Your SlideShare is downloading. ×
WM Dergi - 14.SAYI
Upcoming SlideShare
Loading in...5
×

Thanks for flagging this SlideShare!

Oops! An error has occurred.

×

Saving this for later?

Get the SlideShare app to save on your phone or tablet. Read anywhere, anytime - even offline.

Text the download link to your phone

Standard text messaging rates apply

WM Dergi - 14.SAYI

346
views

Published on

Bu ay Turkticaret.net kurucu ve İcra Kurulu Başkanı Murat Yanıklar ile bir röportaj gerçekleştirerek yeni ofislerinin fotoğraflarına yer veriyoruz.Röportajımızda Turkticaret.net’in bu günü ve gelecek …

Bu ay Turkticaret.net kurucu ve İcra Kurulu Başkanı Murat Yanıklar ile bir röportaj gerçekleştirerek yeni ofislerinin fotoğraflarına yer veriyoruz.Röportajımızda Turkticaret.net’in bu günü ve gelecek planları ile birlikte yeni proje ve servisleri hakkında bilgi aldık.Ayrıca Murat Yanıklar’ın sektör’e dair önemli değerlendirmelerine de röportaj sayfalarımızda yer veriyoruz.

Bununla birlikte Melih Andıç’ın “Yeni Domain Uzantıları İle Tanışma Vakti” isimli makalesi, Mehmet Burak İşçi’nin “Blog’cuların Düştüğü 5 Büyük Hata” , “Blog’unuzdaki Teknik Detayları Optimize Edin” , “SEO Dostu Tema İçin 30 İpucu” başlıklı makaleleri ve İbrahim Hızlıoğlu’nun “Fazla Bilinmeyen PHP Fonsiyonları 2” başlıklı makalesini ilerleyen sayfalarımızda bulabilirsiniz.

Ayrıca, Turkticaret.net’in okuyucularımız için hazırladığı hediye 50 TL adhood.com reklam bütçesi kuponu dağıtıyoruz.

Published in: Technology

0 Comments
0 Likes
Statistics
Notes
  • Be the first to comment

  • Be the first to like this

No Downloads
Views
Total Views
346
On Slideshare
0
From Embeds
0
Number of Embeds
0
Actions
Shares
0
Downloads
8
Comments
0
Likes
0
Embeds 0
No embeds

Report content
Flagged as inappropriate Flag as inappropriate
Flag as inappropriate

Select your reason for flagging this presentation as inappropriate.

Cancel
No notes for slide

Transcript

  • 1. 3
  • 2. İNDEX İNTERNETTEN PARA KAZANMAK İSTERKEN PARA KAYBETMEYİN Emin Doğu’nin özel makalesi SEKTÖRDEN HABERLER Web ve internet sektöründen son gelişmeler, haberler WMDB - WEB & İNTERNET TARİHİ Web ve internet tarihi hakkında özel hazırladığımız sayfalar YENİ DOMAİN UZANTILARI Melih Andıç’ın yeni domain uzantıları ile ilgili makalesi TURKTİCARET.NET - RÖPORTAJ Turkticaret.net CEO’su Murat Yanıklar ile yaptığımız röportaj BLOG’CULARIN DÜŞTÜĞÜ 5 BÜYÜK HATA Mehmet Burak İşçi’nin makalesi BLOG’UNUZDAKİ TEKNİK DETAYLARI OPTİMİZE EDİN Mehmet Burak İşçi’nin makalesi TEMMUZ 2013 WM Dergi içeriğinden öne çıkan başlıklar 6 9 28 34 38 56 60 WM İK - SEKTÖREL İLANLAR Sektörel iş ilanları ve iş arayanlar WM İK sayfalarında 70 80 İNTERNETTEN PARA KAZAN İnternet’ten para kazanma yöntemleri ve fırsatları
  • 3. GENEL YAYIN YÖNETMENİ Emin Doğu emindogu@wmdergi.com Twitter : /emindogu GRAFİK & DÜZENLEME Merve Odabaşı merveodabasi@wmdergi.com İÇERİK SORUMLUSU Erdal Tuna erdaltuna@wmdergi.com YAZARLAR Mehmet Burak İşçi mbisci@wmdergi.com İbrahim Hızlıoğlu ihizlioglu@wmdergi.com İLETİŞİM & RÖPORTAJ info@wmdergi.com REKLAM & KAMPANYA reklam@wmdergi.com SIK KULLANILANLAR sk@wmdergi.com BLOG SİTELERİ bs@wmdergi.com www.wmdergi.com WM DERGİ Geçtiğimiz ay 1. yaşımızı kutladığımız 13. sayımıza gösterdiğiniz yoğun ilgi için teşekkür ederek başlamak istiyorum.Geçirdiğimiz 1 yıllık süreçte bizi takip eden ve sürekli artan ilgilerinden dolayı siz değerli okuyucularımıza teşekkürü bir borç biliriz. Bu ay Turkticaret.net kurucu ve İcra Kurulu Başkanı Murat Yanıklar ile bir röportaj gerçekleştirerek yeni ofislerinin fotoğraflarına yer veriyoruz.Röportajımızda Turkticaret. net’in bu günü ve gelecek planları ile birlikte yeni proje ve servisleri hakkında bilgi aldık.Ayrıca Murat Yanıklar’ın sektör’e dair önemli değerlendirmelerine de röportaj sayfalarımızda yer veriyoruz. BununlabirlikteMelihAndıç’ın“YeniDomain Uzantıları İle Tanışma Vakti”isimli makalesi, Mehmet Burak İşçi’nin“Blog’cuların Düştüğü 5 Büyük Hata” , “Blog’unuzdaki Teknik Detayları Optimize Edin” ,“SEO Dostu Tema İçin 30 İpucu”başlıklı makaleleri ve İbrahim Hızlıoğlu’nun “Fazla Bilinmeyen PHP Fonsiyonları 2” başlıklı makalesini ilerleyen sayfalarımızda bulabilirsiniz. Ayrıca,Turkticaret.net’in okuyucularımız için hazırladığı hediye 50 TL adhood.com reklambütçesikuponudağıtıyoruz. Bizi izlemeye devam edin... Teşekkürler... WM DERGİ 14. SAYIVETURKTİCARET.NET 5
  • 4. 6 İnternetten para kazanmak isterken para kaybetmeyin İnternetten para kazanmak yıllardır özellikle webmasterların gündemindeki ve internet kullanıcılarının da en popüler konularından biri.Bu konuda gün geçmiyor ki yeni bir servis, kazanç yolu veya reklam şirketi türemesin. İşte bu noktada kişilerin seçici ve dikkatli olması gerekiyorçünkübuservislerin bir çoğu kısa ömürlü, kullanıcıları üzerinden para kazanarak, herhangi bir ödeme yapmadan ortadan kaybolabiliyorlar. Bu konuda başı yabancı servisler çekmekle birlikte ülkemizde de bir çok servis veya herhangi bir hukuki veya mali kaydı bulunmayan sözde reklam şirketleri de yer alıyor. Bir de Network Marketing konusu var ki,para kazanmak için önce para yatırmanız gerektiğini iddia ediyorlar. Bu aşamada da çok dikkatli olunması gerekiyor çünkü yasal iş yapanlar olabileceği gibi kayıt dışı çalışan ve üye olmak için para yatıran kişilerinparalarınıtoplayarak ortadan kaybolabilenler de olabiliyor.Bu konularda çeşitli şikayet ve mağduriyetleri webmaster forumlarında oldukça fazla görebilirsiniz.Peki nelere dikkat etmek ve neye göre seçim yapmak gerekiyor? Emin DOĞU Webmaster Dergi Genel Yayın Yönetmeni Twitter: /emindogu emindogu@wmdergi.com
  • 5. 7 Ben, kişisel olarak izlediğim yola göre size tavsiyelerde bulunacağım, tabii ki bunlar değişkenlik gösterebilir, her servis veya reklam platformu için geçerli olmayabilir veya siz farklı yollar da izleyebilirsiniz. Hakkımızda sayfasını inceleyin İlgili servis veya reklam şirketinin web sitesine girdiğinizde, “Hakkımızda” sayfasını inceleyin.Kim oldukları, ne zamandan beri bu işi yaptıkları, başka ne tür işler yaptıkları, adres, telefon ve ticari bilgilerinin bulunup bulunmadığına göz atın. Kayıt dışı veya bireysel olarak bu işi yapanların “Hakkımızda” sayfalarında bu gibi bilgiler genellikle yer almazyadahiçbilgibulunmaz veya klasik tanıtım metinleri yer alır. Site adresine dikkat edin Bu servis veya reklam platformlarının site adreslerine dikkat edin. Domain uzantısı .org,.info,.in, .tk, .us vb. olanlar genellikle bireysel yapılardır veya kayıt dışıişyaparlar.Budailerleyen dönemde her an ortadan kaybolabileceği anlamına gelebilir.Yasal olarak bu işi yapan şirketlerin genellikle domain uzantıları .com.tr şeklinde olur veya .com, .net kullanabilirler. Site tasarımını inceleyin Site yapısı, tasarımı veya içeriği de oldukça önemli bir referans noktası olabilir. Doğru düzgün çalışmayan, eksik,hatalar barındıran veya yeterli bilgi ve açıklamalar barındırmayan web sitelerine güvenmeyin veya temkinli yaklaşarakgerekirseiletişime geçin ve detaylı bilgi isteyin. Araştırma yapın İncelemekte olduğunuz servis veya reklam platformu hakkında internette, webmasterforumlarındaveya blog sitelerinde araştırma yapın.Farklı kullanıcıların yaşadıkları mağduriyet veya sıkıntılar olup olmadığı konusunda bilgi bulmaya çalışın. Kimseye araştırmadan ödeme yapmayın Üyelik için ödeme yapmanızı gerektiren servis veya reklam platformlarına sorgusuz sualsiz ödeme yapmayın veya para göndermeyin.Öncelikle üstte bahsettiğim konularda araştırmayaparakbilgiedinin sonrasında güven duymanız halinde kendi tercihleriniz doğrultusunda dilediğiniz işlemi yapabilirsiniz. Değerlendirme Tabii ki bu yazdıklarım sizi gelecekte sorun y a ş a m a y a c a ğ ı n ı z ı n da garantisini vermez ancak büyük oranda mağdur olmanızı veya dolandırılmanızıönleyecektir. Hiç olmazsa bilgi sahibi olarak bilinçli bir şekilde karar vermenizi sağlayacaktır. Ayrıca benim anlam veremediğim ve belirtmeden geçemeyeceğim bir nokta da, üyelik için 50 - 100 TL vb. ödeme alan ve bir çok üyesi bulunan bazı sistemlerin sağlıklı bir kontrol paneli olmadığı, hatta satış/kazanç vb. bilgileri de Google Docs veya Excel aracılığı ile sunduğunu da bir çok kere gözlemledim.Bu alınan paralardan 30-40 TL ’sini işe yatırsanız, bir ortaklık scripti lisansı alsanız olmaz mı? Bu nasıl iştir? Para vermeden üye olunan sistemler bile bir kontrol paneline sahip.
  • 6. 39972305
  • 7. BİLGİ Genç Sosyal Girişimci Ödülleri, toplumda pozitif değişime ön ayak oluyor Toplumda pozitif değişim yaratmak isteyen gençleri desteklemek ve güçlendirmek üzere bu yıl dördüncü kez düzenlenen BİLGİ Genç Sosyal Girişimci Ödülleri’ne başvurular başladı. Türkiye’de yaşayan 18-29 yaş arasındaki tüm genç sosyal girişimcilere açık olan yarışmanın son başvuru tarihi 29 Ekim 2013. BİLGİ Genç Sosyal Girişimci Ödülleri, içinde bulundukları toplum için pozitif değişimin liderliğini üstlenen gençlere destek olmaya ve güçlendirmeye devam ediyor. International Youth Foundation (Uluslararası Gençlik Vakfı), Sylvan/Laureate Foundation (Sylvan/Laureate Vakfı) ve Türkiye Eğitim Gönüllüleri Vakfı (TEGV) işbirliği ile hayata geçirilen ve İstanbul Bilgi Üniversitesi tarafından yürütülen BİLGİ Genç Sosyal Girişimci Ödülleri’yle girişimci gençlerin organizasyonel ve sosyal alanlarda liderlik becerilerini geliştirmeleri teşvik ediliyor. Daha önceki yıllarda olduğu gibi bu yıl da yarışmada finale kalan 10 adaya 3.500 Amerikan Doları maddi/nakdi destek verilecek ve bu adaylar Youthactionnet®, tarafından yapılan “Küresel Genç Sosyal Girişimciler” programına da katılma hakkı kazanacak. Yarışmanın son başvuru tarihi 29Ekim2013.Yarışma,mevcut bir projenin/organizasyonun kurucusu/kurucu ortağı ya da bir organizasyon adına proje lideri olan gençleri hedefliyor. Sürdürülebilir olması planlanan ödüllerle, aynı zamandabilgivetecrübelerini birbiriyle paylaşan ve her yıl daha da büyüyen bir sosyal girişimci ağı oluşturulması için çalışılıyor. Seçilen genç sosyal girişimciler, liderlik vasıflarının geliştirilmesi ve topluma sağladıkları faydanın sürdürülebilmesi için mentor desteği de alıyor. Başvuru süreci BİLGİGençSosyalGirişimci Ödülleri’ne başvurular www. bilgiggo.org adresinden yapılabiliyor. Online başvuru formunda talep edilen kişisel bilgiler ve proje ile ilgili detaylar BİLGİ Genç Sosyal Girişimci Ödülleri Değerlendirme Komitelerinin dikkatinesunulacakveadaylar mülakattan geçirilecek. 5 Kasım 2013 tarihinde açıklanacak 20 yarı finalist için 9-10 Kasım 2013’te liderlik, dinamik birebir öğrenme, işbirliği ve gençler arasında vizyon paylaşımı eğitimleri düzenlenecek. 12 Kasım 2013’te 10 finalistin açıklanmasının ardından 9 Aralık 2013’te finalist eğitimleri gerçekleşecek ve ödüller 12 Aralık 2013’teki törende sahiplerini bulacak. 9
  • 8. KOBIL yazılım çözümü sayesinde bankalar Avrupa güvenlik yönergelerine uyum gösterebilecek. Veri ve dijital kimlik sektöründe yenilikçi güvenlik çözümlerinin üreticisi KOBIL, aynı zamanda ödeme süreçlerini güven altına alan kullanıcı dostu, yenilikçi ve modüler platform teknolojisinin dünyadaki tek tedarikçisi konumunda.KOBİLUygulama Güvenliği Teknolojisi (AST), Avrupa Merkez Bankası yönergelerinin gerektirdiği bileşenler de dahil olmak üzerebasitvedüşükmaliyetli güvenlik bileşenlerini bir araya getirerek, birleşik Avrupa tek ortak ödeme yönetimine (SEPA) dahil parasal işlemlerini daha verimli hale getiriyor. KOBIL Systems, KOBIL AST ürünü ile, Avrupa Tek Ortak Ödeme Bölgesi ödeme işlemlerini bilgisayar korsanlarına karşı uygun ve düşük maliyetli bir yöntemle koruyabilen, dünyanın tek çözümünü sunuyor. AST, bir yazılım çözümü olması sayesinde kullanıcıların akıllı telefonlarını ek bir cihaz gerektirmeden çift faktörlü bir kimlik doğrulama çözümüne dönüştürüyor. AST çözümü Avrupa Merkez Bankası’nın talep listesinde yer alan çift faktörlü kimlik doğrulama gereksinimini sunuyor. AST geleneksel online bankacılığın yanı sıra mobil ödeme ve güvenli mesajlaşma gibi yeni alanlar da dahil olmak üzere tüm platformlar ve tüm cihaz tiplerindeçalışıyor.ASTayrıca bankalara Avrupa güvenlik yönergelerini,Avrupa Merkez Bankası kriterleri ile uyumlu olacak şekilde kolayca ve hızlıca yerleştirebilme fırsatı sunuyor. Söz konusu kriterler arasında son kullanıcı için güçlü kimlik doğrulama (çift faktörlü kimlik doğrulama), kullanıcı kimliğini tespit, işlem takibi ve hassas ödeme verilerinin korunması yer alıyor. 10
  • 9. 11 Daha önceki senelerde “Tart Yaz Kampı” olarak bilinen ve gelenekselleşen Tart New Media’nın yazlık eğitimleri yeni bir isim ve yapılanma ile devam ediyor. Sıradışıbirkuluçkamerkezi olarak fikirleri kendi içinde geliştiren, tohum yatırımını yapan ve yeşermesinde rol alan çalışanlarını fihjbhkrin ortağı haline getirerek “sahil kasabasına yerleşme” hayallerine destek olan Startup Kitchen, “eğitimle önü açılan parlak zihinlerin dünyayı değiştireceğine”olan inancınıbuyazdüzenleyeceği ücretsiz yaz kampı ile pekiştiriyor. Geçtiğimiz ayın sonunda yaz kampı için başvurular başlamıştı. Şimdi ise eğitim programını da açıklayan Startup Kitchen eğitmen kadrosu, bu sene bir değişikliğe giderek 2 farklı program hazırladı. İki farklı yaz kampı Geçtiğimiz senelerden farklı olarak bu sene iki farklı eğitim programı hazırlayan Startup Kitchen,kampa kabul edilecek gençlere “Teknoloji” ve “Kullanıcı Deneyimi” alanlarında eğitim sunacak. Eğitimsonundaiseinandıkları bir projede çalışma imkanı sunarak hayal ettikleri işlere sahip olmalarını sağlayacak. İlk eğitim kampının adı “Teknoloji Kampı” ve 1 Temmuz’da başlıyor. 8 hafta sürerek 23 Ağustos’ta mezunlarını verecek olan bu kampta “Debugging, HTML5 ve CSS3 Temelleri, Google Closure Kütüphanesi, UML Diagramları ve Veritabanı Temelleri” gibi birçok konuyu içeren detaylı bir teknoloji eğitimine ücretsiz olarak katılabilirsiniz. İkinci eğitim kampının adı ise“UXKampı.”15Temmuz’da başlayacak olan bu ikinci kamp toplam 6 hafta sürecek ve yine 23 Ağustos günü sona erecek.Verilecek dersler arasında “Veri toplama ve Analiz Yöntemleri”, “İnsan Bilgisayar Etkileşimi”, “Bilgi Mimarisi ve Ticari Modeller” gibi konularda, konuların uzmanlarından kapsamlı eğitimlere ücretsiz katılma şansını yakalayabilirsiniz. Eğitim detayları ve başvuru süreci Tüm eğitim detaylarına, derslerin içeriklerine ve eğitmenlere http:// startupkitchen.co/egitim adresinden ulaşabilirsiniz. Başvurularınız için ise http://startupkitchen.co/ hemen-basvuradresiniziyaret edebilirsiniz. Startup Kitchen ile ilgili görüşlerini açıklayan Startup Kitchen Program Yürütücüsü Emrah Olgun, “Biz insanların ne okudukları ya da kim olduklarıyla değil, potansiyelleriyle ilgileniyoruz. Kamplara şu ana kadar mühendislikten sosyal bilimlere kadar çok çeşitli alanlarda eğitim almış toplamda 1000’e yakın kişi başvurdu. Dolayısıyla yaşadığımız çağın çocukken bize dedikleri gibi ‘uzay çağı’ değil, ‘siber uzay çağı’ olduğunu bilen; etkileşim tasarımı, yazılım geliştirme ve ürün tasarımı dendiğinde gözleri parlayan tüm yeni mezun ve üniversite son sınıf öğrencileri kampa başvurabilir”dedi. Startup KitchenYaz Kampı programı belli oldu!
  • 10. 12 w w w. i k i n c i e l . c o m , internetteilanvermekisteyen kullanıcılarına özel olarak geliştirdiği Türkiye’deki ilk ve tek mobil ilan uygulamasıyla e-ticaret alanında faaliyet gösteren rakipleri arasından sıyrılıyor. Daha çok oto galericilerin ve emlakçıların kullanması için tasarlanan ve uygun fiyat ve taksit imkânlarıyla, yıllık 1.290 TL’ye alınabilecek “Mobil Mağaza” uygulaması, Android ve iOS işletim sistemlerine sahip cep telefonlarıyla uyumlu çalışıyor. Eski alışkanlıklar ile yeni nesil ticari platformların birleştiği aktif bir ilan ve alışveriş sitesi olarak her geçengünadınıduyuranwww. ikinciel.com,mobil cihazlarda sunduğu “Mobil Mağaza” uygulaması ile ilan vermek isteyen kullanıcılarının, kişiselleştirilmiş mobil mağazaları aracılığıyla daha geniş bir kitleye ulaşmasını hedefliyor. Türkiye’de ilk kez mobil ilan ve mobil mazağa uygulamasını hayata geçiren www.ikinciel.com ‘un kurucu ortağı Burak Akgül, “E-ticaret ve online alışveriş hayatımıza bu kadar girmişken,her geçen gün bağlılığımızın arttığı ve yanımızdan ayırmadığımız tablet ve akıllı telefonları web sitemizin altyapısından ayrı tutamazdık. Bu nedenle k u l l a n ı c ı l a r ı m ı z ı n , kişiselleştirme üzerine ç a l ı ş m a l a r ı m ı z ı sürdürdüğümüz ve oluşturduğumuz bu sosyal platformda çok daha aktif bir şekilde iletişim kurmalarını ve satış yapmalarını sağlayabilmek adına ‘Mobil Mağaza’ uygulamasını geliştirdik. ikinciel.com’dan Türkiye’de ilk ve tek “Mobil Mağaza” fırsatı
  • 11. 13 Artık herkes, www. ikinciel.com’da mağaza sahibi olarak Android ve iOS işletim sistemine sahip cep telefonlarında firmalarının logosuyla kendilerine özel ikon ve önyüz tasarımı yaparakmobiluygulamamızın a v a n t a j l a r ı n d a n yararlanabilecek”diyor. IOS ve Android işletim sistemli cep telefonlarında halihazırda mevcut olan uygulama, bu yaz sonunda IOS ve Android tabletler ile Microsoft telefon ve tabletler için piyasaya sunulacak. Uygulamanın yeni versiyonu için ek ücret ya da fiyat değişikliği söz konusu olmayacak. Mobil Mağaza kullanıcılarına ne tür avantajlar sağlıyor? · Firmaların iPhone ve Android işletim sistemli mobil telefon kullanan tüm müşterileri, online mağazaların uygulamasını marketten indirebiliyor. · Firmalar ilanlarını müşterilerine ulaştırmak için yer ve mekandan bağımsız olabilecek. · Firmaların kendi mobil uygulamaları, eski ve yeni çıkan tüm Android mobil cihazlar ile tüm iPhone versiyonlarında sorunsuzca çalışabilecek. · Mobil uygulamaya sahip firmalar, sektörün bir adım önünde oldukları için daha prestijli bir iş sürecine dahil olacaklar. · Firmaların www.ikinciel. comadresindeyeralanonline mağazalarına ekledikleri ilanlar anında firmaların mobil uygulamalarında görüntülenebilecek. · Mobil cihazlarının GPS özelliğini kullanan müşteriler, bulundukları noktadan firma ilanının bulunduğuyereya da firmanın çalışma ofisine yol tarifiyle yönlendirilebilecek. · Firmaların müşterileri, mobil uygulama üzerindeki ilan detaylarında yer alan telefon numaraları ile çalışma ofisini veya firmaya ait telefon numaralarını uygulamadan çıkmadan anında arayabilecek. · Mobil uygulama, firmaların marka bilinirliğini artırarak pazarda daha prestijli bir yer edinmesine, pazarlama faaliyetlerinin düşük maliyetlerle yürütülmesini sağlayacak.
  • 12. 14 İngilizTelecityGrouptarafındansatınalınanSadeceHosting iletişim faaliyetlerini Marjinal Porter Novelli ile yürütecek 2005 yılından beri bilişim sektöründe faaliyet gösteren, barındırma ve veri merkezi pazarında lider konumdaki şirket SadeceHosting, iletişim faaliyetlerini bundan böyle Marjinal Porter Novelli ile yürütecek. Mayıs 2013’te Avrupa veri merkezi pazarının lideri TelecityGroup tarafından 29 milyon sterlin bedelle satın alınan SadeceHosting, alan adı, barındırma, web sitesi, bulut, e-posta, SSL, sunucu, CDN ve VPN gibi hizmetlerini bireysel ve kurumsal müşterilerine sunan SadeceHosting, çözüm odaklı bir çalışma anlayışını benimsiyor.Uzmanekipleriile 7 gün 24 saat müşterilerine destek sunan SadeceHosting, 60 Gbit kullanım oranına sahip, Türkiye’deki en büyük veri merkezi altyapısını da müşterilerinin hizmetine sunuyor. Avrupa verimerkezi pazarının lider firması TelecityGroup’un bir parçası olarak Türkiye ve bölge pazarına ciddi bir yatırım planlayan SadeceHosting, kısa vadede yapılacak bu atılımların kamuoyu ile paylaşılmasürecindeMarjinal Porter Novelli ile çalışacak. SadeceHosting Genel Müdürü Selçuk Saraç, Marjinal Porter Novelli ile gittikleri işbirliği konusunda şunları söylüyor: “Bölgesel liderlik hedefi olan bir şirket olarak, uluslararası bir ağda birçok küresel müşteriye hizmet veren Marjinal Porter Novelli ile çalışacağımız için çok mutlu ve heyecanlıyız. Amacımız müşterilerimize sunduğumuz dünya standartlarındaki hizmetlerin avantajlarını tüm Türkiye’ye vedünyayatanıtmakvebilişim sektöründeki uzmanlığımızla birey ve kurumları teknoloji ile tanıştırmaktır. Marjinal Porter Novelli’nin hemyerelhemdeuluslararası alanda sahip olduğu tecrübeyle bize bu alanda çok önemli katkı sağlayacağına inanıyoruz.”
  • 13. 15 SadeceHosting Satış ve Pazarlamadan sorumlu Genel Müdür Yardımcısı Emre Narin şunları söyledi: “TelecityGroup’un oldukça geniş bir küresel müşteri portföyü bulunuyor. Bunların arasında Fortune 500 şirketlerinin önemli bir bölümünün yanı sıra internet ve bilişim sektörlerinin tüm önemli oyuncuları mevcut. BT, Orange, Vodafone, China Telecom ve AOL gibi dev hizmet sağlayıcılarının yanında Barclays, Ernst & Young gibi finans şirketleri, HP, Tsystems ve Atos gibi yükletici firmalar Telecity müşteri portföyünde yer alıyor. Türkiye’de ve Türkiye’nin bulunduğu bölgede bu işbirliklerini duyurmak için Marjinal Porter Novelli’nin en doğruiletişimortağıolduğunu düşünüyorum.” Marjinal Porter Novelli Ajans Başkanı Asuman Bayrak, ise şu açıklamayı yapıyor: “SadeceHosting, yalnızca 8 yıllıkbirsüredekendialanında pazar lideri konumuna gelmiş, dünyanın önemli bilişim şirketi TelecityGroup bünyesine de dahil olmuş çok önemli bir şirket. İnovasyon yaratan, katma değer üreten ve gerek bireylerin gerekse kurumlarınBTmaliyetlerinden tasarruf etmesini sağlayan SadeceHosting’in avantajlı ürün ve çözümlerini tanıtacak olmaktan büyük bir mutluluk duyuyoruz.” Webrazzi Summit’13 biletleri satışta! 25 Eylül 2013 tarihinde Swissotel The Bosphorus, İstanbul’da gerçekleşecek Webrazzi Summit’in erken kayıt indirimli biletleri şu an itibariyle satışta.Normal bilet fiyatı 600 Euro olan konferansın, erken kayıt döneminde indirimli bilet fiyatları 400 Euro olarak belirlenmiştir. Ağustos ayından itibaren ise bilet fiyatları 500 Euro ve devamında Eylül ayında 600 Euro olacaktır. Webrazzi Summit’teki yerinizi erken kayıt indiriminden faydalanarak ayırtmak istiyorsanız, hemen summit.webrazzi. com adresinden kaydınızı gerçekleştirebilirsiniz.
  • 14. Etohum, Azerbaycan’daki ilk toplantısını 5-6 Temmuz tarihlerinde Azercell, Azercell’in inkubasyon merkezi Barama, Infipro VC, Elektron Höküm?t (E-gov.az), Nuush ve High Tech park sponsorluğunda Azerbaycan’ın başkenti Bakü’de gerçekleştiriyor. Yeni ekonomiyle ilgili bilgi ve iş fikri sahibi olan girişimcilerle bu konuda yatırım yapabilecek şirket ve profesyonelleri buluşturmayı hedefleyen Etohum, bu kez de Türkiye sınırlarını aşarak Türkiye’deki yatırımcıları Azerbaycan’daki girişimcilerle buluşturuyor. Türkiye’deki başarılı internet yatırımlarıyla öne çıkan yatırımcılar,Kafkaslar’ın en büyük şehri ve en önemli kültür-ticaret merkezi olarak bilinen Bakü’de gerçekleştirilecek toplantıda, Azeri girişimcilere mentorluk yapacak ve internet alanındaki yatırımlarıyla ilgili tecrübelerini katılımcılara aktaracak. Nokta Medya CEO’su Tümay Asena, Akakce kurucu ortağı Koray Karataş ve Etohum’dan Kerim Türe’nin panelde konuşmacı olarak katılacağı, Etohum kurucusu Burak Büyükdemir’in ise “Etohum ve Türkiye İnternet Ekosistemi” başlıklı konuşmasıyla yer alacağı ilk toplantının hedefi ise, Azerbaycan’daki ekosistemle tanışmak ve iki ülke arasındaki işbirliği fırsatlarını konuşmak. Tanışma ve sohbet aralarıyla zenginleştirilecek olan toplantıya Türkiye’den katılmak isteyen internet girişimcilerinin,www.etohum. com/etkinlik/etohum- azerbaycan adresinde yer alan katılım formunu doldurmaları gerekiyor. Etohum etkinliğinin web sitesinde yayınlanan program detayları ise şöyle: Etohum Azerbaycan Programı 5 Temmuz Cuma 18:30–18:45–Hoşgeldin konuşması 18:45 – 20:30 – Networkingsaatleri(eTohum/ konuklar / girişimler) 6 Temmuz Cumartesi 09:30 – 09:45 – Kısa bilgilendirme ve açılış 09:45–11:00–Mentorlük bölümü (Girişimcilere 20’şer dk mentörlük koçluk) 11:00 – 11:15 – Kısa networking arası 11:15–12:30–Mentorlük bölümü (Girişimcilere 20’şer dk mentörlük koçluk) 12:30 – 14:00 – Öğle yemeği 14:00 – 14:40 Etohum ve Türkiye İnternet Ekosistemi – Burak Buyukdemir –eTohum 14:45 – 15:30 Panel: Başarılı girişimler nasıl oluşturulur? Moderatör: Burak Buyukdemir Tümay Asena – Nokta Medya CEO Koray Kabataş – Akakce kurucusu Kerim Türe –Etohum 15:30 -16:00 – Kapanış Konuşması (eTohum, Ministry of Communication and Information Technology, Azercell/Barama) 16:00 – 16:30 – Networking 16 Etohum bu kez de Azerbaycan’a adım atıyor!
  • 15. #wmdergi takipte kal
  • 16. Ülkemizde kredi kartı kullanımınınyaygınlaşmasıyla internet üzerinden yapılan alışverişler de arttı. Dolayısıyla e-ticaret sektörü istihdamda dikkate değer rakamlara ulaşmaya başladı. Yenibiris.com verilerine göre e-ticaret sektöründe eleman ihtiyacı son 6 ayda, bir önceki döneme göre yüzde 150 oranında artış gösterdi.En çok aranan pozisyon ise kategori yöneticisi.Kredi kartlarının yaygın kullanımı, ürün çeşitliliği, kıyaslama imkanı, kapıda ödeme, gelişmiş güvenlik önlemleri gibi faktörler e-ticaret sektörünün hızlı büyümesine katkıda bulunuyor. Yaklaşık 36 milyon internet kullanıcısının olduğu Türkiye’de özellikle lojistik hizmetlerinin gelişmiş olması da sektöre ilgiyi artırıyor. Bankalararası Kart Merkezi verilerine göre Türkiye e-ticaret sektörü 2012 yılını toplamda 30,6 milyar TL’lik hacimle kapattı. Bu sayı, 2011’e göre yüzde 35 daha fazla. Bir işletmede bulunan operasyon, satınalma, pazarlama, muhasebe, finans, bilgi teknolojileri gibi birimler e-ticaret şirketlerinde de bulunuyor ancak süreçler internet üzerinden olduğu için pazarlama alanında çalışacaklarda dijital pazarlama deneyimi aranıyor. Yenibiris.com verilerine göre e-ticaret sektöründe eleman ihtiyacı son 6 ayda, bir önceki döneme göre yüzde 150 oranında artış gösterdi.En çok aranan pozisyon ise kategori yöneticisi. E-ticarette en çok aranan 5 pozisyon ise şöyle: 1.Kategori yöneticisi 2. Grafik/Web tasarım uzmanı 3.Yazılım uzmanı 4.Web arayüz geliştirici 5.Mobil yazılım uzmanı Diğer sektörlere göre çalışanların yaş ortalamasının düşük olduğu e-ticaret, üniversiteden yeni mezun olmuş gençlere çok açık bir sektör. Nispeten rahat çalışma ortamı, yaratıcılığın teşvik edilmesi, çoğunun genç girişimciler tarafından kurulmuş olması, bazı pozisyonlarda deneyim şartı aranmaması gençleri cezbediyor.Firmalardakendini geliştiren, yaratıcı, o şirket ve pozisyonda çalışmaya istek duyan gençleri tercih ediyor. 200 bin çalışan Sektörün yaklaşık yüzde 90’ını bünyesinde bulunduran Elektronik Ticaret İşletmecileri Derneği’ne (ETİD) göre sektörde reklam ajansları, lojistik gibi üçüncü parti şirketlerle birlikte yaklaşık 200 bin kişi çalışıyor. ETİD Yönetim Kurulu Başkanı Hakan Orhun bu yıl yüzde 20’lik istihdam artışı beklediklerini, lisans düzeyinde eğitimin yetersiz olmasından dolayı kalifiye eleman sıkıntısı yaşandığını söylüyor ve ekliyor: “En çok da e-ticaret bilen yazılımcı bulmada sıkıntı yaşanıyor. Kategori uzmanı ya da marka müdürü, arama motoru reklamcılığı, dijital pazarlama, iş geliştirme uzmanları öne çıkan pozisyonlar arasında. Sektörde hem belirli pozisyonlar ortaya çıkıyor hem de var olan pozisyonlar değişim gösteriyor. Örneğin son zamanlarda performans pazarlama uzmanlarına ihtiyaç arttı.” E-ticarete 40 bin kişilik istihdam 18
  • 17. “Php yazılım mühendisleri arıyoruz” Bünyesinde300kişiçalışan Limango.com.tr, arabulvar. com, OGLI e-Solutions Platform şirketlerinin İnsan Kaynakları Direktörü Ela Bilgin, özellikle hızla büyüyen bilgi teknolojileri (IT) ekipleri için en çok PHP yazılım mühendislerine ihtiyaç duyduklarını söylüyor ve sektördekiistihdamkonusunda şunları vurguluyor: “Sektörün daha da büyüyeceğini öngörerek,satın alma/kategori yönetimi departmanlarını güçlendirmek için kategori yöneticileri yetiştireceğiz. İş hacminin artması lojistik operasyonları tarafında da insan kaynağı ihtiyacını doğuracak. İşe alımlarda deneyim dışında, kişilerin şirket kültürümüze uyum sağlayıp sağlayamayacağına da önem veriyoruz. O nedenle birçok pozisyonda e-ticaret alanında deneyimden daha çok, çalışma hevesi, heyecanı, şirket kültürüne uygunluk ve aranılan pozisyon için yeterliliğin olması bizim için daha öncelikli.” “70 kişi alacağız” Modadan elektroniğe birçok kategoride ürün satışı yapan n11.com firmasında 160 kişi çalışıyor. Bu sayıyı yıl sonuna kadar 230’un üzerine çıkarmayı planladıklarını söyleyen İnsan Kaynakları Müdürü Pelin Buruk, Ar- Ge yatırımları ve mobil uygulamalar ekibine yazılım mühendisleri, iş analistleri ve sistem/veritabanı yöneticileri alacaklarını belirtiyor. Firmada deneyimsiz gençlere yönelik bir eğitim programı uygulanıyor ve yeni mezunlar, mevcut çalışanların yüzde 25’ini oluşturuyor. En çok kategori yönetimi alanında çalışmakla birlikte, pazarlama, satış planlama gibi diğer alanlarda da görev alıyorlar. Pelin Buruk, sektörde öne çıkacak meslekleri şöyle anlatıyor: “Önümüzdeki 3-5 yıl içinde sektör giderek daha yoğun bir şekilde bireyin farkındaolduğuyadaolmadığı tüm ihtiyaçlarını belirlemeye ve buna yönelik çözümleri bireye doğrudan sunmaya odaklanacak. Bu yönde teknolojiler geliştirmede rol alacak,kullanıcı deneyimi ve iş zekası konularında kendilerini geliştirmiş mühendislere çok fazla ihtiyaç olacak. Entegre pazarlama iletişimi önem kazanacak, bu nedenle dijital pazarlama ile birlikte ATL (Above The Line)/BTL (Below TheLine),PR(PublicRelations) ve SNS (Social Network Service) alanlarında da yetkin profesyoneller öne çıkacak.” “Alımlarımızın yarısı yeni mezun” 500 çalışanı olan Hepsiburada.com bünyesine ağırlıklı bilgi teknolojileri, kategori ve operasyon birimlerine olmak üzere bu yıl 100 kişi daha katılacak. İşe alımların yarısını yeni mezunların, geri kalanını en az birkaç yıl deneyimli kişilerin oluşturduğunu söyleyen Doğan Online İnsan Kaynakları Grup Başkanı Seda Kayrak, “Yazılımda mobil deneyimi olan, kategoride sanal mağazacılık bakış açısına sahip, web tasarımda ise müşteri deneyimini dikkate alanadaylarbulmakiçinsektör oldukçazamanharcıyor.Bunun dışında, operasyon (depo ve çağrı merkezi) alanında açılan pozisyonlardaki uzmanlık ihtiyacı, e-ticaret yapan firmaların operasyon sürecinin farklı bir yönetim yaklaşımı gerektirmesinden kaynaklanıyor. Bundan kasıt, direkt birinci müşteriye hizmet veren depo alanlarının, ürünü sevk etmeden önce, kısa bir süre depolanmasını sağlayan bir dağıtım merkezi olarak çalışması”diyor. 19
  • 18. Türkiye’nin en prestijli bilişimaraştırmasınınsonuçları açıklandı. AnadoluBilişim,“Veri Merkezi - Barındırma Yönetim Hizmeti Hizmet Sağlayıcı” kategorisinde 1. oldu. Ödülle birlikteTier III uyumluAnadolu Bilişim Data Center’ın başarısı da tescil edilmiş oldu. Bilişim sektörünün referans niteliğindekiyayınıolanBilişim 500 araştırmasının sonuçları 24 Haziran 2013 günü Grand Cevahir Kongre Merkezi’nde gerçekleştirilen törenle açıklandı. İnterpromedya tarafından bu yıl 14. kez gerçekleştirilen prestijli araştırmada Anadolu Bilişim, “Veri Merkezi - Barındırma Yönetim Hizmeti Hizmet Sağlayıcı” kategorisinde 1.’lik ödülünü kazandı. Müşterilerine kesintisiz ve güvenli hizmet sunma ilkesi ile faaliyet gösteren Anadolu Bilişim Data Center ISO 20000 BTHizmetYönetimSistemi,ISO 27001 Bilgi Güvenliği Yönetim Sistemi, PCI DSS Ödeme Kartı Veri Güvenliği Sistemi ve Tier III standartlarıyla uyum içerisinde çalışıyor. Bu kapsamda Anadolu Bilişim Data Center’da hem fiziksel güvenlik hem de veri güvenliği üst seviyede sağlanıyor ve tüm hizmet süreçleri ISO 20000 BT Hizmet Yönetim Sistemi ile uyumlu şekilde yürütülüyor. Ödül ile ilgili Anadolu Bilişim Hizmetleri İcradan Sorumlu Yönetim Kurulu Üyesi Bülent Gönç şu açıklamayı yaptı: “Anadolu Grubu’nun vizyoner bakış açısı ve yatırımlarınınbirsonucuolarak 2010 yılında hizmete açılan ve kısa bir süre içerisinde sektörün önde gelen veri merkezi olan Anadolu Bilişim Data Center’ın uluslararası standartlarda sunduğu hizmet ve gösterdiği başarının Bilişim 500araştırmasıiletescillenmiş olmasının gururunu ve sevincini yaşıyoruz. Anadolu Bilişim olarak veri merkezi hizmetlerinde tescillenen başarımızı, müşterilerimize daha iyi hizmetler sunabilme adına daha da ileri boyutlara taşımayı hedefliyoruz.” Anadolu Bilişim, Bilişim 500’de “Veri Merkezi - Barındırma Yönetim Hizmeti Hizmet Sağlayıcı” kategorisinde 1. oldu! 20
  • 19. Aslanoba Capital ve 212 Ventures, kısa dönemli ev kiralama platformu HemenKiralik.com’a 2,5 milyon dolarlık yatırım yaptı Kısa süreli konut kiralama alanında lider platform HemenKiralik.com, kuruluşunun üzerinden henüz 1 buçuk yıla yakın bir süre geçmesine rağmen 4 milyon dolara yakın yatırım almayı başardı. Ayda ortalama 10 bin yeni kiralık konut ilanının eklendiğisite60ülkede,esnek sürelerde konut kiralama imkânı sunuyor. Esnek süreli konaklama şartlarıyla ev, villa ya da apartman dairesi kiralamak isteyenleri mülk sahipleriyle buluşturan online platform HemenKiralik.com, Aslanoba Capital ve Hollanda merkezli 212 Ventures Capital’den yaklaşık 2,5 milyon dolar tutarında yatırım alarak hızlı büyümesini sürdürdü. HemenKiralik.com’un bundan sonraki hedefi ise Türkiye’nin yanı sıra Orta Doğu ve Kuzey Afrika gibi yükselen pazarlarda büyümek. Ayda ortalama 10 bin kiralık ev ilanına yer veren site, Doğu Avrupa ve Rusya pazarlarına da girmeyi planlıyor. 1 yıllık sürede 4 milyon dolara yakın yatırım Toplamı 1 milyon dolara yakınilkveikincituryatırımları, 212, Fahri Diner ve Teruhide Sato gibi yatırım fonu ve melek yatırımcılar tarafından yapılan HemenKiralik. com, son yatırım hamlesi ile birlikte 4 milyon dolara yakın finansman sağlamış oldu.. Halihazırda 40 kişilik çalışan kadrosu bulunan ve aldığı yatırımlarla insan kaynağınınyanısırateknolojik altyapısını da geliştirecek olan HemenKiralik.com, Türkiye’de büyük bir hızla büyüyen alternatif konaklama sektörünün de lokomotifi konumuna geldi. 1 yılda bölgeye yayıldı Turizm ve yazılım alanlarında deneyimli Remi Onur,MehmetÜlkü,AlperKaya ve Okan Barlas tarafından kurulan HemenKiralik.com, her geçen gün popüleritesi artan alternatif konaklama hizmetinin Orta Doğu ve Kuzey Afrika bölgelerine de yayılmasında önemli rol oynuyor. Ocak 2012’de hizmete açılan HemenKiralik. com’un ardından İngilizce, Rusça ve Arapça konuşulan ülkelere yönelik flat4day. com, domiknaden.ru ve shokakonline.com sitelerini faaliyete geçiren grup, söz konusu bölgelerde yerel destek sağlıyor. Dünyanın en önemli 5 turizm destinasyonundan biri olan Türkiye’yi kendisine merkez olarak alan şirket, bu yönüyle yurtdışındaki rakiplerine karşı avantaj sağlıyor. HemenKiralik.com Kurucusu ve CEO’su Remi Onur, konuyla ilgili şunları söylüyor: “Türkiye toplam 53 milyon yerli/yabanci turist sayısıyla yalnızca bir turizm ülkesi olmakla kalmıyor, aynı zamanda bölgenin en büyük ve en güvenilir pazarı olarak da öne çıkıyor. Yüzde 60’lara varan kredi kartı penetrasyon oranı ve Avrupa’nın internet kullanımı en yaygın 5. nüfusuna sahip ülkemizde, tüketiciler internette topluluklar oluşturmaya ve online ortamda harcama yapmaya alışıklar. Türkiye bu nedenle Ortadoğu ve Kuzey Afrika’nın yanı sıra çevremizdeki diğer gelişen pazarlara da yayılmamız için stratejik öneme sahip.” 21
  • 20. Arama motoru Geliyoo haber Rss servisini yayına açtı Arama Motoru Geliyoo’nun Türkiye’de Big Data konusundaki gelişmeleri parmak ısırtıyor, Türkiye’de dünya ile aynı anda Big Data veCloudaltyapısınıkullanarak bir çok servisi hayata geçiren Geliyoo Arama Motoru yeni bir servisi daha yayına açtı,. Güncellemeleri devam eden Haber servisinde Rss bağlantıları ile haber yayın akışlarını takip etmeniz mümkün. Türkiye’nin ilk ve tek profesyonel arama motoru botu olan GeliyooBot/1.0 ile dünyada bulunan her siteye ulaşarak index sayısını her geçen gün arttıran Geliyoo, günlük ortalama 7 ila 10 TB arasındakidatayıanalizediyor. Geliyoo Browser ile de çok yakında hizmete başlayacak olan Geliyoo’nun arama motorunun yanı sıra bir çok projesi bulunuyor, Türkiye’de bu güne kadar uygulanmamış bir çok reklam modelini hayata geçirmeye hazırlanan Geliyoo yatırımcılar gözde şirketi konumunda. Geliyoo Haber Servisine RSS bağlantılarınızın eklenebilmesi için RSS bağlantılarınızın içerisinde resim olması gerekiyor, resimsiz olarak çekilen RSS bağlantıları kullanıcı açısından ilgi çekici olmadığı düşünülüyor, yeni güncellemesini 01/08/2013 e kadar gerçekleştirecek olan Geliyoo Haber servisi artık haberler çok daha hızlı ve kolay ulaşmanız için kullanıcı yorumlarına da yer verecek. Sosyal Paylaşım imkanı da sunan Haberler Geliyoo Twitter, Facebook ve diğer online paylaşım servisleri ile bağlandılı eklentiler ile sizlere daha kolay paylaşım imkanı sağlıyor. Geliyoo Haber’in bir diğer özelliği haberler konusunda sizlere bildiri gönderebilmesi için üyelik servisini kullanabiliyor olmanız. Bunun yanı sıra Haber sitelerinin Geliyoo Haber’e kayıt yaptırmaları için Haber RSS bağlantılarını Forum Geliyoo’da ilgili bölüme konu açarak bildirmeleri gerekmektedir. 22
  • 21. 23 sahibinden.com verilerine göre, yılın ilk beş ayında gerçekleşen klima satışları, geçtiğimizyılınaynıdönemine göre yüzde 91 artış kaydetti. Klima fiyatlarında değişiklik gözlenmezken, en çok satılan klima markası da Arçelik oldu.Hava sıcaklıklarının artmasıyla Türkiye’nin en büyük pazaryerlerinden sahibinden.com’un, 2013 klima ilan ve ortalama satış rakamlarına ilişkin verileri de belli oldu. Verilere göre yılın ilk beş ayında gerçekleşen klima satışları geçtiğimiz yılın aynı dönemine göre yüzde 91 artış kaydetti. Klima fiyatlarında değişiklik gözlenmezken, en çok satılan klima markası Arçelik oldu. Arçelik’i sırasıyla Beko, Vestel, Airfel ve Demirdöküm izledi. sahibinden.com verilerine bakıldığında en çok klimanın İstanbul’da satıldığı kaydedildi. İstanbul’u sırasıyla İzmir,Antalya,Ankara ve Bursa izlerken,en çokklima satışının Mayıs ayında gerçekleştiği gözlendi. Duvar Tipi Klima Yine İlk Tercih Oldu sahibinden.com aracılığı ile gerçekleşen satışlarda, tüketicilerin yine ilk tercihi olan duvar tipi klimaların satışları yüzde 78,5 oranında gerçekleşti. Salon tipi klima satışlarında artış gözlenirken, geçtiğimiz yılın ilk altı ayında tüm klima satışları içindeki payı yüzde 13,1 olan salon tipi klimaların payı bu yıl yüzde 15,2’ye yükseldi.Klimaların kapasitelerini ifade eden güç birimi BTU bazında, bu yıl da en çok talep gören 12 bin BTU klimalar oldu. Tüm satışlar içinde 12 bin BTU klimaların satışları geçtiğimiz yıl yüzde 24’lük bir orana sahipken, bu yılki pay yüzde 29’a ulaştı. 2012’ye göre satışları azalan 24 bin BTU klimaların oranı yüzde 28’den yüzde 23’e geriledi. Türkiye’de sosyal medyanın 1 numaralı markası Markafoni Türkiye’nin ilk ve lider özel alışveriş kulübü www. markafoni.com, Ekonomist dergisi ile İngiliz araştırma şirketi Brandwatch’ın birlikte hazırladığı “Sosyal Marka 100 Araştırması”nda birinci seçildi! “Sosyal Medya 100” listesi, analistlerden ve sosyal medya uzmanlarından oluşan 12 kişilik jüri tarafından belirlendi. Jüride; Serdar Kuzuloğlu, Levent Erden, Rauf Ateş, Talat Yeşiloğlu, Özgür Alaz, Alemşah Öztürk gibi kendi iş alanlarında başarılı ve duayen isimler yer aldı. www.markafoni.com, kullanıcılarıyla her gün düzenli gerçekleştirdiği paylaşımlarilesıcakiletişimde bulunması, çeşitli yarışmalar vasıtasıyla kullanıcılarını ödüllendirmesi, sosyal medyaya özel hazırlanan videolarla ve gerçekleştirdiği özel sosyal medya projeleri ile fark yaratmasıyla “Türkiye’nin en güçlü sosyal markası” unvanına layık görüldü. Markafoni Pazarlama Direktörü Hakkı Arıkan, konuyla ilgili olarak şunları söyledi: “Sosyal medya yönetim stratejimiz; müşteri deneyimi ve etkileşimini güçlendirmek, müşteri şikayet yönetimini en hızlı ve efektif şekildeyapmaküzerinekurulu. Bu stratejimiz sayesinde müşterilerimizle aramızdaki bağı her geçen gün daha fazla güçlendiriyoruz.” Bu yıl İstanbul’lu klimaya sarıldı, satışlar yüzde 91 arttı
  • 22. Turkcell Superonline, Vestel Grup’a ait Deksarnet’i bünyesine kattı. Turkcell Superonline bu satın alım ile “ışık hızı”ndaki fiber optik ağını, uydu haberleşme altyapısı ile daha da güçlendirecek. Turkcell Superonline, Vestel Elektronik Grubu’na bağlı Deksarnet Telekomünikasyon A.Ş.’nin hisselerinin tamamını bünyesine dahil etti. Deksarnet’in yüzde 100 hissesinin Superonline İletişim Hizmetleri A.Ş. tarafından satın alınmasına ilişkin süreç, 7 Mart 2013 tarihinde imzalanan “Pay DevirSözleşmesi”ilebaşlamıştı. Satın alma bedeli 1 milyon 750 bin dolar olarak belirlenen hisse devir işlemi,gerekli yasal onayların alınmasının ardından tamamlandı. Uydu telekomünikasyon ve bilgi teknolojileri alanlarında entegre servis sunucu olarak 1997 yılında kurulan Deksarnet’ın ana faaliyet alanı; uydu ve telsiz haberleşmesi, bu kanallar üzerinden internet, intranet ve benzeri IP temelli trafiklerin aktarılmasından oluşuyor. Deksarnet, otelcilik, sağlık gibi farklı sektörlerden çok bayili şirketlere kadar pek çok kurumsal müşterisine; yazılım geliştirmeden, bilgi teknolojileri yönetim ve uygulamalarına, multimedya tabanlı hizmetlerden altyapı hizmetlerine geniş bir yelpazede çözümler sunuyor. Turkcell Superonline’a uydu haberleşme altyapısı Bu satın alım ile sabit genişbant altyapısını uydu haberleşme altyapısı ile daha da güçlendirmeyi hedefleyen Turkcell Superonline, yaklaşık 10 milyon dolar bedeli ödenmiş uydu istasyonu altyapısını bünyesine katıyor. Turkcell Superonline’ın Söğütözü’nde bulunan uydu istasyonuyla konsolidasyon sonrasında ise bakım giderlerinde yaklaşık yüzde 60 tasarruf imkanı elde edilecek. Deksarnet’in aynı zamanda “Otel/Hastane Televizyon Otomasyonu”, “Dijital Bilgi Panoları” ve “Uydu ile Şubeler Back-up’ı” gibi hazır ürünleri de Turkcell Superonline’ın kurumsal müşterilerine yönelik hizmetlerini geliştirmesinde önemli rol oynayacak. Deksarnet’in Turkcell Superonline bünyesine dahil edilmesi, Turkcell Grubu içerisindeki sinerjiye de katkıda bulunacak. Satın alma işleminin ardından mevcut yayıncılık alanında faaliyet gösteren Turkcell müşterilerine bütünleşik çözümler sunulabileceği gibi uydu ile yedekleme çözümü de verilecek hizmetler arasına dahil olacak. “Satın almalarımızı uzun vadeli perspektifle planlıyoruz” Turkcell Superonline Genel Müdürü Murat Erkan, konuya ilişkin değerlendirmesinde “Geleceğinteknolojisiolanfiber altyapıyı dünya ile aynı anda ülkemize kazandırmak üzere 5 yıl önce çalışmalara başlamış bir şirket olarak,tüm faaliyet ve satın almalarımızı uzun vadeli bir perspektifle planlıyoruz. Tellcom adıyla hizmet vermekte olduğumuz 2008 yılında kurumsal segmentte varlığımızı güçlendirmek amacıyla Sabancı Telekom’un altyapısını devraldıktan sonra; 2009 yılında Tellcom- Superonline birleşmesi ile altyapı tarafındaki gücümüze Superonline markasını ekledik. Kasım 2011’de ise Global İletişim’i bünyemize katarak, kurumsal müşterilerimize sunduğumuz bulut bilişim, veri merkezi ve ileri güvenlik çözümleri gibi bütünleşik telekom hizmetlerini zenginleştirdik. 8 24 Turkcell Superonline Deksarnet’i satın aldı
  • 23. 25 Yandex, şehirlerarası uçak, tren, otobüs ve feribot seferleri konusunda güncel bilgileri içeren Yandex.Seferler adlı yeni servisini kullanıma sundu. Yandex.Seferler, tek bir arama ile tüm farklı ulaşım seçeneklerini sunabildiği gibi, kullanıcılara gitmek istedikleri destinasyonla ilgili rotalar da oluşturuyor.seferler.yandex. com.tr üzerinde dilediği uçak veya otobüs biletini seçen kullanıcılar, diledikleri takdirde Yandex’in resmi çözüm ortağı olan Biletall. com’a yönlendirilerek bilet satın alım işlemlerini de gerçekleştirebiliyor. Servisin bir diğer önemli özelliği ise, hizmetin Türkiye ile sınırlı olmayışı ve dünya çapında uçuş bilgilerini de içermesi. An itibarıyla sadece seferler. yandex.com.tr üzerinden ulaşılabilen servisin mobil uygulamasının önümüzdeki aylardakullanıcılarınhizmetine sunulması ve kapsamına şehiriçi ulaşım yollarının da eklenmesi planlanıyor. Kullanıcıların hayatını önemli ölçüde kolaylaştıran Yandex.Seferler, şirketin faaliyette olduğu diğer ülkelerde ulaşım alanındaki en büyük web servisi olma özelliğini taşıyor. 8 Şehirlerarası sefer tarifeleri Yandex.Seferler’de Yandex’in Lamborghini’si talihlisine kavuştu! Yandex.Browser’in tanıtım kampanyası kapsamında Yandex tarafından şanslı bir kullanıcıya vaat edilen Lamborghini Gallardo LP 560- 4 bugün talihlisine kavuştu. İstanbul’a babası Ahmet Kıyak ile birlikte gelen Gaziantepli şanslı Yandex.Browser kullanıcısı Erkan Kıyak, son teknoloji ürünü Lamborghini Gallardo’yu Yandex.Türkiye CEO’su Bogdan Wisniewski’den teslim aldı. Kıyak: “Böylesine güzel bir arabayı kazandığım için gerçekten çok mutluyum. HayalimigerçekleştirenYandex Türkiye’ye tekrar çok teşekkür ederim” dedi.Yandex.Türkiye CEO’su Bogdan Wisniewski ise: “Tarayıcımızın Turbo hızını ve üstün özelliklerini vurgulamak adına hayata geçirdiğimiz Lamborghini kampanyamızdan güzel geri dönüşler aldık. Kullanıcılarımızdan birini, birçok insanın hayallerini süsleyen bir Lamborghini ile mutlu edebilmiş olmak çok güzel. Tekrar hayırlı olsun” dedi.Yandex.Browser’ın Lamborghini kampanyası, 28 Şubat–19Mayıs2013tarihleri arasında katılımcılarını kabul etmiş ve 27 Mayıs 2013 günü Yandex.Türkiye ofisinde, noter huzurunda gerçekleştirilen çekilişle talihli belirlenmişti.
  • 24. IdeaSoft sektör bilgilendirmelerine devam ediyor İdeasoft, E-Ticaret Sözlüğü gibi bir çok proje ile sektöre ilgi duyan kesimlerin ihtiyaçlarını karşılayacak içerikler üretme çalışmalarını haziran ayında da devam ettirdi. E-Ticaret Sözlüğü , sanal mağazacılık jargonunun kullanıcılar için açık ve sade bir şekilde sunulması amacıyla Haziran ayı içerisinde hazırlanıp, kullanıcı dostu bir menüyle şekillendirildi. Temmuz ayı içerisinde yayına girecek olan bu sözlük sayesinde girişimci ve girişimci adaylarının kafalarındaki soru işaretleri cevaplarını bulmuş olacak. İdeasoft’un Haziran ayında mercek altına aldığı Çin’den ürün ithalatı konusunda bloğundan yayınladığı yazı dizesinde; kontrolör bir firmayla çalışmanın öneminin altı çizildi. Sanalmağazasahiplerinin vitrin ve tasarımlarını Yaz sezonuna hazırlamaları yönünde ipuçlarının verildiği İdeasfot bloğunda, ay içerisinde kutlanan Babalar Gününde satışları arttırmaya yönelik bilgiler de paylaşıldı. Türkiye’de E-Ticaret Hacmi Artmaya Devam Ediyor Türkiye’de yerli kartlarla Mayıs döneminde toplam 2.642,24MilyonTLtutarında, 13.860.030 adet E-ticaret işlemi yapıldığı gözlenirken, Ideasoft paketlerini kullanan girişimciler Haziran ayında bupastadanpaylarınıalmaya devam ettiler. Haziran Ayında, Marmara Bölgesi Ideasoft paketlerini kullanımında %53,7 ‘lik dilimle Türkiye genelinde en aktif bölge olmayı sürdürürken, İller arasında İstanbul Avrupa yakası %26’lık dilimle ilk sırada yer aldı. Bu oranlar içersinde en hızlı gelişim gösteren E-Ticaret girişim sektörleri; Organik & Doğal Ürünler, Beyaz Eşya ve Takı & Mücevharat olarak öne çıktı.” 26
  • 25. /wmdergi beğendin mi yaptığımızı?
  • 26. 28 “WM Dergi ‘nin her sayısında bu sayfalarda İnternet, Web Dünyası, Sosyal Medya ‘nın doğuşu, şekillenişi, bunları gerçekleştiren kişiler ve en büyük web şirketleri hakkında derlediğimiz çok özel makale ve bilgilere yer vereceğiz.” Bugün kullanmakta olduğumuz internet, web teknolojileri ve web siteleri nasıl doğdu, kimler temelini attı ve gelişimine öncülük etti? WMDB sayfalarında her ay bu teknolojiler ve kişiler hakkında derlediğimiz bilgi, makale ve hikayelerini yayınlayacağız.Bu sayede, belki de hiç bilmediğiniz ilginç bilgi ve hikayeler okuyacak, bir web teknolojisi veya web sitesinin doğuşuna tanıklık edecek,mimarını tanıyacaksınız. WMDB sayfalarında yer alan bilgi ve hikayeler internet ortamında çeşitli kaynaklardan derlenerek bir araya getirilmekte ve hazırlanmaktadır. İlgili bilgi ve hikayelerin doğruluğu garanti edilmemekte, mümkün olduğunca temiz ve net bilgiler sunulmaya ç a l ı ş ı l m a k t a d ı r . Kaynak olarak Wiki kullanılmaktadır. WMDB
  • 27. 29 Plesk hosting paneli tarihçesi Plesk yazılım paketi, ticari bir web hosting otomasyonudur. Plesk Inc. firması altında Amerika’da yayınlanmıştırveNovosibirsk, Russia’da tasarlanmıştır. Haziran 2003’de, SWsoft firmasının Plesk Inc.’yi satın alması nedeniyle Plesk SWsoft ürünü olmuştur. SWsoft ve Parallels firmalarının ocak 2008’de birleşmesi nedeniyle Plesk şimdi Parallels Şirketinin yönetimi altındadır. Plesk, bir sunucu sistemi yöneticisine, web tabanlı bir arayüz üzerinden yeni web siteleri,yenie-postahesapları oluşturma ve DNS girdilerini yapma gibi imkânlar sunar. Yönetici, alan adları ve/veya istemcilere kaynaktahsisinde rol oynayan etkenleri önceden saptayan istemci ve site şablonları yaratabilir. Plesk’in Linux/UNIX için tasarlanmış olanı, Red Hat Linux/Fedora, SUSE, Debian/ Ubuntu and FreeBSD de dahil olmak üzere bir çok POSIX platformunu destekler. Plesk’in Windows için olanı ise Windows Server 2003 ve Windows Server 2008 işletim sistemlerini destekler. Plesk, CounterStrike ve Battlefield 1942 oyun sunucularının yanı sıra, MySQL ve PostgreSQL veritabanlarının (Windows altında Microsoft SQL Server ve Microsoft SQL Server Desktop Engine),Tomcat Java Server, ColdFusion Server gibi platformların isteğe bağlı sürümlerini kurar ya da bunların sürüm yönetimlerini gerçekleştirir. Güvenlik Bazı kullanıcılar,( Mahsum Çelik, Azat Metin, Serkan Alan) çoklu barındırma (multihosting) anlamında, bütün sanal sunucular aynı Apache kullanıcısı ve aynı Apache yapılandırması altında çalıştığı için Plesk’in güvenli olmadığından şikayetçidir.
  • 28. 30 Ancak, Windows için Plesk 7.5.6 sürümü ve üstü sürümlerde, tüm sanal sunucular, kendilerine ait ayrı ayrı IIS’ler (Internet InformationService)üzerinde kendi çalışan grubu işlemleri altında güvenle çalışabilirler. Plesk’in Linux sürümünde bu özellik mevcut değildir. Ayrıca Plesk, https uygulamaları için 8443 varsayılan portunu kullanır; bu port standart dışı https portlarına izin vermeyecek şekilde hem Microsoft ISA Server hem de Microsoft Small Business Server ile çakışır. Daha bir çok problemi mevcuttur, bunun yanı sıra Plesk 10’nun çıkmasıyla hatalar dahada çoğalmıştır (Unable to delete logrotate config: logrot_mng failed: Execute websrvmng --update-log-rotation “--vhost-name=offff.com” failed with error code 1: Cannot find hosting by domain ID 1) Yedekleme ve Geri yükleme Plesk veri yedekleme ve geriyüklemefonksiyonundaki bir eksiklik Plesk’in dosyaları ayrı bir FTP sunucusuna yüklemedenöncesunucudisk alanını kullanarak dosyaları depolama mekanizmasıdır. Pleskyedeklemedosyaları çok büyük olduğundan bu mekanizma yöneticileri yedek almamak ya da büyük boyutlarda depolama alanını kullanmadan bırakmak arasında bir seçime zorladığından kullanılabilir sunucu dopolama alanını gözle görülür bir şekilde kısıtlar.
  • 29. 31 Microsoft SQL Server tarihçesi Doğuşu Versiyon 7.0’dan önce “kod tabanı” Sybase SQL Server tarafından Microsoft’a satıldı, ve bu Microsoft’un kurumsal seviyede veritabanı pazarına girişi oldu. Sybase SQL Server 3.0 ile esasen aynı olan ilk versiyon, SQL Server 1.0’ı yaratmak ve pazarlamak adına Microsoft, Sybase ve Ashton-Tate ile takım oluşturdu. 1992’de Microsoft SQL Server 4.2 sevkedildi. Daha sonra Windows NT 3.1 ile aynı zamanda Microsoft SQL Server 4.21 piyasaya sunuldu. Microsoft SQL Server 6.0 Windows NT için dizayn edilmiş ilk versiyon olmasıyla birlikte Sybase’den talimat alınmaksızın piyasaya çıkartıldı. SQL Server 7.0, miras Sybase kodu ile yazılan bir “rewrite” versiyonu oldu, ve yerine SQL Server 2000 çıkartıldı.SQL Server 2000,IA- 64 mimarisinden farklı olarak yazılan ilk sürüm oldu.SQL Server 2000 sürümünden 10 yıl sonra performansta artışlar görüldü, IDE araçlarını ve tamamlayıcı başka sistemleri içeren SQL Server 2005 piyasaya sunuldu. SQL Server 2005 SQL Server 2005 (Kod Adı Yukon), Ekim 2005 tarihinde piyasaya sunuldu. İlişkisel dataya ek olarak,XML datayı düzenlemeye destek içerdi. Bu amaçla, veritabanı sütunlarında bir veri tipi ya da sorgularda sabitler (literals) olarak kullanılabilecek bir XML veri tipi tanımladı. Özelleştirilmiş indeksleme, XML veri için kullanılabilir hale geldi. XML veri, XQuery kullanılarak sorgulanma imkanı sunuldu, bu sayede kişinin CLR (Common Language Runtime) ile YönetilenKod(ManagedCode) olarak SQL kodu yazmasını mümkünkıldı.SQLServer2005 ayrıca T-SQL içerisine XQuery sorgularını yerleştirmek için T-SQL diline eklemeler yaptı. Ek olarak, XQuery’ye, XML veriye sorgulama bazlı modifikasyonları mümkün kılan “XML DML” adı verilen yeni bir eklenti tanımladı. SQL Server 2005, yeni indeksleme algoritması ve daha iyi hata geri dönüştürme (error recovery) gibi yeni özellikler ile geldi. İzinler ve giriş kontolü daha granüler hale getirildi ve sorguların eş zamanlı olarak sorgulama işlemcisi (query processor) tarafından yürütülmesi daha etkin hale getirildi.
  • 30. Tablo üzerindeki bölümlemeler ve indeksler desteklendiğinden, veritabanı kümeleme kolaylaştırıldı. .NET Framework ile birleşimi için SQL Server 2005 ile birlikte SQL CLR tanıtıldı. SQL Server 2005, çoklu amaç için veritabanı kullanımını sağlayan “MARS”’ı (Multiple Active Results Sets) tanıttı.SQL Server 2005,“Server instance” sağlığının kontrol edilmesi, problem teşhis etme ve performas ayarı gibi bilgilerin edinilmesini sağlayan “DMVs” (Dynamic Management Views) teknolojisi tanıttı. SQL Server 2008 SQL Server’ın bir sonraki versiyonu, SQL Server 2008, 6 Ağustos 2008 tarihinde piyasaya sürüldü. Neredeyse sıfır kapalı kalma süresi, veri yönetimini kendi kendine ayarlanabilen, organize olabilen ve devamlılığını sağlayan bir hale getirmek SQL Server 2008’in getirdiği yeniliklerden bazılarıydı. SQL Server 2008 ayrıca, resim, video ve diğer multimedya formatlarını da içeren, yapılandırılmış ve yarı- yapılandırılmış veriler için destek sundu.Mekana bağımlı (location-dependent) veri için özelleştirilmiş tarih ve zaman tipleri, ve Mekansal veri (Spatial data) yeni veri tipleri arasında yerini aldı. Dosya sistemindeki herhangi bir dosyanın referans edilmesi için yapılandırılmamış ve yarı-yapılandırılmış verilere daha iyi destek, yeni veri tipi “FILESTREAM” ile sağlandı. Yönetimi kolaylaştıran ve performansı arttıran Tam Metin Arama (Full-Text Search) özelliği SQL Server 2008 ile birlikte tanıtıldı.SQL Server 2008, ölçeklendirmeye ve indeksleme algoritmalarına da katkıda bulunan ve “filtrelenmiş indeksler” (filtered indexes) kavramıyla açığa çıkan,daha iyi sıkıştırma özellikleri de getirdi. SQL Server 2008 ayrıca veritabanlarını “Cmdlets” olarak Windows PowerShell sağlayıcıları üzerinden kullanılabilir hale getirdi, bu sayede sunucu ve çalışan tüm oluşumlar Windows PowerShell üzerinden yürütülebilir duruma geldi. SQL Server 2008 R2 SQL Server 2008 R2 (eski Kod Adı “Kilimanjaro”) TechEd 2009’da duyuruldu ve 21 Nisan 2010 tarihinde piyasaya sunuldu. SQL Server 2008 R2, SQL Server 2008’e ek olarak ana veri birimleri ve hiyerarşileriyönetimisağlayan “Master Data Services” olarak adı geçen yeni bir ana veri yönetim sistemi ekledi. Ayrıca çoklu SQL Server oluşumlarını yönetmeye yarayan Çoklu Sunucu Yönetimi (Multi Server Management), Raporlama Servisi (Reporting Service), Analiz ve Integrasyon Servisleri (Analysis & Integration Services), Excel ve SharePoint için “PowerPivot”, “StreamInsight”, eklenen yeni özellikler arasında olduğu görüldü. Versiyonlar Microsoft, SQL Server’ı farklı versiyonlar ile sunmaktadır. Bu versiyonlar, farklı özellik setleri içerdiği gibi, farklı kullanıcıları da hedef alır. Temel (Mainstream) Versiyonlar -Datacenter SQL Server 2008 R2 Datacenter, yüksek seviye uygulama desteği ve ölçeklenebilirlik ihtiyaçlarını gideren, verimerkezleri (datacenters) için tasarlanmıştır. 256 mantıksal işlemciyi ve neredeyse sınırsız hafıza desteklemektedir. StreamInsight Premium versiyonuyla birlikte gelmektedir. 32
  • 31. Enterprise SQL Server Enterprise versiyonu, SQL Server kümelerini yaratmak ve düzenlemekiçingerekliaraçları içeren versiyon olup, çekirdek veritabanı motoru ve add-on servislerini desteklemektedir. 524 petabayta kadarveritabanı yönetebilmekte, 2 terabayt hafıza içermekte ve 8 fiziksel işlemci desteklemektedir. Standard SQL Server Standart versiyonu, çekirdek veritabanı motorunu, bağımsız servislerle (stand-alone services) birlikte içermektedir. Daha az aktif instance (kümedeki ağ sayısı) desteklemesi, hot-add memory (sunucu çalışırken hafıza eklenebilmesi) gibi yüksek süreklilik fonksyonları ve paralel indeksleri içermemesi, SQL Server Enterprise versiyonundan farklı olduğu noktalar olmaktadır. Web SQL Server Web versiyonu, Web hosting için “low-TCO” (toplamda sahip olma maliyeti) bir seçenektir. Workgroup SQL Server Workgroup versiyonu, çekirdek veritabanı fonksyonlarını içermekte ancak ek servisleri içermemektedir. Express SQL Server Express versiyonu, çekirdek veritabanı motorunu içeren, ücretsiz bir versiyondur. Veritabanı ve kullanıcısayısındabirsınırlama yoktur, ancak 1 işlemci, 1 GB hafıza ve 4 GB veritabanı dosya limiti bulunmaktadır. Özelleştirilmiş (Specialized) Versiyonlar -Azure Microsoft SQL Azure Veritabanı, Microsoft SQL Server’ın bulut bazlı (cloud- based) versiyonudur. Azure Servisleri Platform’unda “software as a service” (servis olarak yazılım) olarak sunulmuştur. Compact (SQLCE) SQL Server Compact versiyonu, gömülü bir veritabanı motorudur. Diğer SQL Server versiyonlarının aksine, SQL CE motoru, SQL Mobile (başlangıçta mobil cihazlar için tasarlanmıştır) üzerine kuruludur ve aynı ikili değerleri paylaşmamaktadır. Boyutunun küçüklüğüne (1 MB DLL footprint) ek olarak, özellik setleri belirgin olarak azaltılmıştır. Windows Service olarak çalıştırılamayacağı gibi, 4 GB veritabanılimitibulunmaktadır. Developer SQL Server Developer versiyonu, SQL Server Datacenter versiyonuyla aynı özellikleri içermektedir, ancak sadece geliştirme (development) ve test sistemi olarak kullanılabilmektedir. Embedded (SSEE) SQL Server Embedded versiyonu, SQL Server Express veritabanı motorunun, sadece belli Windows Servisleri tarafından ulaşılabilen, özel olarak düzenlenmiş bir ismidir. Evaluation SQL Server Evaluation versiyonu, Deneme Sürümü (Trial Edition) olarakta bilinen, Enterprise versiyonunun tüm özelliklerini içeren,sadece 180 günle sınırlı olan versiyonudur. Fast Track SQL Server Fast Track, özel olarak, ticari kurum bazında, veri depolama ve zeka işleme (intelligence processing) işlemlerinde kullanılan versiyondur. Parallel Data Warehouse (PDW) Parallel Data Warehouse versiyonu, yüzlerce terabaytlık veri depolama işlemleri için optimize edilmiş versiyondur. 33
  • 32. Yeni domain uzantıları ile tanışma vakti 12 Ocak 2012 tarihinde ICANN tarafından başvuru süreci başlatılan yeni alan adı uzantıları 2013 sonu itibariyle hayatımıza girmeye başlayacak. Toplamda 1.940 başvurunun alındığı ICANN newgTLDsürecindemükerrer başvurular düşüldüğünde 1.400 yenialanadıuzantısını için değerlendirme sürecinin hemen hemen sonuna gelindi. 2012 ortalarında çekilen kuralar neticesinde değerlendirme sıraları belirlenen ve an itibariyle 720 tanesi için “olur” onayı verilen new gTLD’lerin Ağustos 2013 itibariyle tamamen neticelendirilmesi bekleniyor. Yeni domainlerde süreç nasıl işleyecek? ICANN’in IE (Initial Evaluation) ismini verdiği değerlendirme süreci sonunda “olur” onayı alan domain uzantıları, altyapılarının standartlara uygunluğunu onaylatmak için ICANN’in öngördüğü bazı yeterlilik testlerine tabi tutulacak. Bu testleri geçen ve ICANN ile sözleşme imzalamaya hak kazanan uzantılar ise başvuru sahiplerinin inisiyatifinde kayıtsüreçleriniişletebilecek. Her domain uzantısı genel kayda açılacak mı? Bu sorunun cevabı elbette başvuru sahibi şirketlerin tasarrufunda olacak. Zira eğer şirket kullanım onay aldığı alan adı uzantısını genel kayda açmak istemiyorsa belirli prensiplerle kendi tarafında dilediği kurum veya şahsa tahsis edebilecek veya özel koşul ve fiyatlar altında satışa sunabilecek. Melih ANDIÇ İsim Tescil A.Ş - İş Geliştirme & Dijital Pazarlama Yönetmeni Twitter: /melihandic melih.andic@isimtescil.net 34
  • 33. Yeni domainlerin fiyatları ne olacak? Her domain uzantısı başvuru sahibi tarafından belirlenecek fiyatlar ile satışa sunulacak. Hemen belirtelim; başvuru sahipleri ön başvuru bedelinin haricinde uzantılarının kabulünü takiben her bir uzantı için 185.000$’lık ana tahsis ücretini yatırmak ve ilgili uzantıyı yönetebilmek için kendi DNS altyapılarını ve kayıt yazmanlarına sağlayacağı arayüz ve entegrasyonlarıtamamlamak zorunda. Bahsi geçen altyapılar ve ICANN’in standart olarak her bir uzantıdan istediği yıllık 25.000$’lık işletim bedeli düşünüldüğünde bir alan adı uzantısı için kümülatif anlamda 500.000$’dan daha yüksek bir “sahip olma ve yönetimmaliyeti”oluşacağını söylemek mümkün. Bu rakama pazarlama ve iletişim harcamaları da eklendiğinde ortalama 50.000 adet satış hedefi olan bir alan adı uzantısının kendisini finanse edebilmesi için iyimser olarak 20$ gibi bir temel maliyetle dünyaya gözlerini açacağını öngörebiliriz. Pek tabi sadece fikir vermesi adına çıkarılan yukarıdakitabloherşirketiçin aynı değil. Örneğin Google’ın kendi domain uzantılarında saha satışı yerine markaya ilintilendirilmiş ücretsiz dağıtım yöntemini benimseyeceği, kar amacı gütmeyen STK ve Belediye gibi kuruluşların da temel maliyet üzerinden alan adı uzantılarını genel kayda açacağı konuşuluyor. Tüm bu şartlar altında bu işten para kazanmak isteyecek başvuru sahiplerinin de bu kadar iyimser davranmayacağını göz önünde bulundurmakta fayda var zira 20$’lık temel maliyet hesabımızda bahsi geçen 50.000’lik hedef, bu uzantı kalabalığında her alan adı için tutarlı görünmüyor. 35
  • 34. Yeni domainler ne vaad ediyor? Dünyanın en popüler uzantısı olarak kabul edilen .COM’da yaşanan sıkışma hemen hemen tüm internet kullanıcılarının canını sıkmakta. 260 milyonun üzerinde kayıtlı COM domain olduğu düşünüldüğünde herkes için aradığı domaini bulmak sanıldığı kadar kolay olmuyor. Durum böyleyken ikinci el alan adı pazarında yüzbinler, hatta milyonlarca dolara el değiştiren COM domainlere rastlamak mümkün. Yeni alan adı uzantıları ise bu sıkışmayı kırarak, kendi alanında bireysel ve kurumsal iştirakler için yeni markalaşma fırsatları oluşturacak.Örneğine-ticaret girişimleri .STORE ve .SHOP uzantılarının yanında .BUY gibi sektörü temsil eden özel uzantılarda kendilerine yer bulabilecekken, sayıları milyonları bulan blog yazarları ve diğer kişisel siteler .BLOG ve .WEB uzantısı ile çok geniş bir portföyden,projelerini temsil edenyüzlerceyenialternatife erişebiliyor olacak. Ön talepler için geç kalmayın! 90’lı yılların başında Amerika’da başlayan domain hareketini kaçıranTürkiye’nin bu kezönemli bir avantajı var. İnternet kullanımının yaygınlaşması ile tüm teknolojilere dünya ile eşit mesafede durabilen Türkiye de ilgili alan adlarının çıkış ve kayıt proseslerini takip edebileceğiniz; ülkenin en büyük ICANN akredite yazmanı isimtescil.net, kullanıcıları için özel bir ön talep sürecini başlatmış durumda. www.isimtescil.net/ yenidomainler adresinden ulaşılabilen “ICANN yeni domain uzantıları ön talep programı” kapsamında kayda açılması beklenen yeni alan adları için ücretsiz talep listesi oluşturmanızmümkün. Şimdiye kadar 500.000’e yakın başvuru alan isimtescil. net,bu süreçte kullanıcılarını başvuru sıralarına göre listeliyor ve ilgili domainler genel kayda açılmadan önce talep sahiplerini e-mail yoluyla bilgilendiriyor. Tüm bu süreçleri yakından takip etmek isteyen sosyal medya kullanıcıları için facebook ve twitter üzerinden /yenidomainler hesapları da anlık olarak tüm gelişmeleri izlenebileceği güçlü ve Türkçe bir kaynak vazifesinde. 36
  • 35. 37 . trade . money . app . voting .travel . CITY . istanbul . ist . pizza . business . radio . music . web . SHOP . web . love . digital Yeni Domain Uzantılarını KeşfedinİNTERNET’İN YENİ YÜZÜ YÜZLERCE YENI UZANTI KAYDA ACILIYOR . . NEW gTLD ÜCRETSİZ ön talep listesi oluşturma. .shop, .web, .ist, .blog gibi yüzlerce yeni uzantı fırsatı. Domain genel kayıt duyurularını online izleyebilme.
  • 36. MURATYANIKLAR ÖZEL RÖPORTAJ Murat bey,sizi tanıyabilir miyiz? 07 Aralık 1975 tarihinde Bursa’da doğdum. Eskişehir Anadolu Üniversitesi’nde Matematikokuyanbiröğrenciikenİnternet’le tanıştım ve hep kendi işini kurma hayali olan biri olarak mezun olduktan sonra İnternet’le ilgili işimi kurdum. Dönüm noktası o cevap oldu Üniversiteden mezun olduğum yıllarda hayatımın dönüm noktası olarak nitelendirdiğim bir olayyaşadım. O zamanlar Türkiye’nin en güçlü firmalarından biri olan Superonline’a bir projemi gönderdim ve projeyi beğenmeleri üzerine İstanbul’a davet edildim. Görüşme sırasında iş teklifi aldım ve üniversiteden yeni mezun, cebinde 5 kuruş parası bulunmayan biri için hayır denilemeyecek bir teklifte bulunuldu. Proje ve yapılacaklar hakkında konuşuldu, konuşuldukça heves arttı. Bu süreç etkileyici gelmiş olacak ki Genel Müdür Yardımcısı bana: “Murat hedefin ne, ne yapmayı arzuluyorsun?”diye sordu. Bu soru üzerine, hep kendi işini kurmak isteyen biri olarak ve ortamında samimiyetine güvenerek “Sizi yanımda çalıştırmak isterim” dedim ve her şey bu cevaptan sonra tersine döndü. “Bu, senin düşündüğün kadar kolay değil” diyebircevabınardından“bizsiziararız”temalı bir vedayla oradan gönderildim. Bursa’da zaman Bursa’ya döndüğümde kendi işimi kurmak için yaptığım çalışmaların yanı sıra firmalara web tasarımı yapıp tüm süreci kendim kontrol ediyordum ve bir gün tasarım yaptığım bir firmanın genel müdürü artık emekli olmak üzere olduğunu ve kendine bir iş kurmaküzere yatırım yapmak istediğini söyledi ve hayat bundan sonra benim için değişti. TURKTICARET.Net nasıl doğdu? Hayatımın fırsatını ele geçirdikten sonra henüz 22 yaşındayken şirketimi kurdum. Bu ayki özel röportajımızda Turkticaret.net’e konuk oluyoruz ve WM Dergi Genel Yayın Yönetmeni: Emin Doğu soruyor, İcra Kurulu Başkanı: Murat Yanıklar yanıtlıyor... 39
  • 37. Özellikle KOBİ’lerin İnternet’ten habersiz yaşadığını fark ettim ve İnternet ile ilgili temel servisleri sunmaya başladım. 1999 Aralık ayında ise TURKTICARET. Net projesini hayata geçirdim ve bugün Türkiye’nin KOBİ’lere yönelik en büyük b2b elektronik pazaryeri haline geldi. 2002 yılında“TOYPTürkiye”yarışmasında Girişimcilik kategorisinde birincilik ödülüne layık görüldüm ve bu çerçevede 2003 yılında “Dünyada Yılın En Başarılı Gençleri” yarışmasında Türkiye’yi temsil ettim. 2007 yılında Bursa’da Gelir Vergisi sıralamasında 20.oldum. TURKTICARET.Net’in yeni ofisi yüksek standartları ve çalışanlarına sunduğu imkanlarileTürkiye’ninendikkatçekiciofisi oldu.Bu konuda neler söyleyebilirsiniz? TURKTICARET.Net olarak sadece projelerle değil çalışma ortamındaki yenilikle de fark yaratmayı hayal ettik. Sonra da Bursa ULUTEK Binası ile Türkiye’yi yepyeni bir çalışma ortamıyla tanıştırdık. 2000m2’lik alanda bir yılda tamamlanan çalışma tabii ki kolay bir süreçten geçmedi. Çalışanlarımıza farklı , özgün ve sosyal bir çalışma ortamı sağlamak hedefiyle yola çıkıldı ve amacımıza ulaştık. Sosyalleşmek, mahallelerde insanların birbirine gidip geldiği eski komşuluk zamanlarını bir teknoloji üssünde yaşatmak,eski sosyal ortamların yeni sosyal platformla buluşmasını sağlamak ve gelenekle geleceği birleştirmekti amacımız. 40
  • 38. Farklı imkanları olan bir ortam yaratarak çalışanlarımızın spor yapmalarını sağlamak, günlük iş stresini üzerlerinden atabilmeleri amacıyla masaj odası ve spor salonu oluşturmak, duş, kafetarya, bakkal gibi farklı bir çok unsuru bir araya toplayan bir ofis ortamı herkese çok ilginç ve çekici geldi. Projede en dikkat çekici nokta mimarinin Bursa teması üzerine kurulması oldu. Her ne kadar merkezimiz İstanbul olsa da TURKTICARET.Net’indoğduğuyerolanBursa. Bu anlamda Bursa’yı öne çıkaran bir konsept proje hazırladık. Kısmet olursa İstanbul’a da İstanbul teması üzerine bir ofis kurmayı düşünüyoruz. TURKTICARET.Net bünyesinde kaç kişi çalışıyor? TURKTICARET.Net’te toplamda 120 kişi çalışıyor. TURKTICARET.Net’in şu anki konumu ve sunduğu hizmetler ile ilgili neler söyleyebilirsiniz? Web Servisleri, Satış ve Pazarlama Servisleri, Dijital Reklam servisleri ve Dijital içerik hizmetleri sunuyoruz. 2005 yılından itibaren sadece kendi projelerimizi geliştiriyoruz. Kendi markalarımızı yaratarak ticari faaliyetlerimiz sürdürüyoruz. TURKTICARET.Net’in aktif kaç müşterisi var? Türkiye’nin 81 ilinden TURKTICARET.Net’in yaklaşık 150.000 müşterisi var. Aynı zamanda 30’danfazlaülkededemüşterilerimizbulunuyor. 41
  • 39. TURKTICARET.Net kaçadet alan adı kayıt etti? Kurulduğumuz günden bu yana 1 milyondan fazla alan adı tescili yaptık. TURKTICARET.Net sadece bir alan adı ve hosting hizmetinden çok, birçok alanda içerik bazlı hizmetler de sunuyor. Son dönemde içerik bazlı servis ve hizmetlerinize daha mı fazla ağırlık veriyorsunuz? Teknoloji her geçen gün daha da gelişiyor. Ve tüm dünya bu çılgınlığa ayak uyduruyor. TURKTICARET.Net elbette bir alan adı- hosting firması değil. Alt yapımızı sürekli geliştirmek, müşterilerimize daha kaliteli hizmetler sunabilmek için birçok çalışmamız mevcut. Ama aynı zamanda gelişen teknolojiyle birlikte içerik bazlı projelere de yer vererek farklılaşmaya başladık. Her iki tarafta birbirine paralel ilerliyor. Bir tarafta yıllardır işleyen bir sistem varken diğer tarafta çok yeni oluşumlar var. Bu yeni oluşumları desteklemekiçin de çeşitli çalışmalaryapılıyor. Büyük emekler var. TURKTICARET.Net’e bağlı çeşitli marka ve hizmetleriniz mevcut,bunlar nelerdir? Bunları proje proje anlatayım, Adhood.Com: Büyük bir reklam platformu. Aynı zamanda İnternette reklam konusunda çığır açan bir yapıya sahip. Onbinlerce yayıncısı olan, 1400’den fazla reklamvereni olan bir yapıya sahip. 42
  • 40. Yeni bir versiyonunu açıyoruz. ajanslara tek noktadan hizmet veren bir reklam platformudur.Şu anda Milliyet.com.tr,Mynet. com gibi sitelerle işbirlikleri yapıyoruz ve onların reklam alanlarını da reklamverenlere adhood.com üzerinden sunmaya başladık. Adhood.com reklam verenlere,yayıncılara ve WinWords servisi ile reklamverenlere, AdSemantic servisi ile yayıncılara, Analytics servisi ile tüm web sitesi sahiplerine, Adserver servisi ile Reklam Ajanslarına ve PubServer servisi ile de yayıncı ve networklere hizmetler sunmaktadır. YENİ ve BÜYÜK BİR PROJE: WEB TV Web TV: Sosyal video ağı. İnternette çok başka bir dönem bizi bekliyor. Her geçen gün kullanıcı sayısı katlanarak artan sosyal paylaşım ağlarının pek yakın gelecekte video ile daha fazla entegre olacağını görüyoruz. Hembireylerhemdemarkayadafirmalarweb. tv adıyla kendilerine kanal açmaya başladılar. Bukanallardaisterceptelefonlarındanister bilgisayarlarından canlı yayın yapabiliyorlar, video paylaşabiliyorlar. 40.000’den fazla kanal açıldı 8 ayda. Ayrıca 70’ten fazla TV kanalı projeye dahil oldu ve yayınlarını web. tv üzerinden yapıyorlar. Sanatçılar, Siyasiler ve bir çok ünlü kişi web.tv ile video sitelerini oluşturdular. www.kanaladi.web.tv şeklinde kanal açıp, yayın yapabilmek çok kolay. 43
  • 41. Web.tv geçtiğimiz ay Akdeniz Oyunları’na sponsor oldu. 2 milyondan fazla kişiye Akdeniz Oyunlarını web.tv’den izletti. Orada tüm branşlara,tüm sporculara kendi adlarına özel web.tv kanalları açıldı. Web.tv şu anda hızla yoluna devam ediyor. ÜCRETSİZ HİZMETLER ZENGİNLEŞTİRİYOR TURKTICARET.Net aynı zamanda kullanıcılarına ücretsiz altyapılar veriyor. Hazirsite.com markası altında birçok ücretsiz yazılımla TURKTICARET.Net kullanıcılarına, hangi alanda var olmak istiyorsa bunun için destek oluyor. Haberyazılımı.com: Medya şirketleri, gazeteciler, yayıncılar ya da içerik üreten bireylere haberlerini yönetebileceği ileri teknolojilerle hazırlanmış tamamen ücretsiz profesyonel bir haber yönetim yazılımı. Bu proje hakkında şöyle de denebilir; haber sitesi kurmak isteyen tüm kullanıcılar haberyazılımı.com sayesinde bu amaçlarına ücretsiz ulaşabilme imkanı bulacaktır. Aynı zamanda eticaretci.com, İKYazılım, mobilodeme.com, interbilet, forumaç, ucretsizwebalanı,hazirblog,e-ticaretsiteleride hazirsite.com altında verilen hizmetlerdendir. Bunların dışında Ok.net,Televidyon,Yahoyt. com, Girişimci Merkezi gibi yine içerik bazlı projeler yer almakta. 44
  • 42. 45 Hazır Site markanız aldında, ücretsiz webalani, interbilet, forum.ac, hazirblog, epazaryeri, ikyazilimi gibi birçok yazılım ve servis sunmaktasınız.Bu konuda neler söyleyebilirsinizve bu servislere yenileri eklenecek mi? Hazirsite.com’dan bahsedecek olursak da internette yerinizi almanız için size çeşitli alternatifleri ile web sitesi çözümleri sunmaktadır. İnternet kullanıcılarının Web sitesi, Eticaret sitesi, Haber Portalı, İçerik yönetim sitesi ya da online bilet satış sitesi oluşturmalarına ve internet’in sunduğu kolaylıklardan yararlanmalarına yardımcı olmak için hazırsite.com oluşturuldu. İnternette varlıklarını oluşturmak isteyen herkeseücretsizwebsitesiçözümlerinihazirsite. com altyapısı ile gerçekleştirebilmektesiniz. Kullanıcılarımıza site oluşturma ve yönetimi hakkında video sunumları ile destek verirken,müşteri hizmetleri departmanı ile de telefon ve mail desteği de verilmektedir. Gelişmiş Panel Yönetimi seçenekleri ile Google indexleme amacı ve meta kelime girişleri yapılması sağlanmaktadır. Bu alanda çalışmalar ve yenilikler devam ediyor. Bir çok yeni projeyi duyurmaya başlayacağız.
  • 43. Web. tv markanız ile Türkiye’de bu alanda kapsamlı ve farklı bir hizmet sunuyorsunuz. Mevcut durum ve gelecek planlarını hakkında bilgi alabilir miyiz? Web.tv uzun ve hummalı bir çalışmadan sonra 2012 Ekim’de yayın hayatına başladı. O günden bugüne geçen kısa sürede web.tv birçok aktif kullanıcıya ulaştı. Canlı yayın özelliğiyle daha çok dikkat çekti ve bu sayede ünlüler, firmalar, bireysel kullanıcılar herkes canlı yayında takipçilerine ulaştı. SeraySever’eaitZodyak.web.tv,Yavuz Seçkin’e ait yavuzseckin.web.tv, Hayko Cepkin’e ait ise haykocepkin.web.tv gibi ünlülerin kanalları var. Sayın Bakanımız Veysel Eroğlu’nun veyseleroglu.web. tv ‘de yayına girdi. Siyasi partiler ve başkanları da kanallarını açtı. Özellikle gezi parkı olayları sırasında web.tv çok aktif bir şekilde kullanıldı. Taksim’den gezi parkından canlı yayınlar yapıldı. Olayların içerisinden canlı yayınlar oldu. Bunların hepsi de geziparki.web.tv‘de yayında. Web.tv Türkiye’den çıkan ilk sosyal video ağı.Tabii ki gururluyuz.Amacımız web.tv’nin tüm dillerde aynı anlamı taşıyanisminingetirdiğigüçle,projemizi yurtdışında büyütmek istiyoruz. 46
  • 44. Web.tv’ye eklenecek yeni özellikler hakkında bilgi alabilir miyiz? web.tv’nin en önemli özelliği sosyal bir platform olması. Yakında daha çok sosyalleştirecek, içeriğe çok daha hızlı ve kolay ulaşımı sağlayacak özellikler gelecek. Aynı zamanda amacımız TV kanallarını da bu özelliklerle izleyicilerine ulaştırmak.Akıp kaybolan içerikler ulaşılabilir ve daha çok izlenebilir hale gelecekler. Web.tv’ye gösterilen ilgi nasıl ve şu an mevcut aylık tekil ziyaretçisi nedir? İlgiden çok memnunuz. Web.tv şu an 5 milyondan fazla aylık tekil ziyaretçiye sahip. Artan bir ivme ile de ziyaretçi ve içerik sayımız artıyor. Reklam networkü Adhood, uzun yıllardır yayıncılarına kazanç sağlıyor. Adhood’da şu an kaç farklı kampanya var? Adhood şu anda 1400’den fazla kampanya belirlenen hedeflere göre yayınlanmakta. Adhood’untayeniversiyonuçoketkileyicioldu ve reklamverenler ve yayıncılar tarafından sahiplenildi. Adhood’un aylıkreklam gösterimi sayısıve toplamda yayıncılarına aylık kazandırdığı miktar nedir? Adhood günlük 450 milyon reklam gösterimi sağlıyor. Bu Türkiye’nin en büyük altyapısı demek. Miktar hakkında net bilgi veremem ama yayıncılarını memnun edecek miktarlar olduğunu söyleyebilirim. 47
  • 45. Mobil Ödeme platformunuz hakkında bilgi alabilir miyiz? mobilodeme.com, mobil ödeme sistemiyle alışverişe olanak sağlayan bir çözüm altyapısıdır. Çözüm ortakları ve üye iş yerlerine sunduğu API’lerle onların müşterilerinin mobil ödeme sistemini kullanmasını sağlar. Tüm operatörlerle entegre bir şekilde çalışarak cep telefonu üzerinden tahsilatlarda aracılık etmektedir.Iframe, Web ve SMS modelleri ile ücretsiz hizmet veren bir sistemdir. HaberYazılımıservisinizileücretsizhaber portalısahibiolmaimkanısunuyorsunuz. Referanslarınız arasında önemli medya kuruluşları ve hatta bir de spor kulübü var. Bu konuda neler söyleyebilirsiniz? 2100’den fazla haber sitesi haberyazilimi. com sayesinde yayın yapmakta. Üstelik ücretsiz olarak. Bu çok büyük ve önemli bir servis.Referanslarımızhergeçengünartmakta. Büyükmedya şirketleri artıkbu altyapıyı tercih etmeye başladı. Ücretsiz web alanı nedir? Hazirsite.com projelerimizden birisi olan ucretsizwebalani.com kendi web sitesi olan müşterilerimize ücretsiz sunucu ve ayrıcalıklı hizmetler sunmaktadır. Kullanıcılarımıza site oluşturma ve yönetimi hakkında müşteri hizmetleri departmanımız tarafından sürekli olarak telefon ve mail yolu ile destek verilmektedir. 48
  • 46. 49
  • 47. 50 Kurumsal ve Bireysel tüm İnternet Yayıncıları / Haber Siteleri, E-ticaret siteleri ve Bloggerlar kendi altyapısını kullanarak ucretsizwebalani.com’un sağladığı sunucu hizmetlerinden faydalanabilirler. Müşteri sayımız; güçlü alt yapımız ve sınırsız desteğimiz sayesinde günbegün artmaktadır. Hazır blog ile ücretsizwordpress hosting imkanı sunuyor ve herkesin blog sahibi olmasını sağlıyorsunuz. Bu konuda bilgi alabilir miyiz? Yine hazirsite.com’un projelerinden biri hazirblog.com.Blog sahibi olmak isteyenlere ücretsiz destek sağlıyoruz. Sistemde bulunan bütünleşik sosyal paylaşım olanakları sayesinde de arkadaşlarınız,yakın çevreniz ve takipçileriniz, blogunuzda olup bitenlerden anında haberdar olurlar. Wordpress’in gelişmiş yazılımını hazirblog. com ile ücretsizyayınlayabilir tüm kullanıcılar. İnterbilet ve ikyazılımı ile sunduğunuz hizmetler hakkında bilgi alabilir miyiz? Interbilet; müşteri ilişkileri oluşturmak, etkinliklerinizi organize etmek ve müşterilerinizin biletlerinizi zahmetsizce alabilmesi için en iyi çözümleri üretmek için oluşturulmuş bir sistem.
  • 48. İnterbilet ve ikyazılımı ile sunduğunuz hizmetler hakkında bilgi alabilir miyiz? Interbilet; müşteri ilişkileri oluşturmak, etkinliklerinizi organize etmek ve müşterilerinizin biletlerinizi zahmetsizce alabilmesi için en iyi çözümleri üretmek için oluşturulmuş bir sistem. Şu anda bir çok konser ve etkinlik için servisler vermeye başladık.Spor kulüplerinin de ilgisini çekmeye başladı altyapımız. Bu konuda da girişimlerimiz devam ediyor. İK Yazılımı firmaların kendi kariyer yönetimi ve insan kaynakları yönetimini aynı platformdan gerçekleştirmeleri amacıyla kurulmuş bir sitedir. Firmalar; bu platformdan isterlerse kendi iş ilanlarını yayınlayabilirler, isterlerse özgeçmiş toplayıp bunları değerlendirmeye alabilirler. Eticaretci ve e-pazaryeri servisleriniz ve sunduğunuz hizmetler hakkında bilgi alabilir miyiz? E-pazaryeri TURKTICARET.Net’in altında alıcılar ve satıcılar için ayrı ayrı düzenlenmiş bir yapıya sahiptir. E-pazaryeri sayfalarında 300.000’i aşkın ürün sergilenmektedir. eticaretci.comdaticaretininternetortamında yapıldığı günümüzde SSL dahil tüm altyapıyı ücretsiz olarak sunmakta. Bunun yanı sıra hızlı ve kolay kullanımı, 14 banka ile entegrasyonu, sürekli yenilenen özgün tasarım seçeneği ve gün geçtikçe artan tedarikçi entegrasyonu ile proje TURKTICARET.Net’in yüz aklarından… 51
  • 49. 52
  • 50. 53 Burada da opencart altyapısı kullanılmakta ve tüm modülleri ile ücretsiz servis sağlanmakta. Yeniservis,hizmet,yatırımgibiplanlarınız ve çalışmalarınız var mı? Teknolojinin bu kadar hızla ilerlediği günümüzde yenilikler ve çalışmalar bitmez. Yeni projeler tabii ki var. Ama biraz zamana ihtiyacımız var bunları hayata geçirebilmek için. Şu an yeni ofisimizle birlikte mevcut projelerimizi büyütmeyi hedefliyoruz. Yeniliklerden biri olarak sadece şunu iletebilirim. Mobil bir oyun hazırladık. Onu sunmaya başlıyoruz. TURKTICARET.Net’in gelecek planları hakkında bilgi alabilir miyiz? TURKTICARET.Net bulunduğu coğrafyanın dışına taşmayı amaçlıyor. Bölgesel bir oyuncu olma hedefimiz var. Tüm çalışmalarımız bu yönde.
  • 51. 54 Webhosting sektörü hakkında neler söyleyebilirsiniz, değerlendirmeleriniz ve görüşlerinizi alabilir miyiz? Web Hosting piyasasını süt sektörüne benzetiyorum. Sektörün büyük firmaları birbirlerini rakip görmezler rakipleri olarak sokak sütçülerini görürler. Hiçbir şekilde gerekli koşullarda üretilmeyen sütü evlere kadar sağlıksız bir şekilde götürdükleri için bu değerlendirme yapılır. Web Hosting piyasası da bu şekilde.O kadar çoksokaksütçüsü türedi ki bu sektörde,rakiplerimiz onlar.Çünkü hiçbir gerekli koşulu yerine getirmeden çok yetersiz bir şekilde hatta bir tane serverla bende bu hizmetiveriyorum diyen onbinden fazla kişiya da firma var sektörde. Bunları BTK’nın hızlıca düzenlemesi gerekir. Zaten ortada gerekli yönetmelikler var fakat takip yok bu konuda. Aynı zamanda Türkiye’de web hosting firmaları arasında son kullanıcı odaklı hizmet veren çok fazla firma olmaması, biraz önce bahsettiğim nedenler ve Türkiye’de altyapı maliyetlerin yüksek olması bir çok site sahibini ve webmasterı da yurtdışı şirketler ile çalışmaya yönlendirmekte. Biliyorsunuz hayatımıza kısa süre önce bulut bilişim kavramı girdi. Bu web hosting firmaları için yeni bir yatırım ve yeni bir hizmet. Bu sektörün öncü firmalarından biri olarak gerekli yatırımlarımız bu noktada yapmış bulunmaktayız. Müşterilerimize daha düşük maliyetli ve daha kaliteli hizmet vererek sektörde pazarın büyümesinde etkili bir rol oynayacağımızı düşünüyoruz.
  • 52. 872305 Adhood 50TL‘LİK REKLAMVEREN KUPONU WM Dergi Kampanyasını ve Kupon Kodunu Belirterek Reklam Verebilirsiniz Kupon Kodu: adhood-v3 ARA, KODU SÖYLE, HEMEN SİPARİŞ VER 0 224 224 86 40 www.adhood.com
  • 53. Blog’cuların Düştüğü 5 Büyük Hata Blog yazarlığı zor bir iştir, ancak ne yazık ki günümüzde bu zorlukları kolay yollardan aşabileceklerini düşünen blogcu arkadaşlarımız var.Her ne kadar herkes bloglarının tanıtımını, tanınırlığını arttırmak için uğraşsa da bu arkadaşlarımız düştükleri bazı hatalar nedeniyle blog dünyasında başarısız oluyor. Bu yazımda ise sizlere başarısız olmamanız ve sıkça düşülen hatalara düşmemeniz için bazı önerilerde bulunacağım. Açıklık Eksikliği Ne yazık ki bir çok blogcu arkadaşımız henüz neden blog yazmak istediklerine, ne yazacaklarına, hedeflerine karar vermediklerinden büyük bir kargaşa içerisinde blogculuk hayatlarına başlıyorlar. Belki de ilk günler de her şey yolunda gidiyor gibi gözüküyor ancak bir süre sonra bıkkınlık,sıkıntı ve konu bulamama gibi sorunlar baş göstermeye başlıyor. Sizdeeğerhayalkırıklığına uğramak istemiyorsanız öncelikle önünüze bir kağıt alıp üzerine blogunuzun hedefleri, neler yazmak istediğinizi, neden blog yazmak istediğinizi yazarak her zaman görebileceğiniz bir yere asın. Her işinizi önceden planlayın. Eğer geleceğe yönelik planlarınız yoksa siz de hayal kırılığına uğrayıp, blogculuğu bırakacak arkadaşlarımızdansınız. Mehmet Burak İşçi www.burakisci.com mbisci@wmdergi.com 56
  • 54. Kopyalama Peşinde Koşmak Ne yazık ki sizi bir diğer hayal kırıklığına uğratacak durumsa kopyalama peşinde düştüğünüz içerikler. Ne yazık ki gelişen internet dünyasında bilgi hırsızlığı başını aldı gidiyor. Artık her ne kadar fizikselyaşlarıdeğildezihinsel yaşların ergenlik çağlarında kalmış birçok kişi yüzünden içerik kopyalanmasının önüne geçemez olduk. Bir blogu blog yapan onun içeriğidir. Her blogun kendine özgü bir ruhu, bir havası vardır bunu ise blogda ki içerikler oluşturur. Üretken bir blog oluşturup insanlara yararlı olmak yerine, sağdan soldan içerik kopyalayıp tek amaçlarının para kazanmak olduğu bu kişilerin sonları da iyi ki hayal kırıklığına uğramaktır. Küçük Şeyler Üzerinde Fazla Zaman Harcamak Ne yazık ki iyi niyetli arkadaşlarımızın çoğu küçük şeyler üzerine gereğinden fazla zaman harcayarak asıl işleri olan blog yazarlığında aksamalar meydana getirebiliyorlar. Özellikle de yazı yazma işleminiz sırasında takıldığınız küçük şeyler yüzünden kaybettiğiniz zaman ve ilginiz size birçok şey kaybettirecektir. Blogunuzda düzenlemek istediğiniz şeyleri ikinci plana atmalısınız çünkü içerik her zaman daha önemlidir. Bencillik İçeriğinizi hazırlarken bencil davranmamalısınız. İnsanlara yararlanabilecekleri bir şeyler sunmalısınız ki blogunuz sevilsin. Bir içerik yazarken ziyaretçilerinizin tepkisi ne olur, bu yazı nasıl karşılanır diye de düşünmelisiniz. Bırakıyorum Çoğu yeni arkadaşımızın karşılaştıkları ilk sorunda verdikleri tepki ben bu işi bırakıyorum oluyor. Zaten bu arkadaşlarımızın arasında yılmadan yoluna devam edenler ise bugün çok iyi konumlara gelebiliyorlar. Unutmayın ki hayat da önünüze her zaman zorluklar çıkarabilir,burada önemli olan ise bu zorlukları aşabilecek inancınızın olması. 57
  • 55. 66 WordPre
  • 56. ess Bu ay WordPress özel bölümümüzde, çeşitli WordPress eklenti ve tanıtımlarına yer veriyoruz... Eklenti Tema Makale
  • 57. Blog’unuzdakiTeknik Detayları Optimize Edin Gelişen web dünyasında sitelerin açılış hızları her geçen gün önemlerini arttırmaktadır. Artık hiç kimse bir siteye girip dakikalarca o sitenin açılmasını beklemiyor, bunun en büyük nedeni de internette çeşitliliğin artması. Örneğin bir arama sonucunda birinci sırada çıkıyorsunuz diyelim, eğer sitenizin açılma hızı çok yavaş ise insanlar her ne kadar ilk sırada çıksanızda sizin sitenizin açılmasını beklemeyecekler, sıralamalarda ki diğer sitelere bakacaklardır. Haliyle sitenizde geçirilen ortalama süredebüyükbirdüşüş,hemen çıkma oranında ise büyük bir artış gözlemlenecektir. Araştırmaların bize sunduğu sonuçlara göre bir sitenin açılış hızı; siteye duyulan güven,arama sıraları ve arama sıralarında ki sıçramalar üzerinde oldukça etkilidir. Öncelikle arkadaşlar sitenizin hızı ve verimi konusunda emin olmalısınız. İnternette bunları ölçmenizi sağlayacak birçok araç vardır ancak içlerinden size en çok önerebileceğim Gtmetrix’dir. Gtmetrix servisi ile sitenizi sorguladığınızda sitenizin hız puanını gösteren sonuçlar size gözükecektir. Bu servisin en sevdiğim yanı ise sitenizi yavaşlatan unsurları ayrıntılı bir biçimde göstermesi ve bize çözüm yolunu da göstermesidir. Bu servise alternatif olarak kullanabileceğiniz Google Page Speed servisi vardır. Hemen hemen ikisinin sonuçları aynı çıkar ancak Google Page Speed servisi Gtmetrix kadar ayrıntılı değildir. Eğer sitenizin hızı düşük çıkıyorsa sitenizde optimize etmeniz gereken yerler var demektir. Zaten sitenizi yavaşlatan faktörleri Gtmetrix servisi ile görebileceğinizden dolayı bunlara karşı önlemlerinizi alacaksınızdır. Ben yine de internet sitelerini yavaşlatan belli başlı faktörlerden ve çözüm yollarından bahsetmek istiyorum. Tarayıcı Önbellekleme Kullanın Genellikle çoğu webmasterın gerek Gtmetrix’de gerekse de çeşitli SEO analiz araçlarında karşılaştıkları en büyük sorunlardan biri de tarayıcı önbellekleme kullanımıdır. Kısacatarayıcıönbelleklemeyi açıklamak gerekirse; daha önceden girdiğimiz herhangi bir siteye tekrar girdiğinizde bir önceki girdiğimizde ki dosyaları görmemizdir. Bunu daha somut bir örnekle açıklamak gerekirse. Hemen hemen hepimizin temalarında jQuery dosyaları bulunuyor fakat bildiğimiz gibi bu dosyaların boyutları oldukça yüksektir ve hepsinin yüklenmesi bazen sitenin açılma hızını on saniyenin üzerine çıkarabilmektedir.İşte bu noktada devreye tarayıcı önbelleklemegiriyor.Siteyebir keregirenkullanıcıodosyaları bir kere sisteminde geçici bir klasöre yüklemiş oluyor, eğer bu kullanıcı sitenize daha sonradan tekrar girerse dosyaları tekrar yüklemek yerine sistemine kaydettiği o dosyaları görüntülüyor bu sayede de sitenin açılış hızında %80’e varan artışlar gözlemlenebiliyor.Bu işlemi WordPress’de kolayca yapabileceğiniz bir eklenti mevcut. 60
  • 58. Eklentimizin adı W3 Total Cache, ancak eklentiyi daha önceden hiç kullanmadığım için kullanımı hakkında yardımcı olamayacağım. CDN Kullanın Şimdi bu CDN ne diyebilirsiniz, çünkü bir çok blogda bahsedilen bir konu değildir ancak sizi başarıya götürecek çok önemli bir faktördür.CDNsistemiözellikle de uluslararası projeler için daha yararlıdır. CDN sitenizde ki resim, jacascript, CSS gibi içeriklerinizi koyabileceğiniz bir nevi depolama alanıdır. Siteniz açılırken bu dosyaları ise kendi sunucunuz yerine bir CDN servisi üzerinde sitenize yüklersiniz. Size sağlayacağı avantaj ise, bu işlemin tarayıcıların paralel indirme yapmasını sağlamasıdır. Yani sayfalarınız aşırı hızlı yüklenirler. Kullandığınız CDN servisi eğer dosya sıkıştırma sistemlerini de kullanıyorsa sitenizin açılma hızı milisaniyelere kadar düşebilir. İkinci büyük yararı ise bu CDN servislerinin dünyanın her yerinde sunucularının bulunması. Mesela Türkiye lokasyonlu bir siteye New York’tan bağlanan birisi sitenizi çok yavaş açacaktır, çünkü öncelikle sitenize bağlanma isteğinin New York’tanülkemizegelip,yanıtın geri dönmesi gerekir ki arada ki mesafeyi de hesaba katınca bu işlem gerçekten uzun sürmektedir. Ancak eğer bir CDN servisi kullanırsanız New York’tan sitenize bağlanmak isteyen birisi CDN servisinin NewYork üzerinde ki sunucusu üzerindensitenizdekidosyaları çekeceğinden dolayı sitenize ilk duruma göre katlarca daha hızlı bağlanacaktır. Genellikle bu kullanımlar Facebook, Twitter, Google gibi büyüksitelerbaştaolmaküzere neredeyse tüm uluslararası projelerde kullanılıyor. CDN sistemini bulut sistemi olarakta düşünebilirsiniz. Sıkıştırılmış Resimler Kullanın Sitenizde ki resimleri optimize etmek, sitenizin hızı açısından çok önemli bir etkendir. Özellikle de bir sitede bulunan en yüksek boyutlu dosyaların genellikle resimler olduğunu düşünürsek, bu resimlerin boyutlarının küçültülmesinin sitelere sağlayacağı gözle görülür artışı da göz ardı edemeyiz. Bildiğiniz gibi arkadaşlar yaptığım temalarda SEO uyumluluğu ve hız konularına çok dikkat ederim, yaptığım temalarda ki resim optimizasyonlarını yaptığımda yazının başında belirttiğim servislerde en az 20 puanlık bir artıkgörmekteyim.Buradan resim optimizasyonunun önemini anlamışsınızdır zaten. CSS Sprite oldukça önemli bir resim sıkıştırma yöntemidir, onlarca resmi boyutu hepsinin toplamına göre çok düşük kalan bir resimde toplarsınız ve siteniz açıldığında onlarca resmi sorgulamak yerine sadece tek bir resmi sorgular. Bir diğer yöntem ise sitelerinize eklediğiniz resimleri (genellikle öne çıkarılmış görseller) bir resim sıkıştırma aracı ile boyutunu düşürerek sitenize eklemelisiniz.Zaten bu konuda büyük ihtimalle Gtmetrix sizi uyaracaktır. Gtmetrix’in en sevdiğim yanlarından biride optimize etmemizi istediği resimleri, otomatik olarak optimize edip bize sunmasıdır ve bu sayede hiçbir program indirmeden resimlerimizi optimize etmiş oluyoruz. Mehmet Burak İşçi mbisci@wmdergi.com 61
  • 59. WP EKLENTİ TANITIMLARIWordPress sitenizi geliştirebileceğiniz ve ektra özellikler ekleyebileceğiniz çeşitli ve ücretsiz eklenti tanıtımlarını her ay bu sayfalarımızda bulabilirsiniz... 62 Sociable Sitenizdeki ziyaretçilerin içeriklerinizi ve yazılarınızı sosyal ağlarda paylaşması için geniş seçenekler sunan bu eklentiye mutlaka göz atmalısınız. Demo : Yok Download : İndirmek İçin Tıklayınız WMD Puanı WPtouch Bu eklenti ile, web sitenizi mobil uyumlu bir hale getirebilirsiniz.Popüler mobil işletim sis- temi ve platformları otomatik tanıyan ve sit- enizi uyumlu hale getiren bir eklenti. Demo : Yok Download : İndirmek İçin Tıklayınız WMD Puanı 5WMDP WordPress.com Stats WordPress sitenizin ziyaretçilerini ayrıntılı bir şekilde, tekil, çoğul, ülke ülke ve gün gün raporlanmış bir şekilde görebileceğiniz yararlı bir eklenti. Demo : Ekran Görüntüleri Download : İndirmek İçin Tıklayınız Watermark RELOADED WMD Puanı Sitenizdeki resimlerin üzerine site adı veya adresinizi yazabileceğiniz kullanışlı bir eklenti.Ücretsiz olarak wordpress eklentiler sayfasından indirebilirsiniz. Demo : Yok Download : İndirmek İçin Tıklayınız WMD Puanı
  • 60. WP TEMA TANITIMLARIÇeşitli WordPress temalarını sizler için değerlendiriyoruz.Her ay en güzel ve çeşitli tema tanıtım ve değerlendirmelerini bu sayfalarımızda bulabilirsiniz... 63 Presto - Powerful Blog/Magazine Presto teması henüz bir kaç gün önce yayınlanan blog ve haber sitesi teması.6 farklı sayfa düzeni ve sınırsız renk seçeneği sunuyor. Demo : Tıklayınız Download : İndirmek İçin Tıklayınız Flavor - Responsive/HD Magazin WMD Puanı Flawor isimli tasarım, HD ve responsive yapısıyla tüm cihazlara uyumlu ve ajax yapısı ile dikkat çekiyor.Haber ve incel- eme sitesi için hazırlanmış bir tema. Demo : Tıklayınız Download : İndirmek İçin Tıklayınız WMD Puanı 5WMDP Staggerly - Responsive News Doofer Blogging Theme Staggerly teması, responsive yapıya sa- hip, bir çok renk seçeneği sunan ve al- ternatif anasayfa & blog tasarımları bu- lunan bir tasarım. Demo : Tıklayınız Download : İndirmek İçin Tıklayınız Doofer blog teması, sadec ve mini- malist yapısı ile öne çıkıyor.Geniş renk seçeneği ve birçok menü &widget desteği ile hazır geliyor. Demo : Tıklayınız Download : İndirmek İçin Tıklayınız WMD PuanıWMD Puanı
  • 61. 7462 Ayın Blog Site Hibestil Halil İbrahim Bestil’in, WordPress, Nasıl Yapılır, Teknoloji, Web Tasarım gibi bir çok alanda zengin içerikler barındıran blogu. www.hibestil.com Siz de blog sitenizi, bs@wmdergi.com ‘a iletin her ay bu bölümde okuyucularımızla paylaşalım... Gezi Gerçekler AtaİsmetÖzçelik,internetteyayılan ‘saçma photoshop vakalarını’, yalan-yanlış bilgileri doğrularını göstererek paylaşmaya çalışıyor. gezigercekler.tumblr.com
  • 62. eleri 71 İlgi çekici, işlevsel, yaratıcı web siteleri her ay, Site Tanıtımları sayfalarımızda... Sosyal medya, web ve internet dünyasından güncel haberler yayınlayan, etkinlikler ve röpor- taj bilgileri sunan güncel site. www.sosyalmedyaport.com Sosyal Medya Port Salih Çaktı Uluslararası Sosyal Medya Derneği Genel Sekreteri Salih Çaktı, blo- gunda sosyal medya, iş geliştirme ve sektörel alanda yazılar yayınlıyor www.salihcakti.com
  • 63. 66 SEO DostuTema Geliştirmek İçin 30 İpucu Bir siteyi öne çıkaran en önemli faktör, sitede kullanılan temadır. Sitenizde kullandığınız tema sadece ziyaretçilerinizi etkilemekle kalmaz size artı veya eksi olarak SEO konusunda birçok getirisi olur. Bu yazımda sizlere SEO uyumlu olarak bir tema geliştirebilmeniz için bazı önerilerde bulunacağım. Eğer önerilerime uyacak olursanız temanız hem daha işlevsel hale gelecektir hem de arama motorları tarafından daha kolay taranabilir bir hale. Ülkemizde neredeyse hemen hemen her gün yeni bir tema çıkarılmakta, ancak neredeyse herkes temalarının açıklamalarına SEO uyumlu tema yazıyor yaptıkları tek şeyde her sorgulama da farklı sonuçlar veren WMARACI SEO analiz aracından 80 üstü puan almak. Daha sonra gidiyorsunuz GTMETRİX’den o siteyi sorguluyorsun D D kalite çıkıyor yani kullanabileceğiniz en kötü kalite düzeyine sahip temalardan biri, aynı şekilde Google Page Speed testi yapıyorsunuz yine temalarının hızı elliyi zor zahmet geçiyor ve bu temalara SEO uyumlu tema diyorlar. Ne yazık ki ülkemizde de kimse bu temaları sorgulamadığından, açıklama kısmına inanıp temaları kullanıyorlar ancak birkaç hafta sonra forumlarda açtıklarıkonularisekendilerini ortaya çıkarıyor. Tasarımlarını Optimize Edin Her ne kadar kaliteli içeriklerle sitenizi doldursanız da muhakkakoptimize edilmiş bir temaya ihtiyacınız vardır, yoksatümuğraşlarınızyetersiz kalır. Optimize konusunda sitenizin sadece bir bölümünü değil tüm kısımlarınızı optimize etmelisiniz. Düzgün bir içerik sunma, koyu bir hiyerarşi ve kolay navigasyon etkili bir web varlığı için vazgeçilmez anahtarlardan birisidir. Kullanıcı Dostu Navigasyon ve İşlevsellik İpuçları Web tasarım ve geliştirme ekibiniz ile sürekli tartışma içinde olmalısınız. Temanızda ki en ufak detaya kadar her şeyi incelemeli, kullanıcılar için zorluk oluşturabilecek noktaları temanızdan çıkarmalısınız. • İçerik sayfalarınızın üst kısmında bulunan bir nevi navigasyon görevi gören, kullanıcın yerlerini gösteren menüyü muhakkak kullanmalısınız. Örnek bir resim; • Text linkler kullanmaya özen gösterin. Text linklerde kullanmayı unutmamanız gereken en önemli faktör title=”açıklama”tagıdır.Buyapı linklerinizle ilgili açıklamalar içerir ve hem kullanıcıya hemde arama motoru botlarına büyük kolaylıklar sağlar. Bu yüzden bu yapıyı muhakkak temanızda ki tüm bağlantılarda kullanmalısınız. Gerçekten önemli bir maddedir. • Açılış yani anasayfanız kullanıcıların sitenizde ki tüm bağlantılara ulaşabileceği bir işlevsellikte olmalıdır. Muhakkak temanın bir köşesinde bir arama kutusu, kategorilerin listelendiği bir kısım, tercihe göre de arşivlerin listelendiği bir kısım temaya eklenmelidir. Bunlar sayesinde kullanıcı sitenizde ki herhangi bir bağlantıya rahatlıkla ulaşabilecektir.
  • 64. • Temaların genellikle üst kısımlarında “logo, slogan, menü, reklam alanı, twitter kutusu, arama kutusu” gibi alanlar bulunur. Bir ziyaretçi siteye girdiğinde ilk gördüğü kısım header dediğimiz bu üst kısımdır. Ziyaretçiyi etkilemek istiyorsanız bu üst kısmı çok dikkatli ve ilgi çekici şekilde tasarlamalısınız. • Bazı temalarda gördüğümüz bir olay var. Her kategoride farklı bir şablon kullanmak. Böyle bir kullanım ziyaretçiyi karmaşıklıktan başka bir şeye sürüklemeyeceğinden dolayı, kategorilere özel farklı şablonları kullanmamanızı öneriyorum. • Bazı temalar çok geniş olabiliyor, bu durumda da tarayıcıların alt kısmında sayfayı sağa sola kaydırmak için yatay kaydırma çubuğu beliriyor. Böyle bir durum kullanıcı dostu olmadığından size önermiyorum. Tasarım genişliklerinizi tüm ekran çözünürlüklerini dikkate alarak tasarlamalısınız. • Sitelerin açılış hızlarının sıralamaları etkilediği daha önceden Googletarafındanbelirtilmişti. Bu durumda temanızda sitenizi yavaşlatacakunsurlara yer vermemelisiniz. Elinizden geldiğince CSS Sprite yöntemini kullanmalısınız. • • Unutmayın yavaş açılan temalar hemen çıkma oranını arttırabileceği gibi, sıralamalarınızı da düşürecektir. • Pop-up ve benzeri kullanıcı rahatsız edecek reklam alanları kullanmaktan kaçının, reklamları da ziyaretçilerin gözüne sokmamaya dikkat etmelisiniz aksi taktirde o ziyaretçinin sitenize bağımlılığı çok iyi olmayacaktır. • Bunların dışında Google Webmaster Yönetici Kurallarında bahsedilen detaylara da dikkat etmenizi öneririm. İçerik Optimizasyonu • Çok uzun yazılar ve fazlasıyla kullanılan anahtar kelimeler kullanıcı dostu değildir. Yazılarınızı olabilecek en kısa seviye de tutmalısınız. • Unutmayın ki bir yazı içerisinde ki anahtar kelimenizin kullanım oranı aşırıya kaçarsa bundan çok büyük zarar görürsünüz. • B a ş l ı k l a r ı n ı z d a H1, H2, H3, H4, H5, H6 etiketlerini kullanmaya özen göstermelisiniz. • R e s i m l e r i n i z d e mutlakaalt=”resimaçıklaması” etiketini kullanmalısınız. Unutmayın, arama motorları resimleri analiz edemezler ve resimlerin ne ile ilgili olduklarını anlayabilecekleri tek etiket sistemi budur. • Eğer gerçekten arama motorlarında iyi bir sıralama almak istiyorsanız yazılarınızda flash içerik kullanmaktan kaçınmalısınız. Web Tasarım ve Pazarlama Elementleri • Z i y a r e tç i l e r i n i ze içerik veya temanız hakkında yorumlar yapmayı teklif edin, kullanıcıların yorumları sizi daha üst seviyelere taşıyacaktır. • Ziyaretçiler için oldukça basit bir dönüşüm modeli hazırlamalısınız, alt seviye de internet bilgisine sahip olan birisi bile sitenizde rahatlıkla dolaşabilmeli. 67
  • 65. • T a s a r ı m ı n ı z d a muhakkak görünür bir yerde sosyal paylaşım ikonları yer almalıdır. Ziyaretçilerin beğendikleri yazıları rahatlıkla sosyal medya da paylaşabilmeleri gerekmektedir. • Temanızda ve içeriğinizde çekici ve açıklayıcı görüntüler kullanın. • Eğer büyük bir proje hazırlıyorsanız temanızın tüm fonksiyonlarını çeşitli dillerle uyumlu olabilecek şekilde ayarlamalısınız. Unutmayın ki her dilde cümle yapıları değişmektedir. • Reklam alanlarının temanızda uygun bir yerde olduğundan emin olun,hemen hemen her kullanıcı bir tema da reklam alanı aramaktadır. Sizde onlara istediklerini verin. • Kullanıcılara öneri etiketleri sunmalısınız. Siteniz hangi konu ile ilgiliyse o konu hakkında önerdiğiniz bazı sayfaları vs. temanızda bir köşe de göstermelisiniz. • Çekicivekullanıcıdostu bir tema; bağlantılar çekmek için, hemen çıkma oranını azaltmak için, sitede geçirilen ortalama süreyi arttırmak için oldukça etkili bir yöntemdir. SEO Dostu Sitelerin Teknik Yönleri • Tamamenflashiçerikten oluşan bir site inşa etmekten kaçınmalısınız unutmayın ki aynı etkiyi jQuery kullanarak da oluşturabilirsiniz. • Navigasyon için de flash kullanmaktan kaçının. • Aşırı Javascript ve Ajax kullanımından da kaçınmalısınız. Unutmayın ki bu diller internet sitelerini fazlasıyla yavaşlatırlar. Diğer yandan bu dillerin telefonlar da çalışma sorunları da bulunmaktadır. • Temanızın her ekran çözünürlüğünde rahatça görüneceğinden emin olmalısınız. Sitenizi minimum 1024 x 768 ekran çözünürlüğünde rahat görünebilecek bir seviye de tasarlamalısınız. Sitenize giren ziyaretçilerin en çok hangi ekran çözünürlüklerini kullandıklarını görmek içinse Google Analytics’i kullanabilirsiniz. • Temanız başta Internet Explorer olmak üzere tüm tarayıcılar da düzgün gözükmelidir. • Arama motoru botlarının sitenizi daha iyi analiz edebilmesini sağlamak için, onlara özel olarak bazı eklentileri ve flash içerikleri kaldırabilirsiniz. • Sizde arkadaşlar bu konu hakkında atladığım ya da değerli gördüğünüz maddeleri yorum olarak belirtirseniz konuyu okuyacak arkadaşlarımız açısından daha faydalı olur. 68 Mehmet Burak İşçi mbisci@wmdergi.com
  • 66. 71972305 TIKLA HEMEN ABONE OL! a b o n e . w m d e r g i . c o m WM Dergi‘ye ABONE OL http://abone.wmdergi.com WM Dergi, Her Ay E-Mail’ine Gelsin
  • 67. WM İK SEKTÖREL TEMMUZ 2013 Natro İK UZAKTAN DESTEK UZMANI natro.com müşterilerine uzaktan destek (chat) yazılımı ile satış ve satış sonrası bilgilendirici destek hizmetini sunmak. Uzaktan destek ekibi zaman ve ofis bağımsız çalışmaktadırlar. Bu sebeple üniversite öğrencileri ya da evinden çalışmak zorunda olan bedensel engelliler için ideal bir iş imkanıdır. Online Başvuru: Tıklayınız Natro İK WEB TASARIM UZMANI Adobe Photoshop ile web sitesi tasarımı, - Tasarımların html ve css düzenlemeleri yapılmış olarak yazılım departmanına aktarımı. * Web sitesi ve Web Uygulama Tasarımları konusunda daha önceden yaptığı çalışmaları referans olarak gösterebilmesi gerekmektedir. Online Başvuru: Tıklayınız İsimtescil İK SİSTEM VE DESTEK UZMANI Ürün ve hizmetlerimiz ile ilgili telefon ve yazılı olarak gerekli desteği sağlamak, Windows ve/veya Linux işletim sistemlerinde deneyimli,ASP, PHP, ASP.NET yazılım dillerinde giriş seviyesinde bilgi sahibi, IIS, Apache, FTP, DNS, Mail Server, SQL Servisleri konularında bilgi sahibi, Müşteri ilişkilerinde başarılı. Online Başvuru: cv@isimtescil.net İsimtescil İK YAZILIM UZMANI Geliştirilmekte olan domain ve host otomasyonu vb. her türlü projede; Mevcut yapıya uygun şekilde teknik analiz, teknik tasarım, veri tabanı tasarımı ve mimari altyapı çalışmalarını gerçekleştirmek, Üretilen fonksiyonların test senaryolarını ve testleri yapmak,Ürünlerin test ortamından güncel ortama taşınmasını sağlamak. Online Başvuru: cv@isimtescil.net 70
  • 68. WM İK SEKTÖRELMarkum İK WEB HOSTİNG UZMANI Hosting sektörünü tanıyan ve benzer pozisyonda çalışmış, Windows veya Linux sistemlerde deneyim sahibi, IIS ve/veya Apache Web Server, FTP, DNS, Mail Server, MySQL ve/veya MSSQL Server, ASP, ASP. Net, PHP vb. hosting bileşenleri hakkında bilgi sahibi, kurumsal yazılı ve sözlü iletişim becerisine sahip. Online Başvuru: cv@markum.net SadeceHosting İK SİSTEM YÖNETİCİLERİ Linux ve/veya Windows platformlarında tüm hosting ortamına hakim, ilgili alt yapı yazılımlarının ayar, optimizasyon ve performans konularında uzman derecede yetkin olan, 7/24 vardiyalı olarak görev yapan sistem yönetim ekibimiz için görev arkadaşları aramaktayız. Online Başvuru: Tıklayınız İş Arıyorum MUSTAFA ÇAKMAK Öğrencisiyim ve internet sektöründe çalışmak, kendimi geliştirmek istiyorum.Bu alanda kariyer yapmak hedeflerim arasında yer almaktadır. Web hosting, uzaktan destek ve benzeri pozüsyonlarda iş arıyorum. İletişim: bloggeradmin@teknofiber.net TEMMUZ 2013 SadeceHosting İK YAZILIM GELİŞTİRİCİLER Geliştirme ekibimizde görev yapmak üzere linux platformu üzerinde PHP-MYSQL alanında en az 5 yıllık deneyimi bulunan, css-js konularına eksiksiz derecede hakim, html konusunda sorunu bulunmayan uzman yazılım geliştirici çalışma arkadaşları aramaktayız. Online Başvuru: Tıklayınız 71
  • 69. Bir kaç hafta önce kod parçacıkları incelerken yine kulağı tersten tutmaya çalışanbirkodilekarşılaştım ve “Hazırlanacak Makaleler” listeme not ettim.:) Kullandığımız diller bize bir çok fonksiyon sunmasına rağmen bir süre sonra bunlar da yetersiz kalmaya başladı ve “framework” kullanarak işlerimizi daha da hızlandırmaya çalıştık, hala da süreçleri daha fazla hızlandırmak için çalışıyoruz. Bunun ana sebebi biz yazılımcıların çalışma saatlerini şirketlere / işverenlere ücret karşılığında kiralayarak çalışıyor olması sanırım. Bu yüzden bizi fazladan kod yazmaktan kurtaracak fonksiyonları zorluk derecesine bakmadan bu yazıda paylaşacağım. Bazı projelerde bol haneli sayıları arayüzde göstermemiz gerekir. (Örneğin : Kullanıcının kazandığı toplam puan) Bu tarz durumda ekrana 1250145 - bir milyon iki yüz elli bin yüz kırk beş -sayısını direk yazarsak okunması oldukça güç olacaktır. Bu sayıyı sondan üçer haneler şeklinde ayraçlarla bölmemiz gerekebilir. n u m b e r _ f o r m a t fonksiyonundan haberdar olmayan bir meslektaşım aşağıdakine benzer kod yazarak araya ayraçlar eklemiş. Fazla Bilinmeyen Php fonksiyonları 2 İbrahim Hızlıoğlu ibrahimhizlioglu.com ihizlioglu@wmdergi.com 72
  • 70. 73 Bu örnek daha az satır kod yazarak başka şekillerde de hazırlanabilir. Ben buna benzer bir kod ile karşılaştığım için direk bu örnekten gitmek istedim. Bu kadar kod yazmak yerine Php’nin bize sunduğu fonksiyonu kullansaydık tek satırda işimizi çözecektik.:) Benzer bir işlemi para birimleri için yapmak isterseniz yine imdadınıza yetişecek bir fonksiyon bulunuyor. Para işlemleri için money_format , sayı işlemleriniz için number_ format fonksiyonlarını inceleyebilirsiniz.
  • 71. 74 Geçtiğimiz ay yayınladığımız 13 web uygulamasısizlerdenoldukça güzelbirilgigörüncebunubir adım ileriye taşımak ve her ay, webmaster araçları’ndan oluşan programları sizler için derleyerek yayınlamaya karar verdik. Bu ay, tamindir ‘in desteği ile hazırladığımız webmaster araçları sayfalarımızda, »» Metin editörleri »» Veritabanı yazılımları »» SEO yazılımları »» Tasarım araçları »» Optimizasyon aracı »» PDF aracı »» Analiz yazılımları gibi birçok konuda işlerinizi kolaylaştıracak, bir adım ileriye taşıyacak ve belki de bilgi sahibi olmadığınız konularda size yardımcı olacak ve çalışmalarınızı geliştirmenizi sağlayacak programları derleyerek bir araya getirdik. Sizler de bu sayfalarda yayınlanmasını istediğiniz yazılımvearaçlarıbizeinfo@ wmdergi.com adresinden iletebilirsiniz. Webmaster araçları ile çalışmalarınızı geliştirin
  • 72. 75 Web2PDF Web sitelerinin URL’lerini yazarak PDF formatına dönüştürmenizi sağlayan Web2PDF hem ücretsiz hem de kayıt zorunluluğu olmadan çalışıyor. Servisin seçenekler bölümü oldukça zengin. Bu bölümden oluşturulacakPDF belgesiyle ilgili tercihlerinizi belirleyebiliyorsunuz. Sayfa boyutu, HTML seçenekleri, referans ekleme alanları, PDF dokümana başlık, açıklama, etiket ekleme. PDF olarak kaydetmek istediğiniz sitenin URL’sini yazdıktan sonra oluşan belgeyi bilgisayara kaydedebilir veya internette paylaşabilirsiniz.Ayrıca Google Docs kullanıcıysanız belgeyi Docs’a göndererek açabilirsiniz. İşletim Sistemi: Web Tabanlı Qapacity - Web Sitesi Hazırlama Uygulaması Eğer şirketiniz için şık ancak kullanımı ve yapımı basit bir web sitesi hazırlamak istiyorsanız Qapacity’e bir şans verebilirsiniz. Web tasarım konusunda hiç bilgisi olmayan şirket ya da iş sahipleri için oldukça kolay web siteleri hazırlarken göze de hitap eden tasarımlar oluşturabiliyorsunuz. Web sitenize görseller, yazılar eklerken aynı zamanda sosyal medya ile de etkileşim için ilgili araçlar sunulmuş durumda. Ayrıca çeşitli tema seçeneklerini kullanarak çokkısasüreiçerisindetasarımınızıdeğiştirebilir ve size en uygun olanı deneyerek bulabilirsiniz. İşletim Sistemi: Web Tabanlı
  • 73. 76 Micropoll - Anket Hazırlama Uygulaması Eğer web sitenize anket eklemek, sonuçları görmek ve istatistikleri incelemek istiyorsanız bir yığın kod arasında dolaşmanıza veya internette nasıl yapacağınızı araştırmaya gerek yok.Micropoll web uygulaması kısa bir üyelik formundan sonra kolayca web siteniz için anketler hazırlamanızı ve bu anketleri yönetmenizi sağlıyor.Hazırladığınız anketlere ait kısaHTMLkodlarınıwebsayfanızaentegreederek oldukça rahat bir şekilde anket yerleşiminizi yapabilirsiniz.Ayrıca hangi tarihler arasında ne kadar oy aldığınızı,trendlerin nasıl ilerlediğini ve eğer ABD’deyseniz hangi eyaletlerden ne kadar oy geldiğini görebiliyorsunuz. Anketleri sık sık kullanmak ve hepsine aynı panelden ulaşmak istiyorsanız kesinlikle faydalanabileceğiniz bir web uygulaması. İşletim Sistemi: Web Tabanlı About.me Artık kişisel web sitenizi hazırlarken onlarca sayfa ve farklı bilgilerden oluşan sistemler kullanmak zorunda değilsiniz. Uzun zamandır tek bir sayfadan oluşan web siteleri kişisel web sitelerinde ideal olarak gösteriliyorlar. About.me de bu işi kolayca yapmanızı sağlayan tamamen ücretsizbir web uygulaması. Hakkınızda kısa bir açıklama,arkaplan resmi ve sosyal medya bağlantılarınızı eklediğinizde hem görsel olarak başarılı hem de içerik olarak yeterlibirkişiselwebsayfasıyaratabiliyorsunuz. Ayrıca ziyaretçi istatistiklerinizin tutulması da About.me’nin sunduğu tamamen ücretsiz servisin içerisine dahil olarak geliyor. İşletim Sistemi: Web Tabanlı
  • 74. 78 Instapaper - Web Sayfalarını Kaydedin İnternetinyorucutemposundasürüklenirken yeterince zaman ayıramadığınız onlarca şey görürsünüz. Bunlar arasından okumak istediklerinizi uygun bir zamanda okumak için kaydetmek isterseniz imdadınıza Instapaper yetişir. Bilinen yer imi özelliğini tek bir amaç için özelleştiren servis, kendi alanında oldukça popüler. Uygulama sakladığınız internet sayfalarını kolay okunabilir bir formatta kaydederek internet bağlantısı olmayan her ortama taşınmasını sağlıyor. Servisin kendi“Read Later”imini tarayıcınıza sürükleyip bırakın ve profil açmakiçin kaydolun. Bundan sonra okumaya vakit ayıramadığınız her bir yazı için bu butonu tıklamanız yeterli. İşletim Sistemi: Web Tabanlı Flavors.me - Web Sitesi Hazırlama Aracı Kişisel tanıtımınız için web sitesi yapmak istediğinizde blog uygulamalarını kullanmak ya da web sitesi hazırlamaya çalışmak hem zahmetli hem de pahalı oluyor. Çünkü pek çok blog uygulamasını tam olarak istediğiniz özelliklere entegre etmek ekstra özellikler gerektiriyor. Flavors.me bu aşamada hem bloglarınızı hem de sosyal medya hesaplarınızı tek bir sayfaya bağlayarak birkaç adımda kişisel web sitenizi oluşturmanıza yardımcı oluyor.Flavors.me kullanarak bir yandan sosyal medya hesaplarınızda yaptığınız yayınları kolayca kişisel sayfanızdan da yayınlayabilir, aynı zamanda blog girdilerinizin düzenli olarak yine kişisel sayfanızda yer almasını sağlayabilirsiniz. İşletim Sistemi: Web Tabanlı
  • 75. 79 Onbile - Mobil Web Sitesi Hazırlama Servisi Yükselen mobil cihaz kullanımıyla sitelerin mobil versiyonlarının önemi de hiç olmadığı kadar arttı. Bu alanda kaynaklar kısıtlı olsa da sitelerin mobil cihazlardan ziyaret oranları sürekli yükseliyor. İnternet sitenizin mobil versiyonunu hazırlamak için yardım alabileceğiniz Onbile akıllı telefon ve tabletlerde en iyi görüntü kalitesini sunan siteler tasarlamanızı sağlıyor. Onbile servisi bulut temelli çalışıyor. SEO uyumlu ve optimize edilmiş bir servis sunan Onbile, ihtiyaçlarınıza uygun site şablonları sunuyor. Sunulan web sitesi temaları arasında ücretli ve ücretsiz seçenekler mevcut. Önemli olan ihtiyacınızı karşılayacakbir tema bulmanız. İşletim Sistemi: Web Tabanlı StatusHistory Facebook durum güncellemeleriniz profilinizin yaşına bağlı olarak gitgide artıyor ve zamanlakarmançormanhalegeliyor.Bunedenle eskidenyazdıklarınızıokumakvehatırlamakdaha da zor hale geliyor.Status History bu işi sizin için yapabilen kullanması kolay bir web uygulaması. Facebook hesabınızla giriş yaptıktan sonra uygulamayaizinvermenizinardından2009yılına kadar olan durum güncellemelerinizi tarıyor ve bunlar hakkında size istatistikler sunuyor. Filtreleme ve arama seçeneklerinin yanında en çok durumlarınızı beğenenler, yorum yapanlar gibi çeşitli istatistikleri kolayca görebileceğiniz StatusHistory web uygulamasını kullandıktan sonra güvenliğinize önem veriyorsanız izin verilen uygulamalardan kaldırabilirsiniz. İşletim Sistemi: Web Tabanlı
  • 76. 92 İNTERNETTEN PARA KAZANIN
  • 77. 81 Affiliate Engineer sadece e-ticaret firmalarının satış ortaklığı tekliflerini size sunar. Farklı e-ticaretlere denemeler yaparak en karlı olan siteleri ve yüksek kazançlı ortaklıkları bulun. Affiliate Engineer ile tek ürün e-ticaret yapan çok geniş bir ağa ulaşırsınız. Yüksek izleme teknolojisi ile e-ticaret firmalarına sipariş veya telefon başına dönüşüm ile ortak olun. Daha fazla dönüşüm yani para kazanmanız için e-ticaret ortaklarınıza kuvvetli dönüşüm araçları sunuyorlar.E-ticaret üyelerine, dönüşüm artırmak için CRM, Deatylı Yönetim Raporu, SMS İndirim Kodu, Facebook Like İndirim Kodu, Özel Teklifler, Zaman Bazlı Kampanyalar gibi ileri teknoloji destek veriliyor. Siz de en iyi teknolojiye Affiliate Engineer ile sahip olun Affiliate Engineer e-ticaret firmalarına komple yönetim sunan Order Engineer’in satış ortaklık ağıdır. E-ticaret firmalarının tüm sipariş ve çağrı yönetimini sizden gelen klikler doğrultusunda izler. Kazandırdığınız başarılı bir siparişyadabaşarılıbirtelefon çağrısı e-ticaret firmasından kazançelde etmenizanlamına gelmektedir. Nasıl Kazanacaksınız? Telefon Affiliate - E-ticaret firmalarının sizin reklamlarınızdan kazandığı telefon çağrıları başına kazanın. Satış Affiliate - E-ticaret firmalarının sizin reklamlarınızdan kazandığı sipariş başına kazanın. Affiliate Engineer ile daha fazla kazanın
  • 78. 82
  • 79. 83 Ünlü anket şirketi The Panel Station 9 ülkeden sonra Türkiye’yi de araştırma ağına dahil etti. Arjantin, İngiltere, Brezilya, Rusya, Çin, Endonzya, Hindistan, Meksika gibi ülkelerde araştırma faaliyetleri yürüten The Panel Station anket şirketi artık Türkiye pazarına da girdi. Bu araştırma şirketi diğerlerinden farklı olarak, hizmet verdiği her ülkede, o ülkenin ünlü alışveriş siteleriyleanlaşmasağlayarak, anketlerini dolduran kullanıcılarına para ödemek yerine, bu sitelerden alışveriş çekleri dağıtıyor. Üye olduktan sonra 250 puanı hemen kullanıcı hesabına aktaran Panel Station, 1000 puanı tamamlayan kullanıcılarına anında paralarını tahsil etme imkanı sunuyor. Hesabinizda en az 2000 puan biriktiginde, puanlarinizi www.markafoni. comweb sitesinden Çevrimiçi Alisveris Çeki almak için kullanabilirsiniz. Kazandiginiz puanlari istediginiz zamana kadar Istasyonum hesabinizda biriktirebilirsiniz. Tek seferde en fazla 10000 puani çeke dönüstürebilirsinizve kalanini bir sonraki islemde çeke dönüstürebilirsiniz. Tüm Alisveris Çekleri talep etmenizden itibaren 15 gün içindee-postaadresinizesatin almak istediginiz seyler için alisveris sitesinde dogrudan kullanilabilecek bir Çek PIN/ Kodu ile birlikte gönderilir. Üye olmak için tıklayınız. Panel Station İle HediyelerVe Nakit Kazanın
  • 80. 84 Kendi web sitenizde yapacağınız genel www. h e d i y e p a k e t i m . c o m tanıtımları ya da ürün tanıtımlarına tıklayıp http:// www.hediyepaketim.com’a geçiş yapan ve sitemiz üzerinden sipariş veren kişilerin alışveriş tutarlarının %20 ‘si size ödenir. Buna ek olarak sitenizden giriş yapan ve http:// www.hediyepaketim.com’a üye olan kişilerin bir yıl boyunca yapacakları tüm alışverişlerde de size tutarın %20 ‘si ödenir. Komisyon tutarı toplam alışveriş tutarının kesinleşen kısmı (müşterinin ödeyeceği rakam) üzerinden hesaplanır. Bir sipariş kesinleşip müşteri tarafından ödemesi yapılmadan hesabınıza komisyon aktarımı yapılmaz. Facebook ve twitter gibi sosyal mecralarda,tanıtım yazısı ve link paylaşarak 7000’den fazla hediyelik eşyanın satışından gelir elde edebilirsiniz. Nasıl kazanacağım? Web sayfanıza içinde referans numaranızın bulunduğu banner kodunu koyarak sizin sayfadan gelen kullanıcıların alışverişlerinden komisyon kazanabilirsiniz. Sistem nasıl işliyor? Kontrol paneli üzerinden ; gönderdiğiniz ziyaretçi sayısı , sizin kazandırdığınız üyeler ve yapılan alışveriş tutarları gibi bilgileri online takip edebilirsiniz. Sizin referansınız olan kullanıcıları ve yaptıkları alışveriş miktarları ile komisyonunuzu Raporlar/ İstatistikler ekranınızdan takip edebilirsiniz. Ay sonunda, belirlenen limitin aşılması halinde, komisyon tutarıhesabınızayatırılır.Eğer o ay limitinizi aşamazsanız, o ayın tutarı bir sonraki aya devreder. Her ayın 15’inde alt ödeme limitini aşmanız durumunda ( Şu anki alt limit : 50 YTL ) belirttiğiniz banka ve hesap numarasına eft veya havale gerçekleştirilir. Hediyepaketim.com Satış Ortaklığı
  • 81. 85 NetAffiliation kimdir ? NetAffiliation, 2003 yılında, Fransa’da kurulmuş, bugün 150 çalışanı olan bir satış ortaklığı (affiliation) ağıdır. Şirket,Avrupa ve Latin Amerika’da genişleyerek bir çok kıtaya ulaşmıştır.Şu anda 15 ülkede 1,700 program ve 100,000 yayıncısı ile faaliyet göstermektedir. Satış ortaklığı (affiliation) nedir ? Satış ortaklığı, bir reklamverenin ürün veya hizmetini,internet reklamları aracılığıyla yayınlamasına dayanan bir pazarlama tekniğidir.Bu model, performansa dayalı işler : reklamverenin mesajlarını yayınlamayı kabul eden satış ortağı, reklamverene bir satış, doldurulmuş bir form veya newsletter üyeliği vb… gibi yönlendirmeleri gerçekleştirdiğinde bir komisyon alır. NetAffiliation’a Nasıl Başvuru Yaparım ? Bu linke tıklayarak... Website ve kullanıcı bilgilerinizi bu 3 aşamalı formdadoldurun.İlkaşamada ülke olarak ‘Türkiye’, ikinci aşamada dil seçeneği olarak ‘Türkçe’yi seçin. Email adres teyidi için size otomatik bir email gönderilecektir. Bu emaildeki konfirmasyon linkine tıklamanız yeterlidir. NetAffiliation kazandığım parayı nasıl öder? Hesabınızda 50€ biriktiğinde ödeme talep edebilirsiniz. Euro ile işleyen kampanyalar için ödemeyi PayPal veya banka havalesi ile, TL cinsinden işleyen kampanyalar için ise banka havalesi ile alabilirsiniz. Detaylı bilgi, platform kullanımı, ödemeler, vs ile ilgili her türlü soru hakkında Türkçe destek almak için bize her zaman destek@netaffiliation.com adresinden ulaşabilirsiniz. NetAffİlİatİon İle Sİz de Kazanmak İster Mİsİnİz? Şimdi NetAffiliation Yayıncısı olun, Reklam Alanlarınızdan Gelir Sağlayın...
  • 82. 74 İyi.net iyi.net, satın aldığınız veya satın almayı planladığınız ürünler hakkında karşılaştırma yapmanıza olanak sağlayarak, size güvenil- ir zengin bir deneyim fırsatı da sunuyor. Themeforest HTML, WordPress ve birçok alışveriş scriptini destekleyen binlerce özel tasarıma yer veren sitede bir birinden güzel, orjinal ve kaliteli çalışmalar bulabilir, bu çalışmalara uygun fiyatlarla sa- hip olabilirsiniz.Böylece siteler- inizde farklılıklar yaratabilirsiniz. DomainHole Süresi dolan ve silinme süre- cinde olan alan adlarını sorgula- yarak inceleyebileceğiniz, ücretsiz hizmet veren bir web sitesi. Siz de web sitenizi, sk@wmdergi.com ‘a iletin her ay bu bölümde okuyucularımızla paylaşalım... www.iyi.net SıkKullanılan www.themeforest.net www.domainhole.com
  • 83. nlar 75 İlgi çekici, işlevsel, yaratıcı web siteleri her ay, Site Tanıtımları sayfalarımızda... Feedly Google reader’e alternatif bir rss takip uygulaması olan Feedly ile sayfa tasarımını kişiselleştirerek rss kaynaklarını takip edebilirsiniz. Dafont Şu an bünyesinde 20.000’den fa- zla font barındıran dafont, ücret- siz ve oldukça geniş içeriği ile her türlü tasarım ve web sitesi işinizde sık kullanılanlarınızda bulunması gereken bir web sitesi. Göz atmanızda fayda var. Sanalkurs Onlarca kategoride, yaklaşık 6.000 video ders sunan siteyi takip etmekte yarar var. SlideShare SlideShare, ayda 60 milyon zi- yaretçinin 130 milyon sayfa görüntüleme yaptığı, online sunum, pdf, video ve webinar paylaşımının yapıldığı bir plat- form.Ayrıca bir çok altyapı için embed desteği de sağlıyor. www.sanalkurs.net www.dafont.com www.slideshare.net www.feedly.com
  • 84. 05 WM Dergi‘yi Takip Et ÜCRETSİZ HEDİYELER KAZAN! Ödül teslimleri için belirli bir süre olmamakla birlikte en kısa sürede gönderim yapılacaktır. 1.YAŞ ÇEKİLİŞİ ÖDÜL KAZANAN OKUYUCULARIMIZ; Erkan Çağlar Kaan Gülten’den“Sorularla SEO”Kitabı Ercan Közen Kaan Gülten’den“Sorularla SEO”Kitabı Bilgi Net Kaan Gülten’den“Sorularla SEO”Kitabı Sercan Doğan Kaan Gülten’den“Sorularla SEO”Kitabı Tuan Küçükali Kaan Gülten’den“Sorularla SEO”Kitabı Hasan Ekşi Mp3 Player Ödül kazanan okuyucularımızın info@wmdergi.com adresine mail atarak, ödülünü teslim almak için“açık adres”ve“telefon”bilgilerini iletmeleri gerekmektedir. www.sorularlaseo.com