Afrika dalam perdagangan global produk bentuk isolasi budaya. kreatif, misalnya, tetap marginal (kurang dari 1 persen dari ekspor dunia), meskipun banyak yang memiliki Globalisasi dan tren media baru bakat kreatif. Pada tahun 2006 media dan industri budaya menghasilkan lebih dari 7 persen PDB global dan Namun lansekap media global sedang berubah, bernilai sekitar US$1,3 triliun, atau hampir dua karena beberapa negara berkembang mulai muncul kali lipat total penerimaan dari sektor pariwisata sebagai pengekspor peralatan budaya dan media internasional pada tahun itu (diperkirakan US$680 serta pembuat konten, berkontribusi terhadap apa milyar). Pada 1990-an di negara-negara yang yang disebut ‘menangkal arus’. Ekspor peralatan media tergabung dalam OECD (Organisasi untuk dan budaya negara-negara berkembang meningkat Kerjasama Ekonomi dan Pembangunan), pesat antara 1996 dan 2005 sebagai akibat dari ekonomi dan budaya kreatif pada tingkat strategi untuk meningkatkan daya saing global dan tahunan tumbuh dua kali lipat dari industri jasa bertambahnya permintaan untuk alat komunikasi. dan empat kali lipat dari industri Tren ini memfasilitasi munculnya pasar lokal untuk manufaktur. Beberapa tahun terakhir ini menjadi konten media, meskipun pasar masih cenderung saksi bagaimana konsentrasi kekuasaan berada di di tingkat lokal karena keterbatasan teknologi dan tangan beberapa perusahaan multimedia kesulitan distribusi. Kemudian, peningkatan transnasional dan sejumlah pemain media global. ekspor media oleh masyarakat industri baru, Dalam hal media cetak dan rekaman, pasar ekspor munculnya pusat-pusat media baru di kawasan didominasi oleh negara-negara OECD. Tren serupa regional, mendunianya sektor audio-visual Amerika mengenai asal pembuatan konten dapat ditemui Latin (telenovela) dan kebangkitan jaringan di sektor radio, televisi, dan film. Dalam hal bioskop, berita pan-regional/internasional merupakan tanda- kecenderungan umum yang terjadi adalah bahwa tanda ‘globalisasi dari bawah’, yang menciptakan produksi nasional berjuang untuk bersaing dengan kesempatan baru bagi suara-suara alternatif (kaum film-film blockbuster yang diproduksi oleh minoritas, masyarakat adat, masyarakat diasporik Pemancar satelit televisidi luar rumah tradisional‘yurt’ di Mongolia
    • K O M U N I K A S I D A N K O N T E N B U D AYA . 1 9Peningkatan atau kelompok kepentingan khusus) untuk didengar. yang dirancang untuk menghilangkan stereotipe, Dengan demikian pembuatan konten komunikasi berbagai inisiatif melek media dan informasi dapatpenawaran isi dan budaya, serta pola penyebaran dan konsumsi, membantu para pemirsa untuk menjadi lebih kritis sedang menjalani perubahan yang signifikan, yang ketika mengkonsumsi media dan dapat membantumedia dapat ditandai dengan hubungan, interaksi, dan peleburan. untuk memerangi perspektif sepihak. Melek media Praktik-praktik baru dan konten baru mulai merupakan aspek penting dari akses media danmengarah pada bermunculan yang terkait dengan pengembangan dimensi penting pendidikan non-formal. Merupakan beberapa produk budaya, informasi, dan komunikasi suatu hal penting untuk mempromosikan hal‘keanekaragaman yang dapat diakses melalui internet, ponsel atau tersebut kepada masyarakat sipil dan mediayang semu’, menutupi alat semacam itu, yang memungkinkan munculnya profesional sebagai bagian dari upaya untuk struktur produksi kecil yang menargetkan pasar terus membina saling pengertian dan memfasilitasifakta bahwa mikro dan model baru penciptaan dan penyampaian dialog antarbudaya. konten (konten dibuat pengguna). Sejalan dengansebagian orang meningkatnya akses ke internet, Laman Web Dunia (World Wide Web) menunjukkan potensi Kebijakan yang mendorong keanekaragaman budayahanya berkomunikasi untuk memberikan dukungan signifikan bagi Berbagai kebijakan yang bertujuan untuk mendorong mereka yang berupaya untuk mengatasi tidak keanekaragaman budaya dalam komunikasi dan kontendengan mereka yang hanya ketidakseimbangan dalam kekuatan politik budaya berkontribusi terhadap berkembangnyamemiliki kesamaan dan ekonomi lokal dan global tetapi juga perpecahan pluralisme dan aliran bebas ide. Dengan demikian, di antara beragam kelompok masyarakat. keanekaragaman budaya harus menjadi inti mediabudaya sebagai yang berkualitas. Segmen besar populasi, seperti kelompok marginal dan etnis minoritas, sering kaliacuannya Dampak komunikasi dan produk-produk budaya tidak terwakili di media, sebagian karena kurangnya Berbagai peluang baru untuk melakukan pertukaran akses bagi mereka ke posisi editorial, manajerial budaya Komunikasi dan konten Bab 5: interaktif antara mereka yang terlibat dengan atau posisi penting lainnya dalam kantor media. latar-belakang budaya yang berbeda hadir dengan Mendorong adanya keanekaragaman internal di berbagai tantangannya sendiri. Namun demikian, ruang berita serta keanekaragaman latar belakang tantangan yang berkaitan dengan fragmentasi dan budaya dan gender dalam struktur media merupakan stereotip penikmat dan pengguna, perlu ditangani kebutuhan mendasar untuk memastikan melalui berbagai informasi dan media yang tepat. keanekaragaman dalam konten yang dihasilkan. Peningkatan pasokan konten media tidak selalu menghasilkan peningkatan keanekaragaman konsumsi. Dihadapkan pada pilihan yang semakin banyak, beberapa konsumen lebih memilih untuk membatasi diri pada sejumlah kecil judul atau tema yang akrab daripada mencari sesuatu yang tidak dikenal atau berbeda. Kesenjangan antar generasi yang signifikan mengemuka sebagai praktik-praktik baru konsumsi konten digital yang mengarah pada bentuk-bentuk baru jaringan sosial dan menantang para pelaku budaya tradisional, seperti sekolah dan keluarga. Pemirsa semakin dibentuk menjadi ‘penggemar’ atau ‘kelompok’ yang ‘anggota’nya hampir tidak berhubungan satu sama lain dan cenderung menolak cara berpikir yang lain. Hal ini mengarah pada Atap-atap di sebuah kota ‘keanekaragaman semu’, mengemas kenyataandi Afrika Utara bahwa beberapa orang tertarik untuk berkomunikasi hanya dengan orang-orang dengan kesamaan Seorang gadis berbicara referensi budaya.dengan wartawan Jermanmengenai kehidupannya Selain itu terbatasnya keterwakilan di media danbekerja di sebuah pabrik jaringan komunikasi yang besar semakin mendoronggarmen di Bangladesh terciptanya stereotipe melalui apa yang sering disebut sebagai proses ‘pembedaan’, dimana media cenderung untuk menetapkan, mengurangi atau menyederhanakan sesuai dengan salinan program dan format standar. Di antara bermacam strategi
    • 20 . BAGIAN II  BEBERAPA WAHANA UTAMA KEANEKARAGAMAN BUDAYAUntuk tujuan ini, potensi praktek media baru dan daya kreasi merupakan bagian penting bagikonten yang dihasilkan pengguna juga harus keanekaragaman budaya yang mendukungdimanfaatkan. Praktik jurnalisme inovatif muncul, daya kreasi.misalnya, melalui laporan video dengan menggunakanperangkat seluler. Laporan campuran lintas batas Kreasi seni dan ekonomi kreatifbudaya dan negara, melalui skema produksi Pemahaman terhadap kreativitas yang etnosentrisbersama dan produksi gabungan atau melalui penting untuk dihindari. Sebaliknya, kreativitas harusjaringan nasional, regional, dan internasional para dipahami sebagai mencakup semua hasil materialprofesional media, kini sedang diuji dan didorong. yang keberadaannya menjadi bernilai karena manu-Internet menawarkan potensi untuk mendukung Boneka-boneka sia. Batas-batas ‘seni’ sangat bervariasi antara satu bu-demokrasi yang dikomunikasikan melalui berbagai daya dengan budaya yang lain, yang mencerminkan matrioshka Rusiainisiatif budaya yang progresif melampaui perbedaan cara pandang serta bahan dan tekniksumber-sumber informasi mainstream: pembentukan yang tersedia dalam masyarakat masing-masing.identitas dalam masyarakat di perantauan; struktur Paruh kedua abad ke-20 ditandai oleh perubahanpendukung yang membela kepentingan budaya Hasil karya seni selera, tempat, dan pasar secara radikal dalam duniaminoritas; komunitas online, kelompok-kelompok dan segala bentuk seni dan pertumbuhan pertukaran seni di seluruhaktifis, dan orang-orang dengan kesamaan dunia. Dari perspektif budaya seni kontemporer,minat budaya. inovasi yang dunia bergerak menuju bentuk hubungan keluar dan tidak lagi dalam bentuk berupa hubungan pusat/Tiga tantangan yang harus dipenuhi jika komunikasi memperlihatkan pinggiran. Perluasan cara pandang seni dan ekspresidan konten budaya ingin memberikan kontribusi memberi sumbangan pada bentuk-bentukpada keanekaragaman budaya adalah: syarat warna dari kegiatan penciptaan campur yang terlihat pada bermacamkonten yang inovatif, perluasan akses, dan keterwakilan bentuk karya seni. Kebijakan budaya selain harusyang seimbang. Produksi konten yang inovatif umat manusia terbuka terhadap berbagai pengaruh lintas budayamemastikan integrasi keanekaragaman budaya dilihat sebagai ini, serta mengakui bahwa kecenderungan globalisasike media dan industri budaya, bersama dengan tersebut bukan berarti tidak membahayakanpenekanan yang kuat pada konten lokal. Akses sumber utama keanekaragaman budaya. Munculnya bentukantara lain melibatkan langkah-langkah jelas untuk campuran atau saling pinjam karena globalisasi dapatmengurangi perpecahan digital; kemudahan akses keanekaragaman menjadi lebih dari sekadar stereotip, sebagaimanaproduksi dan distribusi ke konten yang inovatif, dan pasar internasional untuk seni ‘eksotik’ tradisionalpemberian dukungan terhadap berbagai strategi budaya dapat berfungsi sebagai tempat yang menghargaiinformasi dan komunikasi baru dengan memastikan seni konformisme.bahwa sudut pandang yang berlawanan terwakilidalam diskusi tentang semua subjek bahasan. Diversifikasi dan saling mempengaruhi tradisi seniKeanekaragaman budaya juga menentukan tercermin dalam banyak sekali pertukaran seniketerwakilan seimbang dari masyarakat pertunjukan internasional dalam bidang teateryang hidup bersama dalam suatu negara dan tari dan sedang merambah ke dalam tampilan,tertentu, sesuai dengan prinsip-prinsip kebebasan sumber-sumber, dan budaya musik klasik Barat. Diberekspresi dan ide-ide yang mengalir bebas. bidang musik pop, keanekaragaman terlihat begitu banyak dimana-mana, multibudaya, dan seringkali jenis dan tempatnya tumpang-tindih. Risiko dariBab 6: Daya kreasi dan pasar wadah percampuran seni ini terletak pada komodifikasi ekspresi budaya dan substitusi konsep ‘budayaBab ini membahas keterkaitan antara keanekaragaman dunia’ untuk keanekaragaman ekspresi budaya.budaya dan berbagai jenis kegiatan mulai dari Globalisasi dan teknologi telah mengubah taruhan bagipenciptaan budaya melalui komersialisasi ekspresi seniman dengan menghadirkan pertanyaan abadibudaya hingga dampak luas budaya terhadap bisnis dengan tegas serta belum pernah ada sebelumnyadan pasar. Mendasari fenomena globalisasi, tentang bagaimana menyeimbangkan kreativitasdorongan kreatif pada akar keanekaragaman budaya seni murni dengan realitas kesulitan ekonomi.merupakan kunci analisis situasi budaya di dunia Imbalan keuangan yang tersedia dalam lingkunganmasa kini. Tentunya, keanekaragaman budaya hanya perdagangan global cenderung mendukungdapat dilestarikan jika akarnya terpelihara dengan sisi ekonomi, yang berdampak penting padatanggapan-tanggapan inovatif terhadap lingkungan keanekaragaman budaya. Dalam musik pop, asimetriyang cepat berubah. Berdasarkan pemikiran arus budaya mendorong seniman lokal untukini, kreasi seni dan segala bentuk inovasi yang mengeksploitasi bakat seni mereka di pasar yangmencakup beranekaragam aktivitas manusia semakin mendunia, menonjolkan proses akulturasidapat dilihat sebagai sumber inspirasi utama yang sedang terjadi di seluruh dunia. Kecenderungankeanekaragaman budaya. Dengan demikian, serupa juga terlihat dalam seni rupa dan plastik. Lima
    • D AYA K R E A S I D A N PA S A R . 2 1negara pengekspor seni rupa dan plastik terbesar keanekaragaman budaya dalam lingkungan alaminya)semuanya adalah negara Barat (dengan Cina sebagai menggambarkan pertentanganan antara keaslianpengecualian) dimana pasar di bawah kekuasaan Barat dan komersialisasi yang penting pengaruhnya bagilebih condong pada seniman dari Barat. Pertukaran pelestarian dan promosi keanekaragaman budaya.dan sirkulasi seniman juga perlu didorongdan difasilitasi. Produk kerajinan merupakan bentuk penting dari ekspresi budaya dan ini berarti bahwa pendapatanMeskipun bahasa tulisan dapat menjadi suatu dan peluang kerja sektor ini di banyak belahan duniapenghalang bagi akulturasi, literatur dalam bahasa akan semakin meningkat jumlahnya. Kerajinan telahpengantar utama memiliki keuntungan besar menjadi bagian dari sistem yang sangat terorganisirdalam hal penyebaran budaya. Koreksi berharga terdiri dari serikat pekerja, pedagang, dan sistemuntuk tren ini diberikan oleh sejumlah penghargaan perbankan, yang merupakan transformasisastra dikhususkan untuk karya-karya asing perekonomian kerajinan tradisional demi memenuhiterjemahan oleh organisasi-organisasi seperti persyaratan pasar global. Produk kerajinan yangPerpustakaan Digital Dunia (World Digital Library) tetap setia kepada tradisi mengandung bentukyang baru-baru ini diluncurkan. Proyek ini dan filosofi yang hanya dimiliki oleh budayamerupakan sebuah proyek kerjasama UNESCO darimana produk itu berasal. Produksi massal dapatdan Perpustakaan Kongres AS, yang menyediakan mengarah pada pemiskinan suatu kerajinan karenamateri-materi penting mengenai budaya dari tidak melibatkan akar kreatifnya. Membanjirnyaseluruh dunia. produk-produk industrial dari Barat di pasar tradisional telah mengakibatkan dampak serius pada ekonomi kerajinan. Memastikan keuntungan yangKerajinan dan pariwisata internasional adil dari produk kerajinan dan memeliharaKonsumsi budaya kini melibatkan masyarakat yang pengetahuan tradisional tentangnya adalah duasemakin luas dan mencakup ekspresi dan pengalaman hal yang sama pentingnya. Upaya perlindunganbudaya yang semakin beranekaragam. Kerajinan terhadap pembuatan kerajinan dapat(dengan memberikan bentuk artistik pada dilakukan dengan peraturan perlindungan hukumbenda-benda dekoratif atau rumah tangga) untuk ekspresi budaya tradisional (folklore).dan pariwisata (dengan menyediakan akses ke Sampai pada batas tertentu, promosi keanekaragaman budaya sangat bergantung pada dukungan untuk usaha komersial yang disesuaikan dengan konteks Daya kreasi dan pasar Bab 6: budaya dan kendala ekonomi lokal. Kredit mikro yang berdasarkan pada mekanisme ekonomi komersial, dengan mempertimbangkan struktur koperasi dalam suatu masyarakat tertentu telah terbukti sangat berhasil, terutama di negara-negara berkembang. Pariwisata memainkan peran penting dalam menggabungkan inisiatif untuk memperoleh keuntungan dan meningkatkan dialog antarbudaya. Setelah beberapa dekade pariwisata massal, kita sedang mengalami pembaruan pariwisata yang Wisatawan berdiri mencari keaslian. Hal tersebut dimotivasi oleh hasrat untuk menemukan masyarakat lain dalam lingkungan dengan seorang alam, sosial, dan budayanya yang asli. Yang disebut perempuan Indian Amerika sebagai ‘pariwisata budaya’, yang mencakup bentuk- bentuk wisata religius dan wisata situs warisan dunia, dengan menempatkan orang dalam lingkungan alaminya dan memperlihatkan kedalaman sejarah kepada kebudayaan lain dapat membantu untuk mempromosikan pemahaman budaya. Melibatkan masyarakat dalam proses tersebut juga membantu menumbuhkan harga diri dalam diri masyarakat dan memberi kontribusi pada pembangunan Kerajinan kayu berkelanjutan. Hal tersebut menjelaskan bahwa Zafimaniry, Madagascar hasil-hasil dari tren baru di bidang pariwisata sampai sejauh ini berupa campuran, karena pariwisata Selatan
    • 22 . BAGIAN II  BEBERAPA WAHANA UTAMA KEANEKARAGAMAN BUDAYA Patung-patung Bunda dapat juga mengarah pada pengasingan budayaMaria yang Kudus dalam yang berbeda, mereduksi ekspresi dan praktiksebuah toko cinderamata budaya menjadi ‘pertunjukan cerita rakyat ‘ yangdi Lourdes, Perancis terpisah dari lingkungan dan makna sejatinya. Keanekaragaman budaya dan dunia bisnis Dalam konteks internasionalisasi pasar, kemampuan perusahaan untuk menghadapi tantangan keanekaragaman budaya dengan memanfaatkan sumber dayanya telah menjadi faktor kunci dalam keberhasilan ekonomi. Keanekaragaman budaya dan dihormati oleh rekan-rekan mereka, untuk penting untuk dipertimbangkan dalam kegiatan menciptakan organisasi yang seluruh bidang komersial di tingkat global, terutama terkait pekerjaan dan tingkat hierarkinya lebih terintegrasi. penciptaan, citra merek, dan strategi pemasaran Ketika jajaran manajerial semakin mampu bekerja Tim bisnis yang serta struktur perusahaan dan perekrutan. dalam lingkungan budaya yang sangat berbeda,multietnik bergandengan diperlukan ‘pejabat kepala keanekaragaman’ (CDO), Perusahaan multinasional semakin menyadari akan yang bertugas mengelola keanekaragaman dalamtangan keuntungan dari membuat produk yang perusahaan sehingga dapat mencegah konflik Seni jalanan di Rio de beranekaragam dan melakukan penyesuaian agar yang dapat sangat merugikan kinerja kelompokJaneiro, Brazil dapat menembus pasar baru dan memenuhi harapan secara keseluruhan. konsumen lokal. Upaya-upaya tes pasar untuk Selimut orang Ekuador membuka jalur komersial tersebut adalah dengan Keanekaragaman budaya semakin menjadi perhatian memasarkan merek lawan menggunakan nama penting dalam studi manajemen perusahaan, dan penelitian dilakukan untuk menilai hubungan kinerja dengan keanekaragaman dalam pasar yang semakin kompetitif. Penelitian terkini menunjukkan adanya hubungan positif antara keanekaragaman dan kinerja keuangan dan ekonomi perusahaan multinasional. Tidak dapat dipungkiri, perusahaan mempromosikan ‘kecerdasan budaya’, yang memusatkan perhatian pada potensi menguntungkan yang diperoleh dari keanekaragaman karyawan, seperti: kreativitas dan inovasi yang lebih baik; pemasaran yang lebih sukses ke berbagai tipe konsumen; pengambilan keputusan yang lebihPenelitian terkini lain dengan asosiasi lokal semata hanya untuk menyeluruh karena perusahaan telah mempromosikan ‘universalisasi’ terhadap cita rasa terinternasionalisasi dan terbiasa berhadapanmemperlihatkan yang biasa. Beberapa perusahaan multinasional dengan lingkungan yang bervariasi; seleksi dan membangun citra mereka berdasarkan kombinasi pelatihan karyawan yang lebih berhati-hati; sertakeberadaan suatu dari lokal dan universal. Pada penerapannya, struktur dalam pemerintah yang menjembatani suatu produk harus mempertimbangkan keadaan skema-skema budaya perusahaan yang berbeda.ikatan positif antara dan pilihan setempat meskipun merek itu internasional. Di pasar yang kini sedang berkembang,keanekaragaman strategi yang dikembangkan untuk konteksdengan performa masyarakat konsumen Barat harus disesuaikan, dengan dukungan karyawan lokal, dengan kondisikeuangan setempat.dan ekonomi Di dalam dunia bisnis global, budaya-budaya yang sangat berbeda saling berhubungan melaluiperusahaan- kemitraan, penggabungan, dan relokasi multinasional. Para manajer masa kini semakin sadar akan perlunyaperusahaan mempertimbangkan faktor budaya dalam rangkamultinasional mengoptimalkan kinerja perusahaan melalui penerapan sikap profesional yang netral budaya hingga penekanan pada asal-usul atau budaya tertentu dari kolega. Budaya perusahaan bertujuan untuk memastikan bahwa karyawan merasa dihargai
    • Bagian III :MemperbaruiStrategiInternasionalyang terkaitdenganPembangunandan PerdamaianKeanekaragaman budaya dipahamisebagai suatu proses dinamisdimana cara terbaik mengelolapertukaran budaya adalah melaluidialog antarbudaya sehingga dapatmenjadi pendorong yang kuat untukmemperbarui berbagaistrategi masyarakat internasionalmenuju pembangunan danperdamaian, berdasarkan padapenghormatan terhadap hak-hak asasimanusia yang diakui secara universal.Keanekaragaman budaya, terkadangtidak dianggap terlalu penting,sehingga perlu ditempatkan di jantungkebijakan agar kerjasama dan kohesiinternasional, sesuai denganTujuan PembangunanMilenium PBB dapat terus majudan berkembang.
    • 24 . BAGIAN III  MEMPERBARUI STRATEGIBab 7 – Keanekaragamanbudaya: aspek pentingpembangunan berkelanjutanBerlawanan dengan asumsi yang tersebar, tidak adaresep baku untuk membangun suatu masyarakat,tidak ada satu contoh terbaik yang dapat dijadikanacuan strategi pembangunan. Memahamipembangunan sebagai suatu proses linear yangberdasar pada ekonomi saja, sesuai dengan modelBarat, cenderung menjadi kendala bagi masyarakatyang mengambil arah berbeda atau mematuhinilai-nilai yang berbeda. Strategi pembangunanyang berkelanjutan tidak bisa netral budaya: strategitersebut selain harus peka budaya juga memanfaatkankeuntungan dari interaksi dinamis antarbudaya.Dengan demikian, pendekatan pembangunan yangpeka terhadap perbedaan budaya adalah kunciuntuk mengatasi masalah-masalah ekonomi, sosial,dan lingkungan yang saling terkait yang dihadapidunia saat ini.Pendekatan budaya dalam pembangunanPandangan yang masih lazim di dunia yang semakinmaju memposisikan hubungan sebab akibat antara‘budaya’ dan ‘keterbelakangan’ atau, dengan kata lain,antara kinerja ekonomi dan nilai-nilai budaya Barat.Konsep pembangunan yang lebih luas denganmaksimalisasi laba dan akumulasi benda-bendamateri semakin bertentangan dengan makna tersiratdari pembangunan. Dengan tidak memperhitungkankeragaman budaya, strategi pembangunan berisikomelanggengkan atau menambah kekurangan yangseharusnya diperbaiki. Pertimbangan faktor sosialdan lingkungan budaya, dan peran serta masyarakatdalam desain dan implementasi proyek, sangatpenting bagi upaya pembangunan berkelanjutan.James D. Wolfensohn, mantan Presiden BankDunia, mengatakan, ‘kita mulai menyadari bahwaefektivitas pembangunan tergantung, sebagian,pada “berbagai solusi” yang mencerminkancara pandang masyarakat tentang dirinya.’Setelah UNDP menjabarkan model pembangunanmanusia pada tahun 1990-an, pengintegrasianaspek budaya dalam pemikiran dan proyekpembangunan semakin diperhatikan, yaitu denganmempertimbangkan kebudayaan (‘webs ofsignificance’) yang diciptakan masyarakat,lingkungan budaya dimana masyarakat dan kelompokhidup, hierarki sosial dan pola hidup setempat, danbentuk-bentuk komunikasi dan ekspresi setempat.Pengakuan terhadap keanekaragaman budayamenambah aspek penting pada berbagai strategiyang memandang keberlanjutan sebagai pendukungintegrasi pilar ekonomi pembangunan dengan pilarsosial dan lingkungannya. Dalam hal ini, keragamanbudaya dapat dilihat sebagai aspek lintas sektor yangsangat penting bagi pembangunan berkelanjutan.
    • K E A N E K A R A G A M A N B U D AYA : A S P E K U TA M A P E M B A N G U N A N B E R K E L A N J U TA N . 2 5Persepsi mengenai kemiskinan dan pengentasan sesuai dengan prinsip-prinsip gerakan Perdagangankemiskinan Adil, dapat membantu memperbaiki kondisiPerspektif budaya membentuk bagaimana kemiskinan sosial-ekonomi sambil meningkatkan hubunganitu dipahami dan dialami. Seringkali ini merupakan kreatif antara budaya, tradisi, dan modernitas.cara dimana orang miskin dipandang atau Yang penting adalah bahwa strategi pengentasanmemandang rendah diri mereka sendiri hingga kemiskinan relevan dan diterima oleh pendudukmenempatkan pada posisi inferior/lemah, yang setempat – yang mungkin berhasil ketika strategimerupakan suatu hambatan besar untuk menekankan dialog dengan kelompok-kelompokpemberdayaan mereka. Perbedaan konsepsi terkait dan keikutsertaannya dalam inisiatifmengenai kemiskinan menyulitkan penerapan peningkatan kemampuan – sehingga mereka Seorang perempuan Indonesiastrategi kerjasama internasional menyeluruh untuk diberdayakan untuk mampu membuat keputusan menganyam keranjangpemberantasan kemiskinan. Namun kemiskinan sendiri berdasarkan informasi dan pengetahuan yangadalah pelanggaran hak asasi manusia mendasar, cukup.dan tidak ada pembenaran secara budaya yangdapat diterima untuk kemiskinan (sebagai ‘nasib’atau konsekuensi dari sebuah tatanan sosial yangmenyeluruh). Dengan melihat kemiskinan daridalam dan dengan komitmen yang jelas untukpemberantasan kemiskinan berdasarkan pada hakasasi manusia, solusi lokal sering bisa ditemukanbersama dengan masyarakat yang terlibat sehinggamereka sendiri dapat menemukan jalan keluardari kemiskinan. Pendekatan menyeluruh yangmemadukan strategi-strategi budaya dengankomitmen terhadap hak-hak asasi manusiaberkontribusi besar pada pemberdayaandan peningkatan kemampuan.Inti dari pendekatan keragaman budaya terletakpada gagasan bahwa kebudayaan adalah berbagaihal yang mengarah ke masa depan. Menurutperkataan Arjun Appadurai: ‘Kita membutuhkan suatuperubahan besar dalam cara kita melihat budayadalam rangka menciptakan hubungan yang lebihproduktif antara antropologi dan ekonomi, antarabudaya dan pembangunan, dalam pertempuranmelawan kemiskinan. Perubahan ini mengharuskankita untuk menempatkan masa yang akan datang,daripada masa lalu, di pusat pemikiran kita tentangbudaya’. Pendekatan terhadap Pembangunan Berkelanjutan Budaya: Aspek Utama Bab 7: KeanekaragamanTugas selanjutnya adalah untuk melepaskan‘kemampuan untuk berupaya’ dan memampukan pembangunan yangindividu dan kelompok untuk menjadi agen sensitif terhadappembangunan mereka sendiri. keanekaragamanKebijakan sosial yang mendukung keanekaragaman budaya merupakanbudaya membantu untuk meningkatkan tingkatpenentuan nasib sendiri kelompok minoritas kunci penyelesaianberpenghasilan rendah atau berstatus rendah. berbagai masalahSelain redistribusi pendapatan dan akses yang samaterhadap hak-hak, pengentasan kemiskinan ekonomi, sosial danmembutuhkan tindakan untuk menjamin bahwakelompok-kelompok tersebut dapat memainkan lingkungan yang Anak-anak bermain Seorang anakperan lebih aktif di masyarakat. Memutuskan saling terkait yang di tempat pembuangan sedang divaksin polio dikukungan kemiskinan melibatkan pemulihan hargadiri, yang pada gilirannya mencakup menghargai dihadapi dunia ini sampah di Maputo, Afghanistan Mozambikwarisan tak benda oleh mereka yang merupakanpewarisnya. Upaya untuk merevitalisasi kerajinan dan Danau di Cinamempromosikan pariwisata berbasis masyarakat,
    • 26 . BAGIAN III  MEMPERBARUI STRATEGIBanyak yang Keanekaragaman budaya dan kelestarian lingkungan Di dalam beragam permasalahan mulai dari erosiharus dipelajari keanekaragaman hayati hingga perubahan iklim, keanekaragaman budaya memiliki peran pentingdari kemampuan – meski seringkali diremehkan – dalam menjawab berbagai tantangan ekologi masa kini dan memastikanmengelola lingkungan kelestarian lingkungan. Berbagai faktor budaya mempengaruhi perilaku konsumsi, nilai-nilai terkaitdan pengetahuan perlindungan lingkungan alam dan cara-caratradisional yang interaksi kita dengan lingkungan alam. Begitu banyak keahlian yang bisa dipelajari mengenai pengelolaandimiliki oleh penduduk lingk ungan dar i yang ter k a n dun g da la m pengetahuan lokal, pedesaan atau tradisional danlokal, pedesaan atau kearifan yang perlu dipelajari, termasuk strategi pencadangan serba guna, produksi skala kecil denganmasyarakat asli sedikit kelebihan, dan kebutuhan akan energi yang rendah, dan pendekatan perwalian atas tanah dan sumber daya alam yang menghindari penipisan limbah dan sumber daya. Sebagai penjaga ribuan spesies, varietas, dan ras tanaman serta hewan peliharaan, penduduk asli dapat memainkan peran penting dalam memberikan inspirasi solusi terhadap masalah lingkungan hidup masa kini. Kendala politik telah membatasi kemajuan terhadap Petani kopi memilah partisipasi masyarakat adat di bawah Program Kerjabiji kopi organik di sebuah lima tahun Nairobi mengenai Dampak, Kerentanan, dan Adaptasi terhadap Perubahan Iklim (2006).perkebunan kopi Sesuai dengan penekanan UNESCO sejak lama mengenai saling ketergantungan dinamis antara Toples-toples obat- manusia dan alam, terjadi peningkatan pengakuanobatan tradisional Cina, terhadap hubungan antara keanekaragaman hayatiHong Kong, Cina dan keanekaragaman budaya, meskipun masing- masing mungkin telah berkembang secara berbeda. Hal-hal yang terhubung meliputi keanekaragaman bahasa, budaya materi, pengetahuan dan teknologi, cara pemenuhan kebutuhan, hubungan ekonomi, yang mengancam stabilitas, dan juga keberadaan, hubungan sosial, dan sistem kepercayaan. Ketertarikan masyarakat manusia telah memicu perenungan kembali para pengambil keputusan akan paradigma serius akan keterbatasan tanggapan terhadap ‘terroirs’ menunjukkan sejauh mana praktik-praktik kepentingan ekologi yang murni bersifat teknis budaya dapat memberikan kontribusi pada revitalisasi dan ilmiah dan terhadap potensi pandangan biologi, pertanian, dan bentuk lain keanekaragaman. pembangunan berkelanjutan berdasark an Namun kedua komitmen ini (baik komitmen terhadap pengalaman, intuisi, dan praktik budaya. Oleh keanekaragaman budaya maupun bentuk-bentuk karena itu, terdapat dua kebutuhan mendesak baik lain keanekaragaman) belum tentu dapat sejalan, untuk menerapkan maupun mempromosikan sebagaimana diperlihatkan oleh perdebatan yang berbagai bentuk baru perkembangan pemikiran, dapat muncul di suatu masyarakat terkait perburuan indikator dan metodologi yang memusatkan spesies langka. Berhubung ekspresi dan praktik perhatian pada mereka yang mendapat keuntungan budaya seringkali terikat dengan kondisi lingkungan, dari perkembangan dan mereka yang mungkin adanya perubahan lingkungan pasti akan cukup besar tersingkir, dan juga pada dampak terhadap berdampak. Perubahan lingkungan yang menye- kondisi manusia dan tatanan sosial yang menjadi babkan perpindahan penduduk besar-besaran dapat sasaran. Dalam hal ini, Lensa Pemrograman mengancam kelangsungan kebudayaan dan Keanekaragaman Budaya UNESCO (UNESCO’s Cultural keanekaragaman secara serius. Efek terbesar pada Diversity Programming Lens), yang akan digunakan transmisi budaya akan sangat dirasakan di pedesaan oleh para pengambil keputusan dan kebijakan, mulai dan diantara kelompok-kelompok minoritas yang dipergunakan untuk menjalankan serangkaian bergantung pada tempat dimana mereka tinggal norma-norma dan standar untuk memasukkan yang memang sudah tertekan. Kemunculan k e a n e k a r a ga m a n budaya k e da la m de s a in, hubungan yang menakutkan dari masalah lingkungan pengembangan, dan penerapan program.
    • K E A N E K A R A G A M A N B U D AYA , H A K A S A S I M A N U S I A D A N P E M E R I N TA H A N D E M O K R AT I S . 27Bab 8: Keanekaragaman Budaya, tradisional atau keyakinan lalu secara salah Keanekaragaman mengasumsikan bahwa keanekaragaman budayaHak Asasi Manusia, dan dan hak asasi manusia universal adalah sama-sama budaya dan dialog eksklusif. Sesungguhnya hak asasi manusia munculPemerintahan Demokratis dari struktur mendasar dari budaya, sebagaimana antarbudaya diakui oleh bangsa-bangsa yang telah menjadi‘Tak seorang pun dapat menyalahgunakan penandatangan berbagai instrumen hak asasi merupakan kunci manusia. Dari perspektif ini, keanekaragaman budayakeanekaragaman budaya untuk melanggar hak- dan dialog antarbudaya merupakan pendorong pendukung untukhak asasi manusia yang telah dijamin oleh hukuminternasional, atau pun membatasi ruang utama untuk memperkuat konsensus di atas dasar memperkuatlingkupnya.’ Inti dari Deklarasi Universal tentang hak asasi manusia universal. Sebagaimana dinyatakanKeanekaragaman Budaya 2001 ini menyoroti dalam Deklarasi Wina 1993, sambil mencamkan konsensus/pertentangan antara keanekaragaman budaya ‘pentingnya keunikan nasional dan internasionaldan hak asasi manusia yang diakui secara universal serta beraneka ragam latar belakang sejarah, kesepakatanyang terkadang muncul secara membingungkan. budaya, dan agama’, tantangannya adalahKeanekaragaman budaya, dan dialog antarbudaya untuk mempromosikan dan melindungi semua mengenai landasan hak asasi manusia dan kebebasan fundamentalyang akan terjadi merupakan jalan ke arah ‘terlepas dari sistem politik, ekonomi, dan budaya universal hak-hakperdamaian berdasar pada ‘berbeda tapi satu’,jauh dari membuka jalan bagi berbagai bentuk [negara-negara]’. Penekanan pada aspek budaya asasirelativisme. Pemahaman menyeluruh akan dari hak asasi manusia harus dilihat tidak sebagaikeanekaragaman budaya berkontribusi pada merendahkan universalitas melalui keanekaragamanpelaksanaan hak asasi manusia secara efektif, namun sebagai pendorong penggunaan hak-hakpeningkatan kohesi sosial, dan pemerintahan ini oleh semua, baik individu atau kelompok.yang demokratis. Serangkaian standar perlindungan hak asasi manusia paling baik jika dimasukkan dalam suatu konteksKeanekaragaman budaya dan hak asasi manusia budaya melalui dialog dan komunikasi. Oleh karenayang diakui secara universal itu, keanekaragaman budaya demikian pentingMereka yang memandang keragaman sama dengan untuk menjangkau orang-orang dalam kehidupanrelativisme lalu memandangnya sebagai penolakan sehari-hari mereka. Gagal dalam hal ini berartiterhadap prinsip-prinsip universal. Sebaliknya, universalitas hak asasi manusia mungkin akan tetapmereka yang memandang penerapan hak asasi abstrak. Seperti telah dicantumkan oleh Kelompok Anak-anak bermain,manusia universal sebagai pemaksaan pada nilai-nilai Fribourg secara jelas dalam Deklarasi Fribourg, Alice Springs, Australia Pemerintahan Demokratis Budaya, Hak Asasi Manusia dan Bab 8: Keanekaragaman
    • 28 . BAGIAN III  SUMBER MEMPERBARUI STRATEGI merupak an suatu hal pe n ti n g un tuk atau bahkan gabungan dari seluruh kegiatan materi mempertimbangkan ‘aspek-aspek budaya seluruh dan spiritual masyarakat – sulit diterjemahkan jika hak asasi manusia dalam rangka meningkatkan terkait hak asasi manusia. Selain itu, tidak jelas siapa universalitas melalui keanekaragaman dan untuk yang menjamin pelaksanaan hak-hak tersebut. mendorong pelaksanaan hak-hak ini oleh semua Akhirnya, ada perdebatan mengenai ketegangan orang, diri sendiri atau dalam masyarakat bersama antara hak-hak budaya dan hak-hak asasi yang lain’. Selain itu, tidak ada lagi penerapan efektif manusia mendasar, seperti hak untuk perlakuan hak-hak sipil dan politik kecuali apabila syarat budaya yang sama dan non-diskriminasi. yang berkontribusi terhadap individu dan realisasi diri kolektif telah dijamin. Menggunakan hak pilih, Keanekaragaman budaya: Sebuah parameter kohesi misalnya, sampai batas tertentu bergantung pada sosial pencapaian tingkat pendidikan minimum, seperti Keanekaragaman budaya kini merupakan tantangan baca-tulis. Sebagian besar syarat budaya ini bisa utama karena komposisi multibudaya sebagian disamakan dengan hak-hak budaya, yang merupakan besar negara. Laporan Pembangunan Manusia UNDP pendorong kemampuan. 2004: Kebebasan Budaya dalam Dunia Kini yang Beranekaragam menekankan pentingnya menerapkan Hak bahasa memiliki arti penting tersendiri karena kebijakan publik yang mengakui perbedaan, menyediakan akses ke suatu kemampuan yang mendukung keanekaragaman dan mempromosikan penting untuk semua hak-hak yang lain. Hak-hak kebebasan budaya. Namun hal ini hanya dapat budaya kurang berkembang dalam hukum terwujud apabila kita sadar akan konflik yang internasional dan sangat sedikit disebut muncul dalam masyarakat multibudaya dari dalam berbagai instrumen internasional. Luasnya pengakuan terhadap keanekaragaman. Pengalaman cakupan hak-hak budaya mengandung beraneka menunjukkan bahwa upaya untuk memperkuat masalah definisi, pertentangan, dan keselarasan tatanan nasional dengan berpura-pura bahwa dengan hak asasi manusia lainnya. Gugatan bersama perbedaan itu tidak ada menyebabkan reaksi balasan atas nama hak-hak budaya – sebagai mengandung budaya dan bahwa menghadapi perbedaan Batu menhir Buenos Aires pendekatan berdasarkan hak terhadap promosi dan budaya merupakan satu-satunya cara efektif hidup perlindungan terhadap keanekaragaman budaya, bersama perbedaan. terkait dengan penciptaan budaya, ekspresi budaya
    • K E A N E K A R A G A M A N B U D AYA , H A K A S A S I M A N U S I A D A N P E M E R I N TA H A N D E M O K R AT I S . 29Sementara masyarakat yang budayanya homogen realistis ke arah pemerintahan demokratis yang Tujuan bersamanyatidak pernah ada, jejaring budaya menjadi semakin sejati. Pendekatan bersifat universalistik tersebutkompleks begitu globalisasi terjadi. Di negara- yang dibangun di atas rasa saling percaya merupakan adalah untuknegara yang tidak secara serius memperhatikan kunci hidup bersama yang damai dalam masyarakat;keanekaragaman budaya, imigrasi massal karena hal tersebut merupakan titik tinggal landas meningkatkanmenyebabkan munculnya masyarakat ‘kumuh’ yang pembentukan suatu konsensus internasionalmenjadi sumber berbagai konflik – oleh karena yang lebih luas selaras dengan tujuan Perserikatan lingkungan yangitu, perlu ada ‘akomodasi yang layak’ antarbudaya. Bangsa-Bangsa. Bagi hak asasi manusia, pencapaianMasalah persepsi penting disini, karena konflik besar semacam itu dapat diterima ketika berasal mendukungantarbudaya selalu melibatkan kebingungan dan dari keanekaragaman model-model budaya kemajuan kedistorsi antara fakta dan persepsi, terutama antara pemerintahan yang berlaku di masyarakat.penduduk mayoritas dan minoritas yang merasa arah pemerintahbahwa dirinya tidak cukup dihargai dan menyatu dalam Oleh karena itu, hukum dan mekanismetatanan sosial. Langkah-langkah harus diambil penyelesaian perselisihan secara tradisional demokratik yanguntuk memastikan bahwa suara dan pandangan (sebagaimana kembali tergali melalui prismaminoritas dapat didengar dan bahwa perdebatan warisan budaya takbenda) dapat hidup bersama sesungguhnyayang melibatkan semua anggota masyarakat dengan organisasi kenegaraan dan menambahyang bersangkutan dapat terjadi. kekuatan pemerintahan yang demokratis.Sejak 1970-an kebijakan multikulturalis – terutamadi bidang pendidikan, informasi, hukum, ketaatanberagama, dan akses media – telah menjadi salah satudari berbagai pendekatan utama untuk memastikankesetaraan dalam keanekaragaman. Berbagaikebijakan tersebut telah terbukti memiliki beberapakelemahan, terutama mendorong penyimpanganke arah isolasionisme budaya. Beberapa negara saatini ditantang untuk menemukan model baru yangmemadukan agenda untuk mempromosikan identitasnasional dengan agenda ‘merayakan’ keanekaragaman.Dalam konteks ini, tujuannya adalah untuk melampauiasimilasi dan multikulturalisme yang dipahamisebagai keterpisahan bukan sebagai interaksi danmenjadi bagian dari beragam kelompok, untukmemfasilitasi akses ke budaya lain, terutamamelalui pengembangan jaringan dan bentuk-bentukbaru hubungan sosial.Tantangan keanekaragaman budaya bagipemerintahan demokratisPe m e r in t a h a n meli batk an ber bagai prosespengambilan keputusan dan pelaku di dalam strukturformal dan non-formal dalam konteks sosial danpolitik tertentu. Mengenali saling ketergantunganantara semua aktor menghubungkan pemerintahandengan permasalahan lebih luas terkait modal sosial Kota yang dikelilingi Cakrawala Kota Newdan hal-hal dasar yang diperlukan untuk kohesi sosial. benteng Ait ben Haddou Jersey di Sungai Hudson, AS Pemerintahan Demokratis Budaya, Hak Asasi Manusia dan Bab 8: KeanekaragamanMembangun masyarakat yang kohesif membutuhkan dekat Ouarzazate dipengembangan dan penerapan berbagai kebijakan Marokoyang memastikan pemberdayaan semua kelompokdan individu, serta partisipasi politiknya. Pengaturan Gambar pada batumengenai pembagian kekuatan, seperti demokrasi khas Aborigin di lembahkonsensus, harus disertai dengan berbagai Carnarvon, Queenslandkebijakan pemberdayaan di bidang pendidikan, Tengah, Australiabudaya, dan media.Tujuan besarnya adalah untuk mempromosikanlingkungan yang mendukung untuk kemajuan yang
    • KESIMPULAN . 31 Kesimpulan Investasi pada keanekaragaman budaya dan dialog merupakan kebutuhan mendesak. Memasukkan keanekaragaman budaya ke dalam berbagai kebijakan publik (termasuk kebijakan yang jauh dari bidang budaya) dapat membantu memperbarui pendekatan masyarakat internasional kepada dua tujuan utama yaitu pembangunan serta upaya perdamaian dan penyelesaian konflik. Sehubungan dengan pembangunan, budaya semakin diakui sebagai aspek lintas sektor dari tiga pilar pembangunan yang benar-benar berkelanjutan yaitu pilar ekonomi, sosial, dan lingkungan. Terkait perdamaian dan penyelesaian konflik, mengakui keanekaragaman budaya berarti menitikberatkan pada ‘berbeda tapi satu’ yaitu berbagi nilai kemanusiaan yang melekat dalam perbedaan kita. Keanekaragaman budaya memupuk penerapan hak asasi manusia secara efektif dan bukan membatasi hak asasi manusia yang diakui secara universal. Keanekaragaman budaya juga memperkuat kohesi Topeng ‘Roi de Soleil’ sosial dan mendorong pembaruan bentuk-bentuk pemerintahan yang demokratis. Selain itu, kita perlu memperbaiki pemahaman mengenai keanekaragaman budaya dan dialogpada Karnaval di Rio de guna melepaskan diri kita dari sejumlah gagasan yang umum.Janeiro, Brazil Menuju pemahaman baru mengenai (dipandang sebagai dialog antar semua tradisi Salah satu Buddha keanekaragaman budaya kepercayaan dan intelektual), bukan berarti bahwaBamiyan abad ke-6, situs kita melepaskan keyakinan namun hanya berupayaWarisan Dunia UNESCO Laporan Dunia bertujuan untuk mempromosikan untuk membuka pikiran. Dialog antarbudaya harusyang hancur pada 2001 kesepahaman dengan meneliti sejumlah dipandang sebagai suatu proses yang kompleksoleh pemerintahan pandangan umum tertentu : dan terus berlangsung yang tidak pernah selesai.Taliban pada masa itu diAfghanistan Globalisasi mengarah pada homogenisasi budaya Keanekaragaman budaya dan ekonomi sama- yang tidak terelakkan. Meskipun tidak dapat sama tidak bersesuaian. Pada praktiknya, dipungkiri bahwa globalisasi melemahkan keanekaragaman budaya hadir di semua sektor keanekaragaman budaya sampai pada batas ekonomi, dari pemasaran dan periklanan hingga tertentu melalui standarisasi cara hidup, produksi keuangan dan pengelolaan bisnis. Keanekaragaman dan konsumsi, hal tersebut sama-sama membantu menjadi sumber daya, karena menstimulasi memahami keanekaragaman budaya dengan kreativitas dan inovasi dalam perusahaan, terutama cara-cara yang telah disoroti dalam Laporan Dunia yang berjiwa sosial. Pemahaman mengenai terbaru ini. berbagai alat yang diperlukan agar keanekaragaman budaya dapat berkembang Keanekaragaman budaya dapat direduksi menjadi (‘kecerdasan budaya’) merupakan satu dari banyak keanekaragaman budaya bangsa. Namun identitas tanda yang nyata adanya pergeseran perlahan nasional bukan merupakan kuantitas yang baku: dalam cara sektor ekonomi (dan pasarnya) identitas nasional merupakan suatu konstruksi memandang keanekaragaman budaya. sejarah; dan identitas yang terlihat begitu biasa pada kenyataannya merupakan hasil dari banyak Kemajuan ilmu pengetahuan dan teknologi dan interaksi yang kita bisa temui di dalam konteks keanekaragaman aktivitas budaya sama-sama nasional. tidak bersesuaian. Keanekaragaman budaya tidak mungkin tidak bersesuaian dengan kemajuan Keanekaragaman budaya dan dialog antarbudaya dan pembangunan. Jelas, munculnya ‘masyarakat sama-sama eksklusif. Daripada memandang dunia berpengetahuan’ yang sejati menyiratkan sebagai pluralitas peradaban, baik dalam hal keanekaragaman bentuk pengetahuan dan sumber- konflik (‘benturan peradaban’) atau dialog (‘aliansi sumber penciptaannya, termasuk kearifan lokal yang peradaban’), kita harus bergerak ke arah rekonsiliasi kondusif bagi pelestarian keanekaragaman hayati. dari perbedaan dimana harmoni keseluruhan terlahir dari resonansi yang terkandung dalam Terdapat kontradiksi yang tidak dapat penerimaan terhadap sesama. Keanekaragaman diselaraskan antara keanekaragaman budaya dan budaya merupakan prasyarat dari dialog universalisme. Keyakinan bahwa keanekaragaman antarbudaya, dan sebaliknya. Tanpa dialog yang budaya jelas mengarah pada revitalisasi hak- tulus, dinamika perubahan (yang merupakan hak dan kebebasan, dilihat berbeda-beda waktu inti dari keanekaragaman budaya) tidak dapat dan tempatnya, bersandar pada penggabungan Rekomendasi Kesimpulan dan dipertahankan, dan keanekaragaman menjadi standardisasi dan universalitas yang tidak bisa punah atau menurun sebagai hasil dari menutup dijelaskan alasannya. Hak-hak dan kebebasan yang diri. Dialog termasuk dialog antar agama diakui secara universal oleh masyarakat dunia
    • 32 . KEANEKARAGAMAN BUDAYASangat menggoda adalah hakiki untuk setiap manusia dan oleh tidak terbatas hanya pada perlindungan warisan karenanya tak-benda. Hak-hak dan kebebasan benda dan takbenda dan menciptakan kondisijika kita melihat tersebut juga tidak dapat dicabut karena tidak seorang dimana kreativitas dapat berkembang, namun juga pun dapat melepas hak-haknya. Di sisi lain, hak-hak harus mencakup berbagai kebijakan yang dituju-faktor-faktor budaya dan kebebasan itu diterapkan dalam beraneka ragam kan untuk membantu para individu dan kelompok lingkungan budaya yang luas, dan semua memiliki rentan yang tidak siap menghadapi perubahan budaya.sebagai penyebab satu aspek budaya yang perlu disoroti. Penjelasan ini bukan ingin mengatakan bahwa norma-norma Implikasi keanekaragaman budaya terhadapkonflik, padahal universal adalah relatif dalam penerapannya. kebijakan publikfaktor tersebut hanya Namun, mengatakan bahwa keanekaragaman Meskipun aspek budaya dari tantangan yang dihadapi budaya dapat mendorong penerapan hak- masyarakat internasional tidak tercermin secaramerupakan alasan hak dan kebebasan, karena mengabaikan langsung dalam Tujuan Pembangunan Milenium, berbagai realitas budaya akan berpengaruh pada kesadaran yang didasarkan pada pengetahuankonflik yang salah. pengakuan akan hak-hak dan kebebasan formal akan implikasi dari keanekaragaman budaya sangat tanpa memastikan bahwa dalam penerapannya penting untuk pengambilan kebijakan publik di bidangPenyebab utama hak dan kebebasan tersebut dapat ditemui yang berada di luar domain budaya sesungguhnya. dan dinikmati dalam beragam konteks budaya.konflik terletak pada Dalam bidang bahasa, pemiskinan budaya, samakeadaan politik atau Semakin perlu untuk menolak mempercayai halnya dengan status politik, sosial, administratif anggapan-anggapan tersebut karena melihat dan budaya dari bahasa, merupakan akar darisosial-ekonomi faktor-faktor budaya sebagai penyebab konflik menghilangnya bahasa.. sangat menggoda, padahal faktor budaya hanya merupakan alasan konflik; penyebab utama konflik Dalam pendidikan, integrasi aspek budaya terletak pada keadaan politik atau sosial-ekonomi. merupakan aspek penting dalam metode dan Sebagaimana direkomendasikan dalam laporan ini, konten pendidikan. Aspek budaya berkontribusi untuk memperjelas pertanyaan tersebut perlu disusun pada pencapaian penuh hak atas pendidikan mekanisme-mekanisme baru untuk memantau, dan penganekaragaman bentuk belajar, termasuk mengumpulkan data dan sirkulasi informasi. belajar di luar sekolah, memastikan tidak ada kelompok dalam masyarakat (yaitu masyarakat Dalam menghadapi pendapat luas tersebut, Laporan adat minoritas, kelompok-kelompok rentan) yang Dunia menyarankan suatu pendekatan baru yang terlupakan. Jika keanekaragaman budaya tidak menyoroti karakter dinamis keanekaragaman budaya. diperhatikan, pendidikan tidak dapat memenuhi Ini berarti bahwa berbagai kebijakan yang perannya dalam pelajaran hidup bersama. mempromosikan keanekaragaman budaya seharusnya Akibatnya, pengembangan kompetensi antarbudaya yang kondusif untuk dialog antarbudaya dan peradaban harus menjadi prioritas pendidikan. Di bidang konten komunikasi dan budaya, karena beraneka jenis komunikasi dari konten budaya yang beraneka ragam menyumbang terjadinya aktivitas pertukaran, dan karena globalisasi dan teknologi baru telah memperluas ruang lingkup pilihan yang mungkin, dalam kaitan ini keanekaragaman budaya merupakan faktor yang harus dipertimbangkan. Hal ini memungkinkan masyarakat minoritas menjadikan diri mereka dikenal oleh masyarakat luas, bahkan jika usaha yang terus-menerus diperlukan untuk membatasi stereotipe dan prasangka yang sering ditujukan kepada masyarakat tersebut. Di sektor swasta, keanekaragaman budaya berpengaruh pada semua bidang kegiatan ekonomi, karena kreativitas dan inovasi saling berkaitan. Empat penari Dogon Keanekaragaman budaya mempengaruhi banyakdengan topeng dan kebijakan publik dan bidang yang tidak berkaitaneggrang, Desa Irelli, Mali
    • KESIMPULAN . 33langsung dengan budaya, UNESCO memiliki tanggung saluran hubungan potensial antara para individujawab khusus untuk membantu Negara Anggota dapat mengurangi rintangan terjadinya dialogdalam perumusan berbagai kebijakan terkait. antarbudaya. Kemudian, keluwesan berbagai identitas dapat menciptakan dinamika perubahanBerbagai tantangan utama yang harus diatasi yang mendorong segala bentuk inovasi di semuaLaporan Dunia ini menyoroti tiga tantangan terkait tingkat. Pendekatan semacam itu memungkinkankeanekaragaman budaya yang akan dihadapi oleh untuk mengubah batasan berbagai kebijakanmasyarakat internasional di masa depan; melawan multikulturalis yang muncul pada 1970-an.buta budaya, mencari titik temu antara universalismedan keanekaragaman, dan mendukung bentuk- Selanjutnya negara harus segera menginvestasikanbentuk baru pluralisme yang dihasilkan dari keyakinan sumber daya keuangan dan manusia dalamperorangan dan kelompok akan keragaman identitas. keanekaragaman budaya. Apa saja bidang utama dimana investasi ini harus ditanam dan apakah yang Dalam dunia yang semakin global dimana hubungan harus menjadi tujuannya? Berbagai rekomendasi antarbudaya berkembang luas secara cepat, berikut memberikan sejumlah petunjuk mengenai memerangi penyebaran buta budaya menjadi perlu. hal tersebut. Keuntungan yang diharapkan dari Tentu saja, kemampuan menerima perbedaan investasi semacam itu adalah kemajuan menuju budaya, menerimanya tanpa dicerai-berai olehnya, pencapaian pembangunan berkelanjutan dan memerlukan kompetensi antarbudaya. Beberapa perdamaian yang berdasar pada ‘berbeda namun masyarakat telah berpengalaman mengembangkan satu’. Harga dari tindakan semacam itu mungkin kompetensi budaya dalam konteks tertentu namun mahal namun harga dari tidak bertindak bisa kadang-kadang terlihat tidak begitu berkembang lebih mahal. Apabila masyarakat internasional di tingkat individual. Membantu mempersiapkan mampu dalam sepuluh tahun ke depan mengukur Seorang anak laki-laki di individu atau kelompok dengan pengetahuan kemajuan yang dicapai dalam kurun waktu tersebut, Pulau Kihnu, Estonia yang diperlukan untuk mengelola keanekaragaman pendekatan-pendekatan yang dipaparkan dalam budaya secara lebih efektif harus menjadi perhatian Laporan Dunia ini telah memenuhi tujuan tersebut. baru bagi para pengambil keputusan publik dan Di era globalisasi swasta. Dialog antar budaya harus memastikan dimana hubungan kesetaraan antara semua pemangku kepentingan dalam masyarakat. Dalam hal ini, multilingualisme antara budaya-budaya dan melek media dan informasi berperan penting. semakin meluas, Kebutuhan untuk memperkuat landasan universalisme dengan menunjukkan bagaimana sangat penting untuk hal itu dapat diwujudkan dalam berbagai aktivitas budaya tanpa merusak. Mengabaikan realitas memerangi meluasnya budaya akan mengarah pada penegasan hak-hak buta budaya formal dan kebebasan tanpa memastikan bahwa hak-hak dan kebebasan dalam praktiknya dapat diterapkan dan dinikmati dalam berbagai konteks budaya. Keanekaragaman budaya adalah penting bagi hak-hak asasi manusia. Hak-hak ini harus ‘disesuaikan’ di tingkat lokal, bukan sebagai elemen yang dipaksakan pada berbagai aktivitas budaya tetapi sebagai prinsip-prinsip universal yang berasal dari berbagai aktivitas itu sendiri. Setiap aktivitas budaya mengandung jalan ke arah universal dan hal ini merupakan bukti atas nilai kemanusiaan kita bersama. Terdapat kebutuhan untuk mengeksplorasi pendekatan baru yang muncul karena pengakuan beragam (multi aspek) identitas individu dan kelompok dalam upaya terus mengembangkan pluralisme budaya. Individu-individu yang menolak dibatasi dalam kategori baku (baik etnis, bahasa, Rekomendasi Kesimpulan dan budaya, politik atau yang lain) semakin meningkat. Inilah saatnya untuk bertindak. Semakin banyaknya
    • 34 . CULTURAL DIVERSITYRekomendasi Bab 1 – KEANEKARAGAMAN BUDAYA dorong rekonsiliasi antar masyarakat 1. Pentingnya pembentukan sebuah di dalam proses harmonisasi budaya Ob s e r v a t o r i u m Dunia untuk keseluruhan. dalam proses pendamaian Keanekaragaman Budaya untuk budaya secara menyeluruh. memonitor berbagai dampak globalisasi dan berfungsi sebagai sum- Bab 3 – BAHASA ber informasi dan data bagi penelitian 3. Kebijakan bahasa nasional harus komparatif yang berfokus ke masa depan. diterapkan dengan tujuan untuk melin- dungi keanekaragaman bahasa serta Berbagai Untuk tujuan ini, tindakan yang harus mendorong kemampuan multilingual. dilakukan adalah: rekomendasi a. Mengumpulkan, mengkompilasi dan Untuk tujuan ini, tindakan harus berikut menyebarluaskan data dan statistik dilakukan untuk: sebagaimana mengenai keanekaragaman budaya, a. Memfasilitasi penggunaan bahasa mestinya ditujukan berdasarkan antara lain Kerangka dengan cara-cara yang semestinya, Kerja Statistik Budaya UNESCO 2009 baik melalui pendidikan, penyuntingan, untuk negara, yang telah diperbarui. administratif atau lainnya. badan-badan regional b. Lembaga pemerintah dan lembaga b. Membuat ketentuan-ketentuan yang dan internasional publik dan swasta perlu mengembangkan di pe r luk a n un tuk m e m pe rgiat berbagai metodologi dan cara untuk pe m be la ja r a n ba h a s a n a s i o n a l d an antarpemerintahan menilai, mengukur, dan mengawasi internasional, selain bahasa ibu. maupun non- keanekaragaman budaya. Metodologi pemerintah, ini harus dapat menyesuaikan diri c. Mendorong penerjemahan materi tulisan institusi nasional, dengan kondisi nasional atau daerah. dan audiovisual dengan segala cara yang mungkin untuk mendorong penyebaran dan lembaga c. Mendirikan observatori nasional untuk berbagai ide dan karya seni secara di sektor swasta. mengawasi berbagai kebijakan dan i n te r n a s i o n a l, te r m a s uk m e lal u i memberi saran mengenai langkah- penggunaan teknologi-teknologi baru. langkah yang tepat untuk mempromo- sikan keanekaragaman budaya. d. Membuat berbagai indikator yang dapat diandalkan dan dapat dipakai secara Bab 2 – DIALOG ANTARBUDAYA internasional untuk meneliti dampak 2. Dukungan harus terus diberikan dari kebijakan bahasa mengenai kepada berbagai jejaring dan prakarsa k e a n e k a r a ga m a n li n gui s ti k , d an yang mengusung dialog antarbudaya mempromosikan contoh-contoh terbaik dan antar agama di semua tingkat, yang terkait. sambil memastikan keterlibatan penuh rekanan baru, khususnya kaum Bab 4 – PENDIDIKAN wanita dan generasi muda. 4. Dalam rangka terus mendorong proses belajar untuk hidup bersama, terdapat Untuk tujuan ini, tindakan yang harus kebutuhan untuk mempromosikan dilakukan adalah: kompetensi-kompetensi antarbudaya, a. Mengembangkan langkah-langkah yang termasuk yang terkandung dalam memberikan kesempatan bagi anggota berbagai aktivitas masyarakat sehari-hari, dan kelompok masyarakat yang menga- dengan tujuan untuk meningkatkan lami diskriminasi dan stigmatisasi untuk pendekatan pendidikan terhadap turut berpartisipasi dalam membuat hubungan antarbudaya. struktur proyek yang didesain untuk menangkal stereotip budaya. Untuk tujuan ini, tindakan harus dilakukan untuk: b. Mendorong berbagai inisiatif dukungan a. Melakukan survey perbandingan isi yang bertujuan untuk menciptakan dan metode pendidikan di berbagai ruang-ruang nyata dan maya dan negara, termasuk cara-cara tradisional menyediakan berbagai fasilitas untuk mewariskan pengetahuan, terutama interaksi budaya, terutama di negara- yang mengacu pada pengakuan dan negara yang dilanda konflik antar penerimaan keanekaragaman budaya. Festival jalanan di penduduk. b. Mendukung berbagai upaya untuk San Pedro de Macoris, c. Mengemas ‘tempat-tempat bersejarah’ mengidentifikasi dan/atau menciptakan Republik Dominika yang berfungsi sebagai simbol dan men- peluang dan fasilitas untuk belajar
    • REKOMENDASI . 35 dengan fokus budaya di setiap sistem dan peningkatan performa yang sumber daya berdasarkan keadilan pendidikan dengan memanfaatkan mendukung ‘kecerdasan budaya’ sosial, demi mendorong dialog sosial berbagai instrumen yang ada seperti perusahaan. yang dinamis dan mempromosikan Laporan-laporan Penelitian Nasional EFA Untuk tujuan ini, tindakan harus dilakukan solidaritas antarbudaya. (Education For All). untuk: a. Memfasilitasi pertukaran karya seni dan Bab 8 – KEANEKARAGAMAN BUDAYA,c. Mengadaptasi metode pengajaran yang peredaran seniman, termasuk melalui HAK-HAK ASASI MANUSIA DAN sesuai dengan kehidupan sehari-hari sistem penerbitan visa budaya. PEMERINTAHAN DEMOKRATIS mereka yang belajar, dengan dukungan 8. Seperti telah diakui secara universal, yang dibutuhkan dari pembuat kebijakan b. Membuat sistem yang layak untuk hak-hak asasi manusia untuk setiap orang di bidang pendidikan, para profesional melindungi pengetahuan tradisional harus dijamin dan penerapan secara di bidang pendidikan di semua tingkat di sektor kerajinan, dan juga cara-cara efektif atas hak-hak tersebut dapat dan masyarakat setempat, serta mengakui dan langkah yang diperlukan untuk berkembang melalui pengakuan aspek budaya sebagai soko guru menjawab kekhawatiran masyarakat terhadap keanekaragaman budaya, yang Pendidikan untuk Pembangunan akan eksploitasi komersial terhadap dapat memperkuat pula kohesi sosial Berkelanjutan. pengetahuan tradisional tersebut. dan mendorong cara-cara pemerintahan demokratis yang diperbarui. Untukd. Membuat panduan internasional untuk c. Membuat dan menyebarluaskan berbagai tujuan ini, berbagai kebijakan yang mempromosikan dialog antarbudaya contoh terbaik terkait pembangunan mendukung perlindungan dan promosi melalui seni, dengan berdasarkan pada pariwisata dengan maksud untuk keanekaragaman budaya harus didukung. identifikasi contoh-contoh terbaik dalam memaksimalkan dampak positif terhadap pendidikan seni. keanekaragaman budaya. Tindakan harus dilakukan terutama untuk: a. Mengumpulkan contoh-contoh kasusBab 5 – KOMUNIKASI DAN KONTEN d. Mengembangkan ‘kecerdasan budaya’ yang spektakular yang memperlihatkanBUDAYA dalam dunia bisnis dan pemasaran konteks budaya sebagai faktor penting5. Terdapat kebutuhan untuk mendorong melalui pembentukan berbagai forum dalam pelaksanaan efektif hak-hak dansensitivitas budaya dalam pembuatan nyata dan maya dan melaksanakan kebebasan yang diakui secara universal,dan konsumsi konten komunikasi penelitian yang relevan mengenai yang menyoroti aspek budayadan informasi yang memfasilitasi keuntungan keanekaragaman budaya, dalam hak-hak dan kebebasan.akses, pemberdayaan dan partisipasi. tidak hanya terbatas pada perbedaan b. Memetakan pertukaran dalam dan etnis atau gender. antara kelompok-kelompok minoritasUntuk tujuan ini, tindakan harus dilakukan dan antara masyarakat mayoritas danuntuk: Bab 7 – KEANEKARAGAMAN BUDAYA minoritas, terutama dalam konteksa. Mendukung pembuatan dan penyebaran DAN PEMBANGUNAN BERKELANJUTAN ‘kota-kota dunia’, dalam rangka men- berbagai materi audiovisual yang 7. Prinsip-prinsip keanekaragaman ciptakan jejaring solidaritas informal, inovatif dan beragam, dengan budaya, sebagaimana tercakup dan mempublikasikan secara luas mempertimbangkan kebutuhan, isi khususnya dalam Lensa pertukaran tersebut. dan pelaku setempat, dan melakukan Keanek arag a ma n Bu d aya (Cu l t u ra l kerjasama publik-swasta, jika diperlukan. Diversity Lens), harus dijadikan acuan c. Mempelajari keanekaragaman warisan dalam mendesain, melaksanakan takbenda berlandaskan pemberdayaanb. Mempelajari dampak perubahan yang dan mengawasi seluruh kebijakan dan partisipasi semua masyarakat disebabkan oleh teknologi informasi dan pembangunan. sebagai contoh model pemerintahan komunikasi terhadap keanekaragaman yang demokratis. budaya, dengan maksud menyoroti Untuk tujuan ini, tindakan harus dilakukan berbagai contoh terbaik akses multilingual untuk: REKOMENDASI UMUM: kepada karya-karya tulis dan audiovisual. a. Mengidentifikasi berbagai tindakan 9. Adanya kebutuhan untuk nyata untuk menjalankan penelitian meningkatkan kepedulian diantara parac. Mempromosikan melek media dan mengenai aspek budaya dari konservasi pengambil kebijakan dan keputusan informasi untuk segala usia dengan dan pengelolaan sumber daya alam, mengenai keuntungan dari dialog tujuan meningkatkan kemampuan dengan fokus acuan pada pengetahuan antarbudaya dan antarkepercayaan, pengguna media untuk secara kritis dan pemahaman tradisional yang sambil mengingat potensi peranannya mengevaluasi konten komunikasi dan dimiliki penduduk asli. budaya. 10. Pentingnya mempertimbangkan b. Mendirikan pusat data dokumentasi pembentukan suatu mekanisme nasionalBab 6 – KREATIVITAS DAN PASAR pendekatan partisipatori terhadap untuk mengawasi berbagai kebijakan6. Kreativitas sebagai sumber inovasi masalah lingkungan, termasuk berbagai publik yang terkait dengansosial dan teknologi, membutuhkan indikasi demi keberhasilannya. keanekaragaman budaya, denganinvestasi untuk pengembangannya, tujuan untuk memastikan pemerintahan Rekomendasi Kesimpulan danbaik di sektor budaya maupun bisnis, c. Mendorong partisipasi anggota yang lebih baik dan terlaksananyadimana keanekaragaman budaya masyarakat di berbagai negara dalam hak-hak asasi manusia yang diakuidipahami sebagai sumber keuntungan upaya menentukan kriteria alokasi secara universal secara penuh.
    • 36 . PERNYATAAN Laporan Dunia UNESCO No. 2: Berinvestasi dalam Keanekaragaman Budaya dan Dialog Antarbudaya Di bawah pengawasan Françoise Rivière, Asisten Direktur-Jenderal untuk Budaya dari 2006 hingga 2010 Edisi umum teks: Georges Kutukdjian dan John Corbett Editorial dan Koordinator Penelitian: Frédéric Sampson Editor Proyek dan Koordinator Produksi: Janine Treves-Habar Direktur Unit Laporan Dunia (resmi menjabat sejak Juli 2007): Michael Millward Dewan Penasihat Laporan Dunia mengenai Keanekaragaman Budaya Neville Alexander (Afrika Selatan) Arjun Appadurai (India) Lourdes Arizpe (Mexico) Lina Attel (Jordan) Tyler Cowen (AS) Biserka Cvjeticanin (Kroasia) Philippe Descola (Perancis) Sakiko Fukuda-Parr (Jepang) Jean-Pierre Guingané (Burkina Faso) Luis Enrique Lopez (Peru) Tony Pigott (Kanada) Ralph Regenvanu (Vanuatu) Anatoly G. Vishnevsky (Federasi Rusia) Mohammed Zayani (Tunisia) Benigna Zimba (Mozambik) Edisi Bahasa Indonesia Penerjemah: Dwi A. Indrasari Editorial: Wieske O. Sapardan dan Anasthasia R. Herna Hak Cipta©2011 oleh Organisasi Perserikatan Bangsa-Bangsa bidang Pendidikan, Ilmu Pengetahuan, dan Budaya 7 place de Fontenoy 75007 Paris, France Hak cipta dilindungi oleh Undang-Undang. Sebagian atau keseluruhan publikasi ini tidak dapat direproduksi, disalin atau diedarkan, dalam bentuk apa pun atau dengan cara apa pun, dengan cara elekronik, mekanik, menyalin, merekam, dan lain-lain tanpa izin terlebih Desain: Andrew Esson, Baseline Arts Ltd, Oxford, UK dahulu. Isi dan materi mengenai status hukum suatu negara, wilayah, kota atau pun daerah kekuasaan, atau terkait pembatasan wilayah atau perbatasannya di dalam publikasi ini bukan merupakan ekspresi dari pendapat UNESCO. Laporan Dunia No. 2: Berinvestasi dalam Keanekaragaman Budaya dan Dialog Antarbudaya (ISBN no. 978-92-3-104000-9) telah dicetak dalam Bahasa Inggris, Perancis, dan Spanyol oleh UNESCO Publishing. Terjemahan ke dalam Bahasa Arab, Cina, Rusia, dan bahasa-bahasa lainnya sedang dilaksanakan. Ringkasan Eksekutif saat ini telah diterjemahkan ke dalam Bahasa Arab, Katalan, Cina, Belanda, Inggris, Perancis, Jerman, Portugis, Rusia, Dua orang bersepeda di dan Spanyol.dekat Arusha, Tanzania Informasi lebih lanjut dapat diperoleh di http://www.unesco.org/en/world-reports/cultural-diversity Email: worldreport2@unesco.org
    • FotoSampul (muka): 9d: © Hasim Syah 22c: © Matjaz Boncina © James Hardy/ZenShui/Corbis 10: © Mila Santova 22d: © Panos/Dieter TelemansSampul dalam-1: 11: © Panos/Jacob Silberberg 23: © Klaus Claudia Dewald © Mihai-Bogdan Lazar 12a: © Ahmed Ben Ismaïl 24: © QiangBa DanZhen1: © Panos/Sven Torfinn 12b: © Komisi Nasional Kyrgyztan untuk 25a: © iStockphoto2-3: © Panos/Jacob Silberberg UNESCO 25b: © Panos/Alfredo D’Amato2a: © T. Fernández 13a: © Panos/Chris Stowers 25c: © Yannis Kontos/Polaris2b: © F. Brugman / UNESCO 13b: © iStockphoto 26a: © Christine Gonsalves3: © Photo Edit/Jack Stein 13c: © Nando Machado 26b: © Randy Plett4a: © Panos/Jocelyn Carlin 14a: © Alamy/PjrFoto/studio 27: © Panos/Mikkel Ostergaard4b: © Rick Lord 14b: © Panos/Gary Calton 28: © Mlenny5: © Robert Churchill 15a: © Katy Anis/UNESCO 29a: © John Woodworth6a: © Institut Budaya Nasional / Dante 15b: © Justin Mott/UNESCO 29b: © iStockphoto Villafuerte 16: © R. Taurines/UNESCO 29c: © iStockphoto6b: © Komisi Nasional Afrika Tengah dan 17a: © Manoocher/UNESCO/Webistan 30: © Alamy/Alex Ramsay Kementerian Pemuda dan Olah 17b: © Jean Cliclac 31: © Brasil2 raga, Seni, dan Budaya 17c: © Joseph Fisco 32a: © Pontuse6c: © Karim Hesham 18a: © Alamy/E.J. Baumeister Jr 32b: © Alan Tobey7a: © Panos/Gerd Ludwig 18b: © Alamy/Danny Yanai 33: © Marc Sosaar7b: © Renato S. Rastrollo / NCCA -ICH / 19a: © Ugurhan Betin Brkovic 34: © Diego Féliz UNESCO 19b: © Panos/G.M.B. Akash 36: © Alamy/Nigel Pavitt7c: © Panos/Penny Tweedie 20: © Jeff Ulrich8a: © Alamy/Jochem Wijnands 21a: © Laurent Renault8b: © Panos/Alfredo D’Amato 21b: © J. Ségur / UNESCO9a: © Markus Winkel 21c: © Photo Edit/Susan van Etten9b: © Linda Wang 22a: © iStockphoto9c: © Luiz Santoz / UNESCO 22b: © Frédéric Sampson
    • Laporan Dunia UNESCOBerinvestasidalamKeanekaragamanBudaya danDialogAntarbudaya Keanekaragaman budaya mulai mendapat perhatian serius pada pergantian abad ini. Namun makna sesungguhnya dari terminologi yang luas ini sering diartikan bermacam-macam dan juga berubah-ubah. Sebagian memandang keanekaragaman budaya sebagai sesuatu hal yang positif karena bertujuan untuk berbagi kekayaan yang Ringkasan dikandung dalam tiap budaya di dunia dan, oleh karenanya, menyatukan kita semua Eksekutif melalui berbagai proses pertukaran dan dialog. Sebagian yang lain menganggap perbedaan budaya mengakibatkan hilangnya rasa kemanusiaan yang kita miliki sehingga menjadi akar dari berbagai konflik. Anggapan kedua tersebut sekarang ini menjadi semakin terbukti sejak globalisasi mengakibatkan peningkatan interaksi dan gesekan antarbudaya yang menyebabkan meningkatnya berbagai ketegangan, tarikan dan klaim yang terkait identitas, khususnya masalah agama yang dapat menjadi sumber perdebatan potensial. Oleh karena itu, yang menjadi tantangan mendasar adalah bagaimana menawarkan suatu visi yang koheren mengenai arti keanekaragaman budaya yang dapat menjelaskan bagaimana hal itu dapat bermanfaat untuk aksi masyarakat internasional, dan bukan sebagai ancaman. Hal inilah yang menjadi tujuan utama dari laporan ini. Sejak awal UNESCO telah diyakinkan akan pentingnya keanekaragaman budaya dan nilai-nilai yang terkandung di dalamnya. Dalam Konstitusi UNESCO (1945) tertulis ‘keanekaragaman budaya dunia yang saling memberi manfaat’ (‘fruitful diversity of the world’s cultures’). Pendapat ini masih sangat relevan di masa kini dan selamanya, meskipun definisi budaya telah menjadi semakin luas dan pengaruh globalisasi telah mengubah banyak hal, dibandingkan pada saat Konstitusi tersebut disahkan pada tahun 1945 pada akhir Perang Dunia Kedua.