• Share
  • Email
  • Embed
  • Like
  • Save
  • Private Content
Presentasidahsyat xamthone2
 

Presentasidahsyat xamthone2

on

  • 568 views

kasiat buah manggis

kasiat buah manggis

Statistics

Views

Total Views
568
Views on SlideShare
568
Embed Views
0

Actions

Likes
0
Downloads
20
Comments
0

0 Embeds 0

No embeds

Accessibility

Upload Details

Uploaded via as Microsoft PowerPoint

Usage Rights

© All Rights Reserved

Report content

Flagged as inappropriate Flag as inappropriate
Flag as inappropriate

Select your reason for flagging this presentation as inappropriate.

Cancel
  • Full Name Full Name Comment goes here.
    Are you sure you want to
    Your message goes here
    Processing…
Post Comment
Edit your comment

    Presentasidahsyat xamthone2 Presentasidahsyat xamthone2 Presentation Transcript

    • KLIKDISINI
    • KLIKDISINI
    • ???
      KLIKDISINI
    • KLIKDISINI
    • KLIKDISINI
    • KLIKDISINI
    • KLIKDISINI
    • KLIKDISINI
    • KLIKDISINI
    • KLIKDISINI
    • KLIKDISINI
    • KLIKDISINI
    • KLIKDISINI
    • KLIKDISINI
    • KLIKDISINI
    • KLIKDISINI
    • KLIKDISINI
    • KLIKDISINI
    • KLIKDISINI
    • KLIKDISINI
      Sumber data : Internet
    • Dr. Sam Walters,
      Neuropath, Master dalambidangBiologiSainsdan
      SpesialNutrisiManusia
      ManggisLebih Dari SekedarUnik
      Antioksidanadalahkunciutamadalammencegahpenyakit. Penelitianbadan-badanpengobatanduniamenunjukkanbahwabuahmanggissecaralangsungmenyembuhkanberbagaipenyakit. Kulitbuahnyamengandung XANTHONE mampumenyembuhkankankerpayudara, paru-paru, perutdanpenyakit leukemia, sertapenyakit-penyakitlainnya.
      Mayoritaspasien yang dirawatmenderitakanker stadium 4 lanjutan, punyasisahidup 6-8 minggu, danmanggismampumengembalikanhidupparapasienitu. Tubuhmemerlukanbahanbiologisbukanbahankimiawi. Salahsatu yang dapatandalakukanuntuksistemkekebalantubuhandaadalahdenganmeminum jus manggis. Intinyapencegahan.
      KLIKDISINI
    • Dr. Finsand,
      Pakarpenguruttulangbelakang & persendianserta
      pengarangbukuMangosteen Triple Play
      ManggisUntukOtot & Tulang
      Sudahsejakzamandahulukalamanggissudahdinikmatiolehmasyarakat Asia Tenggara. Rasanya yang lezatbukansajasebagaipemanisdimuluttetapijugamenyembuhkanpenyakitdisentri, peradangan, nyeridll. Ototdantulangmemilikipermasalahan yang samayakniperadangan. Tahun 1981 sayamengalamicederapunggung, 20 tahunsayaterapi chiropractic, namun rasa nyeritetapada. Suatuketikasayaminum jus manggisdanituadalahawalperubahankesehatan, hidupdanpekerjaansaya.
      Sayajugamerekomendasikankepadaparapasiensayadanhasilnyamenakjubkan. Sekarang saya sudah bebas dari obat-obat kimiawi dan rasa nyeri itu sendiri. Buah manggis pencegah penyakit yang sempurna.
      KLIKDISINI
    • Dr. BernaElya,
      Peneliti Departemen Farmasi Universitas Indonesia
      Misteri Manggis Untuk Kesehatan & Kecantikkan
      Manggis bisa mencegah kerusakkan sel yang disebabkan oleh radikal bebas. Bukan hanya itu, ekstrak kulit manggis bersifat antiproliferasi juga mampu mencegah dan menghambat pertumbuhan sel kanker, bersifat apoptosis, penghancur sel kanker. Manggis sangat ampuh mencegah penyakit paru-paru, tuberculosis (TBC)m ashma, leukemia, antinflamasi dan antidiare.
      Manfaat lainnya dari manggis sebagai antijamur dan antibakteri penyebab jerawat. Manggis sampai hari ini menjadi kajian yang menarik bagi para pakar peneliti dari berbagai belahan dunia. Namun sayang di ranah leluhurnya Indonesia manggis belum banyak diketahui manfaatnya oleh mayoritas masyarakat Indonesia. Manggis mengatasi jantung koroner, HIV. Ini hanyalah sebagian kecil dari khasiat manggis secara keseluruhan. Konsumsimanggissetiaphariuntukkesehatan yang sempurna.
      KLIKDISINI
    • Dr. Ir. Raffi Paramawati, M.Si,
      Pakar Peneliti Manggis
      Balai Besar Mekanisasi Pertanian
      Manggis Penangkal Radikal Bebas Yang Luar Biasa
      Yang paling utama dari manggis adalah kulit buahnya
      karena dalam kulitnya terdapat kandungan antioksidan super yang mampu dengan sangat baik menangkal radikal bebas penyebab berbagai macam penyakit. Penyakit-penyakit seperti jantung, kanker, stroke, diabetes, dll bisa dicegah dengan mengonsumsi buah manggis.
      Manggis juga bisa membuat awet muda jika dikonsumsi secara rutin karena antioksidan super didalamnya berfungsi maksimal menjaga serta memperbaiki sel-sel tubuh kita yang rusak. Mulailah hidup sehat dengan manggis.
      KLIKDISINI
    • Anti-inflammatory:
      Gamma-Mangostinxanthone acts as anti-inflammatory.
      1: Mol Pharmacol. 2004 Jun 24 [Epub ahead of print] Related Articles, Links
      Gamma-Mangostin Inhibits IkappaBKinase Activity and Decreases Lipopolysaccharide-Induced
      Cyclooxygenase-2 Gene Expression in C6 Rat Glioma Cells.
      Nakatani K, Yamakuni T, Kondo N, Arakawa T, Oosawa K, Shimura S, Inoue H, Ohizumi Y.
      Graduate school of Pharmaceutical Science, Tohoku University.
      Anti-Cancer:
      Mangosteenxanthone, garcinone E has potent cytotoxic effect on liver
      cancer.
      1: Planta Med. 2002 Nov;68(11):975-9.
      Garcinone E, a xanthone derivative, has potent cytotoxic effect against hepatocellular carcinoma cell lines.
      Ho CK, Huang YL, Chen CC.
      Department of Medical Research & Education, Veterans General Hospital, Taipei, ROC.
      KLIKDISINI
    • Heart Disease:
      Mangosteen shown to protect LDL from oxidative damage.
      1: Free Radic Res. 1995 Aug;23(2):175-84. Related Articles, Links
      Mangostin inhibits the oxidative modification of human low density lipoprotein.
      Williams P, Ongsakul M, Proudfoot J, Croft K, Beilin L.
      University of Western Australia, Department of Medicine, Royal Perth Hospital, Australia.
      Anti-histamine: Study shows mangosteen has potent inhibitory activities of
      both histamine release and prostaglandin E2 synthesis.
      1: BiolPharm Bull. 2002 Sep;25(9):1137-41. Related Articles, Links
      Inhibitions of histamine release and prostaglandin E2 synthesis by mangosteen, a Thai medicinal
      plant.
      Nakatani K, Atsumi M, Arakawa T, Oosawa K, Shimura S, Nakahata N, Ohizumi Y.
      Department of Pharmaceutical Molecular Biology, Graduate School of Pharmaceutical Sciences,
      Tohoku University, Sendai, Japan.
      KLIKDISINI
    • HIV treatment:
      Mangosteen is leading compound for chemotherapy of HIV infection.
      1: Planta Med. 1998 Mar;64(2):97-109. Related Articles, Links
      Plant-derived leading compounds for chemotherapy of human immunodeficiency virus (HIV)
      infection.
      Vlietinck AJ, De Bruyne T, Apers S, Pieters LA.
      Department of Pharmaceutical Sciences, University of Antwerp (UA), Belgium.
      vlietink@uta.ua.ac.be
      Anti-viral:
      Mangosteen demonstrates potent inhibitory activity against HIV-1.
      1: Planta Med. 1996 Aug;62(4):381-2. Related Articles, Links
      Active constituents against HIV-1 protease from Garcinia mangostana.
      Chen SX, Wan M, Loh BN.
      KLIKDISINI
    • Anti-fungal:
      Mangosteen’s xanthones inhibit fungi activity.
      1: J Nat Prod. 1997 May;60(5):519-24. Related Articles, Links
      Evaluation of the antifungal activity of natural xanthones from Garcinia mangostana and their
      synthetic derivatives.
      Gopalakrishnan G, Banumathi B, Suresh G.
      Centre for Agrochemical Research, SPIC Science Foundations, Madras, India.
      Anti-bacterial:
      Study shows mangosteen kills intracellular Salmonella bacteria.
      1: J Med Assoc Thai. 1997 Sep;80 Suppl 1:S149-54. Related Articles, Links
      Immunopharmacological activity of polysaccharide from the pericarb of mangosteen garcinia:
      phagocytic intracellular killing activities.
      Chanarat P, Chanarat N, Fujihara M, Nagumo T.
      Department of Clinical Microscopy, Faculty of Associated Medical Sciences, Chiang Mai
      University, Thailand.
      KLIKDISINI
    • Central Nervous System:
      Mangosteen contains a promising compound for treatment of central
      nervous system disorders
      1: Br J Pharmacol. 1998 Mar;123(5):855-62. Related Articles, Links
      Effect of gamma-mangostin through the inhibition of 5-hydroxy-tryptamine2A receptors in 5-
      fluoro-alpha-methyltryptamine-induced head-twitch responses of mice.
      Chairungsrilerd N, Furukawa K, Tadano T, Kisara K, Ohizumi Y., Department of Molecular
      Biology, Faculty of Pharmaceutical Sciences, Tohoku University, Sendai, Japan.
      KLIKDISINI
    • KLIKDISINI
    • KEPANJANGAN XAMthone :
      KLIKDISINI
    • KLIKDISINI
    • KESEHATAN TUBUH YANG MENYELURUH:
      • Memperkuat sistem kekebalan.
      • Menyembuhkan peradangan.
      • Memperbaiki komunikasi antarsel.
      • Menggagalkan kerusakan DNA.
      • Alat bantu sistem getah bening.
      • Memelihara optimal fungsi kelenjar gondok.
      • Mengurangi resistansi insulin.
      • Membantu penurunan berat badan. 
      • Menyembuhkan kerusakan urat saraf.
      • Menyeimbangkan sistem kelenjar endokrin.
      • Alat bantu dari sinergi tubuh.
      • Meringankan wasir.
      • Membantu menurunkan kadar gula dalam darah (hypoglycemia).
      • Meringankan penyakit kulit kemerah-merahan/bersisik (psoriasis).
      • Membantu menyembuhkan luka.
      • Meringankan sakit akibat carpal tunnel syndrome (penyakit yang terjadi pada pergelangan tangan serta jari yang disebabkan oleh tekanan yang sering terjadi pada bagian tersebut. Dan biasanya sering diakibatkan karena terlalu sering memakai keyboard dan mouse).
      • Menghilangkan penyakit kulit kering bersisik kronis (neurodermatitis). Kandungan anti peradangan dari manggis dapat mengurangi sisik dan gatal pada penyakit kulit.
      KLIKDISINI
    • KESEHATAN JANTUNG :
      Membantu mencegah penyakit jantung.
      Memperkuat pembuluh darah.
      Menurunkan kolesterol LDL.
      Menurunkan tekanan darah tinggi.
      Membantu mencegah arteriosclorosis
      KESEHATAN PENCERNAAN :
      Membantu mengatasi penyakit GERD (penyakit kronik yang ditandai
      dengan mengalirnya asam lambung ke dalam kerongkongan).
      Membantu menyembuhkan borok/bisul.
      Meringankan syndrome kelainan usus besar (IBS).
      Membantu menghentikan diare.
      Dapat meringankan peradangan usus besar ataupun kecil yang dikenal
      dengan Crohn’s disease.
      Bisa mencegah salah satu penyakit radang usus besar (diverticulitis).
      MEMBUAT LEBIH AWET MUDA:
      29.Menambah energi, meningkatkan kegembiraan dan menaikkan stamina.
      30.Memperlambat proses penuaan.
      31.Membantu menghindari penyakit kemerosotan pada otak (dementia &
      alzheimer’s).
      32. Membantu mencegah batu ginjal.
      33.Membantu mencegah penyakit system syaraf (Parkinson).
      34. Meredakan sakit akibat radang sendi.
      35.Memperbaiki kerusakan dari penggunaan obat penghilang rasa sakit (NSAID).
      36. Alat bantu untuk mata.
      KLIKDISINI
    • KESEHATAN KELUARGA:
      37.Menurunkan demam.
      38. Mengatasi keracunan makanan.
      39. Menyejukan luka tenggorokan.
      40. Membantu  menyembuhkan sariawan.
      41. Mengatasi sesak nafas.
      42. Membantu mengurangi migran (sakit kepala sebelah).
      43. Mengurangi sakit gigi.
      44. Alat bantuan tidur yang alami.
      45. Meningkatkan kemampuan untuk mengatasi stress.
      46. Meningkatkan mood dan menurunkan depresi.
      47. Alat bantu kesehatan otot dan sendi.
      48. Menghilangkan jerawat dan cacat pada kulit.
      49. Menghilangkan  bekas gigitan, terbakar dan keracunan
      50. Meringankan keseleo, ketegangan otot dan sendi.
      51. Meringankan sakit perut.
      52. Meringankan radang tenggorokan (bronchitis), pembengkakan paru-paru
      (emphysema), dan radang paru-paru (pneumonia).
      53. Bekerja sebagai obat penghilang rasa sesak/mampat pada hidung
      (decongestant)
      KESEHATAN PRIA:
      54. Membantu mencegah kemandulan.
      55. Membantu mencegah pembesaran prostat
      KLIKDISINI
    • KESEHATAN WANITA:
      56. Meringankan kesulitan buang air kecil.
      57. Sebagai obat pencuci perut yang lembut.
      58.Meminimalkan gejala sakit sebelum menstruasi (PMS).
      59. Meringankan gejala menopause.
      60. Menurunkan pembengkakan saat menstruasi.
      61. Meringankan sakit pada otot, ligamen, atau tendon (fibromyalgia).
      62. Meringankan sakit akibat penyakit menurunnya kepadatan tulang /
      pengapuran tulang (osteoporosis)
      KESEHATAN ANAK-ANAK:
      63. Membantu meringankan penyakit asma.
      64. Bisa mencegah gangguan hyperaktif dan kurang perhatian (ADHD) dan alergi
      makanan.
      65. Membentuk gigi & tulang yang lebih kuat
      MENGATASI PENYAKIT:
      66. Mencegah penyakit gusi.
      67. Memberantas penyakit TBC.
      68. Menurunkan efek samping ketidaktoleranan laktosa.
      69. Membantu mencegah disentri.
      70. Membantu mencegah penyakit system syaraf pusat (multiple sclerosis).
      71. Bisa mencegah kanker.
      72. Meringankan penyakit inflamasi kronik (peradangan menahun) yang menyerang
      struktur tulang belakang dan terutama sendi panggul (Ankylosing Spondylitis.
      73. Membantu mencegah infeksi paru-paru dan pernafasan kronis (cystic fibrosis).
      74. Mencegah gejala yang berhubungan dengan penyakit lupus.
      75. Mengurangi penyakit lemas otot yang parah (Myasthenia Gravis)
      KLIKDISINI
    • KLIKDISINI
    • Nurman ChaniagoPenyakit jantung
      KLIKDISINI
    • Nama : Heru
      Umur : 40 tahun
      Asal : Jember, Jawa Timur
      Profesi : Tenaga Medis
      Penyakit : Gangguan Jantung & Kelelahan
      Dada saya sering sesak dan rasanya sangat kelelahan. Setelah minum XAMthoneplus® baru 1 botol rasa sesaknya hilang, begitu juga dengan rasa lelahnya. Saya minum cukup 30 ml setiap pagi dan malam setelah makan. Kini saya sudah bisa bermain tenis kembali. XAMthoneplus® memang ok.
      Nama : Hj. Hayati Mustofa
      Umur : 62 tahun
      Asal : Tangerang, Banten
      Profesi : Ibu Rumah Tangga
      Penyakit : Gangguan jantung
      Dada saya rasanya sesak sekali, dikirain sakit paru-paru ternyata dokter bilang jantung saya bermasalah. Saya minum XAMthoneplus® 2 botol, 10 hari kemudian ternyata ada perubahan. Tadinya, kalau saat sholat saya hanya bisa duduk sekarang bisa berdiri, saya juga sudah bisa pergi belanja di pasar swalayan. Hanya 30 ml setiap pagi dan malam setelah makan saya minum.
      KLIKDISINI
    • Nama : Irnawati
      Umur : 25 tahun
      Asal : Lampung
      Profesi : Pegawai Swasta
      Penyakit : Gangguan Jantung
      Saya menderita sakit jantung dan selalu merasa nyeri seperti ditekan dada bagian kiri saya. Saya mencoba mengonsumsi suplemen yang bisa membantu mengurangi risiko jantung saya dan itu saya temukan minuman kesehatan XAMthoneplus®. Hanya 6 botolXAMthoneplus® selama 1 bulan kesehatan jantung saya kembali normal. Dengan 30 ml setiap pagi dan malam setelah makan saya minum.
      KLIKDISINI
    • Nama : Papi Ari
      Umur : 68 tahun
      Asal : Manado
      Profesi : Pensiunan AL
      Penyakit : Stroke
      Selama + 2 tahun terbaring di tempat tidur, buang air besar & kecil di tempat tidur. Setelah konsumsi+ 8 botol dan tidak sampai 2 bulan sudah bisa berdiri.
      Nama : Ustad Ruslan Nasution
      Umur : 45 tahun
      Asal : Medan, Sumut
      Profesi : Pengajar
      Penyakit : Stroke
      Alhamdulillah dengan 6 botolXAMthoneplus® selama 1 bulan penyakit stroke saya membaik dan sekarang saya bisa mengajar kembali. Saya minum cukup 30 ml setiap pagi dan malam setelah makan.Terima kasih XAMthoneplus®.
      KLIKDISINI
    • Nama : I Gede Tangkas
      Umur : 63 tahun
      Asal : Singaraja, Bali
      Profesi : Pensiunan PNS
      Penyakit : Stroke
      Sayamenderita stroke yang membuathidupjaditersiksa. DoktersebuahrumahsakitdiSingarajamemvonissayabahwatelahterjadipenggumpalandarahdiotakbagianbelakang. Keadaaninimembuatsayafrustrasidanbingung. Tapipertolonganselaludatangtidakterlambatbuatsaya. XAMthoneplus®menyelamatkansayadari stroke yang menyengsarakan. Hanya6 botolselama 1 bulansayasembuh. TerimakasihTuhan, terimakasihXAMthoneplus®. Sayaminum 30 ml setiappagisiangdanmalamsetelahmakan.
      Nama : I Gusti Ketut Rai S
      Umur : 55 tahun
      Profesi : Wiraswasta
      Asal : Lampung
      Penyakit : Stroke
      Sayamenderita stroke selama 10 tahun. Harta yang sayakumpulkanhabisterjualuntukmembiayaipengobatanpenyakit yang sayaderita. Namunsayaharusingatakansebuahfilosofisederhanabahwasegala-galanyabolehlenyap, tapiharapanituharustetapada. Berkatharapanitulahsayadapatmengonsumsi6 botolXAMthoneplus®selama 1 bulan. Stroke sayasembuh, sayabisajalandanmelakukanaktivitaskecilsepertimenyapudansebagainya. Sayaminum 30 ml setiappagidanmalamsebelummakan.
      KLIKDISINI
    • SulistyowatiPenderitaKanker
      KLIKDISINI
    • Sri MulyaniPenderita Kanker
      KLIKDISINI
    • Nama : Deden
      Asal : Karawang, Jabar
      Umur : 15 tahun
      Profesi : Pelajar
      Penyakit : Tumor Paru-paru stadium 3
      Saya sudah menjalani pemeriksaan dari rumah sakit di Karawang, Jawa Barat dan sampai rumah sakit ternama milik pemerintah di Jakarta. Sampai di rumah sakit ternama di Jakarta, dokter sarankan tumor saya harus diangkat, tapi paru-paru saya harus dilumpuhkan dulu, tulang rusuk harus dibuka, baru bisa dioperasi, kalau sudah dioperasi tulang rusuknya dibiarkan terbuka sampai seminggu. Kalau tidak dioperasi, kemungkinan dilaser dan potensi untuk lumpuh sangat besar bagi saya.
      Saya membayangkan begitu seram penyakit dan penderitaan saya. Saya diberikan XAMthone plus 3 sendok makan 3 kali sehari, pagi 3 sendok makan, siang 3 sendok makan dan malam 3 sendok makan. Awal-awal minum badan saya rasanya panas sekali, tapi saya teruskan minum XAMthone plusnya. Habis 1 botol badan saya rasanya enak, sekarang saya sudah habis 3 botol. Saya minum sesudah makan.
      KLIKDISINI
    • Nama : Bu Ari
      Asal : Mataram, NTB
      Umur : 42 tahun
      Profesi : Ibu Rumah Tangga
      Penyakit : Kanker Leher Rahim
      Saya minum 3 botolXAMthone plus kurang lebih 3 minggu, kankernya sembuh. Saya juga sudah periksakan diri ke dokter dan hasilnya dinyatakan kanker saya sembuh. Saya minum 3 sendok makan pagi dan malam sebelum makan. Sampai saat ini saya tetap minum XAMthone plus.
      Nama : Suryadi
      Asal : Surabaya, Jawa Timur
      Umur : 59 tahun
      Profesi : Wirausaha
      Penyakit : Kanker Prostat
      Minum XAMthone plus6 botol selama 2 minggu penyakitnya sembuh. Saya minum tidak mengikuti aturan minum yang tertera di label XAMthone plus. Minum, ya minum saja langsung dari botolnya, habisnya enak sih. Selain penyakitnya sembuh, badan saya juga terasa segar bugar terus.
      KLIKDISINI
    • SunartoPenderitaDiabetes
      KLIKDISINI
    • HASIL LABORATORIUM SEBELUM KONSUMSI :
      Ibu SadiahPenderita Diabetes
      KLIKDISINI
    • HASIL LABORATORIUM SETELAH KONSUMSI :
      KLIKDISINI
    • Nama : Karwati
      Asal : Karawang, Jabar
      Umur : 42 tahun
      Profesi : Pedagang
      Penyakit : Diabetes
      Saya menderita diabetes selama 4 tahun, saya juga sudah berobat ke mana-mana, tapi hasilnya tidak banyak perubahan. Dokter bilang, diabetes saya tidak bisa sembuh seumur hidup. Setelah minum XAMthone plus1 botol diabetes saya membaik. Saya minum 3 sendok makan pagi dan 3 sendok makan sore. Sekarang saya terus minum XAMthone plus untuk hasil yang lebih baik.
      KLIKDISINI
    • Nama : Drs. Rizwanto Rais
      Umur : 40 tahun
      Profesi : Anggota DPRD
      Asal : Lampung
      Penyakit : Diabetes Melitus
      Saya menderita penyakit Diabetes akut dalam jangka waktu cukup lama. Saya sudah menggunakan suntikan insulin untuk menjaga agar diabetes tidak meningkat. Namun setelah saya minum XAMthoneplus®3 botol selama 10 hari saja, keadaan diabetes saya membaik bahkan saya merasa fit. XAMthoneplus® memang luar biasa khasiatnya. Saya minum, 30 ml setiap pagi dan malam sebelum makan.
      KLIKDISINI
    • Nama : Jamaludin
      Asal : Serang, Banten
      Umur : 57 tahun
      Profesi : Wiraswasta
      Penyakit : Osteoporosis & Ginjalbermasalah
      SayatelahmembuktikanbahwaXAMthoneplus®sangatbagusuntukkesehatantulangdanginjal. SekarangtinggalAnda yang berikutnya. SayaminumXAMthoneplus®6 botolselama 1 bulan, osteoporosis dangangguanginjalteratasi. Hanyadenganminum 30 ml per hariXAMthoneplus®memberikannilaikesehatan yang lebih.
      Nama : Jamilah
      Umur : 60 tahun
      Asal : Lampung Tengah
      Profesi : IbuRumahTangga
      Penyakit : GagalGinjal
      Sayamenderitagagalginjalsekian lama yang manapenyakitinimembuatsayadibuangolehkeluarga. Mereka (bacakeluarga) sudahtidakmaumenampungsayakarenaterlalubanyakbiaya yang sudahdikeluarkanuntukmengobatisaya. Hartasemuanyaludeskarenapenyakitjahanamini, tetapisayatidaktakutkarenaadaXAMthoneplus®.SetelahsayaminumXAMthoneplus®hanya3 botolselama 2 minggu, keadaansayasemakinmembaikdankinisayabolehberadaditengah-tengahkeluargasayakembalikarenaXAMthone plus yang membawasayakembalipulang. Sayaminum 30 ml setiappagidanmalamsesudahmakan.
      KLIKDISINI
    • Nama : Ridwan Saleh
      Umur : 39 tahun
      Asal : Jakarta
      Profesi : Pegawai Swasta
      Penyakit : Keropos Tulang & Ginjal
      Saya menderita pengeroposan tulang dan gangguan ginjal, ironi memang kalau dilihat dari usia saya, tapi itulah penyakit, tidak mengenal usia. Untuk kesembuhan penyakit saya ini saya minum XAMthoneplus® sebanyak 6 botol selama 1 bulan, dan hasilnya luar biasa baik, penyakit saya membaik dan sekarang saya minum XAMthoneplus® setiap hari. Dengan 30 ml saya minum setiap pagi dan malam sebelum makan.
      KLIKDISINI
    • Nama : Kori W. Putro
      Asal : Sleman, Yogyakarta
      Umur : 10 tahun
      Profesi : Siswa SD
      Penyakit : Asma akut/ Sesak napas &
      Demam tinggi
      Saya terserang sesak napas akut dan demam tinggi selama 3 hari. Saya minum XAMthone plus 30 ml sore hari, malamnya sekitar jam 08.00 WIB napas saya jadi lega dan demamnya turun. Ibuku menyuruhku minum 1 botol sampai habis. Saya biasa minum sesudah makan. Sekarang saya sehat sekali berkat XAMthone plus.
      KLIKDISINI
    • Nama : Putri Nurbaida
      Asal : Yogyakarta
      Umur : 10 tahun
      Profesi : Pelajar SD
      Penyakit : Asma akut & Tidak nafsu makan
      Ketika sore hari saya batuk-batuk, napas tersengal-sengal dan badan panas tinggi. Saat itu saya diberi 30 ml XAMthone plus, dan saya minum, tapi saya makan dulu sedikit. Reaksinya cepat sekali, saya minum jam 04.30 WIB sekitar jam 07.00 WIB malam napas saya normal dan rasanya sangat plong, panasnya turun dan batuk-batuknya berhenti. Selain itu nafsu makan saya jadi bertambah. Saya disarankan oleh Ibu saya untuk terus minum XAMthone plus sampai habis 2 botol selama 10 hari lebih untuk hasil yang lebih baik.
      Nama : Raihan
      Umur : 5 tahun
      Asal : Bondowoso, Jatim
      Penyakit : Panas Tinggi & Diare
      Raihan menderita demam tinggi dan diare. Setelah minum XAMthoneplus® 2 sendok makan, panasnya turun dan diarenya berhenti. Alhamdulillah Raihan sudah bisa bermain kembali dalam waktu 10 menit kemudian.
      KLIKDISINI
    • Nama : Rafika Harun
      Asal : Jakarta
      Umur : 9 tahun
      Profesi : Pelajar SD
      Penyakit : Gizi buruk & Paru-paru
      Saya dikasih Ibu 30 ml XAMthone plus untuk diminum pada malam hari sebelum tidur. Saya minum jam 09.00 WIB jam 12.00 WIB saya rasa lapar sekali, padahal tadinya saya sudah makan sebelum minum XAMthone plus. Akhirnya saya makan lagi sambil ditemani Ibu, esok paginya saya bangun rasanya segar sekali. Nafsu makan bertambah membuat badan saya jadi gemuk dan paru-paru saya sehat. Saya minum 3 botolXAMthone plus selama 2 minggu setiap malam sesudah makan.
      KLIKDISINI
    • Nama : Aurelia
      Asal : Tanah Toraja, Sulsel
      Umur : 51 tahun
      Profesi : Pegawai Swasta
      Penyakit : Ambeien & Gangguan Usus
      Saya minum XAMthoneplus® 6 botol selama 1 bulan, wasir atau ambeien dan gangguan usus yang saya derita membaik. Saya minum 30 ml atau setara dengan 6 sendok makan setiap pagi dan malam sesudah makan. Dan sekarang saya minum rutin demi mencapai hasil yang maksimal alias sembuh total. Saya ingatkan bagi penderita penyakit apa pun kalau kita sedang konsumsi XAMthoneplus® kita harus perhatikan pola makannya. Ingat XAMthoneplus® pasti ingat sehat.
      KLIKDISINI
    • Nama : Mahmudin
      Umur : 79 tahun
      Profesi : Wiraswasta
      Asal : Kota Baru, Lampung
      Penyakit : Stroke, Asam Urat, Asma & Maag
      Saya menderita penyakit komplikasi yaitu stroke, asam urat, asma dan maag akut selama bertahun-tahun. Saya sudah keluar masuk rumah sakit ternama di Jakarta tapi hasilnya tidak memuaskan. Semua hasil jerih payah yang saya kumpulkan selama bekerja habis untuk membiayai pengobatan saya. Namun setelah saya minum 6 botolXAMthoneplus® selama 1 bulan penyakit saya sembuh. Saya minum 30 ml atau setara dengan 6 sendok makan setiap pagi dan malam sesudah makan. Luar biasa khasiat XAMthoneplus®.
      Nama : Sukirno
      Umur : 54 tahun
      Asal : Lampung Timur
      Profesi : Lurah
      Penyakit : Asam Urat, Sakit di Kaki, Muka Kuning & Hilang Ingatan
      Saya menderitasakitasamurat, hilangingatan, kaki sakit, mukakuning yang menemanisayadalamkeseharian. SetelahminumXAMthoneplus®3 botolseminggukemudiansayakembalimenjalankanaktivitassayasepertirapatdansebagainya. Saya minum 30 ml atau setara dengan 6 sendok makan setiap pagi dan malam sesudah makan. TerimakasihXAMthoneplus®.
      KLIKDISINI
    • Nama : T. Silalahi
      Umur : 55 tahun
      Asal : Jakarta
      Profesi : Ibu Rumah Tangga
      Penyakit : Asma akut, Kolesterol & Asam Urat
      Sering menderita sesak napas, kolesterol dan asam urat. Setelah minum XAMthoneplus® kurang lebih 7 botol selama 1 bulan lebih. Tiap minum 30 ml atau setara dengan 6 sendok makan setiap pagi dan malam sesudah makan, hasilnya, sekarang saya sudah bisa jalan-jalan ke Medan dan tetap fit. XAMthoneplus® OK sekali.
      Nama : Tauhid Hasim
      Asal : Purwakarta, Jabar
      Umur : 51 tahun
      Profesi : Wirausaha
      Penyakit : Darah rendah, migrain & susah tidur
      Saya minum XAMthone plus3 botol selama 2 minggu dan hasilnya menakjubkan. Semua keluhan penyakit saya sembuh. Selama masa penyembuhan saya minum 30 ml setiap pagi dan malam sesudah makan. 30 ml = 6 sendok makan.
      KLIKDISINI
    • Nama : Hartono
      Umur : 60 tahun
      Asal : Yogyakarta
      Profesi : Pensiunan
      Penyakit : Hipertensi menahun
      Saya minum XAMthoneplus® 3 botolselama 2 minggu tekanan darah saya turun dan badan saya terasa enak. Saya minum setiap hari 30 mili liter setiap pagi dan malam sebelum tidur selama masa penyembuhannya. Setelah sudah sembuh untuk menjaganya saya minum 30 ml atau setara dengan 6 sendok makan setiap malam sebelum tidur sesudah makan. Salam sehat XAMthoneplus®.
      Nama : Boaz Lodo
      Asal : Ende, Flores
      Umur : 50 tahun
      Profesi : Wiraswasta
      Penyakit : Demam Berdarah & Malaria
      Saya minum XAMthoneplus® baru 6 botol selama 1 bulan demam berdarah dan malaria sembuh. Saya minum XAMthoneplus®, 30 ml atau setara dengan 6 sendok makan setiap pagi dan malam sesudah makan. Pesan saya minumlah XAMthoneplus® sebelum Anda terlambat dan menyesal. Salam.
      KLIKDISINI
    • Nama : Bu Ali
      Umur : 60 tahun
      Asal : Sidoarjo, JawaTimur
      Profesi : Ibu Rumah Tangga
      Penyakit : Glukoma
      Saya menderita glukoma selama 2,5 tahun. Setelah minum 2 botolXAMthoneplus® selama 2 minggu, glukoma saya membaik, saya bisa melihat kembali. Saya minum 30 ml atau setara dengan 6 sendok makan per hari. XAMthoneplus® memang luar biasa. Aturan minum, hanya 30 ml setiap pagi dan malam setelah makan.
      Nama : Teteh Mus
      Umur : 40 tahun
      Asal : Lampung Timur
      Profesi : IbuRumahTangga
      Penyakit : SakitKepalaSebelah
      Sayamenderitasakitkepalamengerikanatauistilahmedisnyamigrainakutselamabertahun-tahun. Kalausakitsangatmenyiksasayakarena air matasayasampaikeluarkarenamenahan rasa sakit yang begituluarbiasa. NamunsetelahminumXAMthoneplus®6 botolselama 1 bulan, urusansakitkepalamengerikantidaksayaalamilagi, kinisayasehatsediakala, tapiXAMthoneplus®selalusayaminum. Aturanminum, cukup 30 ml atausetara 6 sendokmakansetiappagidanmalamsetelahmakan.
      KLIKDISINI
    • Nama : Lula Minarti
      Asal : Bandung, Jabar
      Umur : 38 tahun
      Profesi : Wanita Karir
      Penyakit : Keputihan & Vitalitas
      Saya minum XAMthone plus3 botol selama 2 minggu dan hasilnya mengejutkan, karena keputihan saya hilang dan badan terasa sangat segar kala beraktivitas. Saya minum 30 ml setiap pagi dan malam sesudah makan sebelum tidur. 30 ml = 6 sendok makan.
      Nama : Dr. Rudiyantio, SH, SE, MBA
      Asal : Surabaya, Jatim
      Umur : 55 tahun
      Profesi : Advocat
      Penyakit : Gagal Ginjal, Diabetes Kronis & Stroke
      Saya minum XAMthoneplus®13 botol dan hasilnya sungguh baik untuk kesehatan saya. Tadinya saya harus cuci darah seminggu 2 kali menjadi seminggu sekali, dan menjadi sebulan sekali. Untuk mencapai kesehatan yang utuh saya minum XAMthoneplus® setiap hari. Hanya dengan 30 ml per hari atau setara 6 sendok makan kini saya bebas melakukan segala aktivitas saya. Salam sehat XAMthoneplus®.
      KLIKDISINI
    • Nama : Liam Chan
      Umur : 37 tahun
      Asal : Yogyakarta
      Profesi : Wiraswasta
      Penyakit : Lupus (Antibody berlebihan yang menyerang organ-organ tubuh)
      Saya menderita penyakit lupus selama kurang lebih 5 bulan. Bulan pertama sampai keempat saya ke dokter dan masih dilayani dengan baik tapi masuk bulan kelima dokter “angkat tangan”. Setelah minum XAMthoneplus® 3 botol ada perubahan ke arah yang lebih baik. Kini saya terus minum XAMthoneplus® untuk memulihkan penyakit saya. Aturan minum, cukup 30 ml atau setara 6 sendok makan setiap pagi dan malam setelah makan.
      Nama : Rudy Mulyono
      Umur : 41 tahun
      Asal : Pekalongan, Jawa Tengah
      Profesi : Wiraswasta
      Penyakit : Ejakulasi Dini
      Saya buktikan sendiri setelah minum XAMthoneplus®3 botol selama 2 minggu kinerja seksual saya meningkat drastis. Saya bahagia istri pun bahagia. Semua karena XAMthoneplus®. Buktikan sendiri kalau Anda bermasalah dengan seks Anda. Aturan minum, cukup 30 ml atau setara 6 sendok makan setiap pagi dan malam setelah makan.
      KLIKDISINI
    • Nama : Etty A Koesnadi
      Asal : Jakarta
      Umur : 65 tahun
      Profesi : Wiraswasta
      Penyakit : Nyeri Pinggang, Daging tumbuh di telapak kaki, & Vitalitas
      Alhamdulillah dengan 4 botolXAMthoneplus® selama 2 minggu semuanya menjadi baik-baik saja. Saya sebelumnya menderita sakit pinggang yang menghambat aktivitas saya. Saat sholatpun saya tidak bisa berdiri hanya bisa duduk saja. Selain itu ada daging yang tumbuh di telapak kaki saya sebelah kiri yang mana sangat menyiksa saya kala berjalan atau memakai sepatu maupun sandal. Aturan minum, cukup 30 ml atau setara 6 sendok makan setiap pagi dan malam setelah makan.
      Nama : drg. Lisa
      Asal : Bandar Lampung, Lampung
      Umur : 32 tahun
      Profesi : Dokter gigi
      Penyakit : Vitalitas
      Saya beli XAMthone plus saat ada pameran XAMthone plus di Bandar Lampung 1 botol, dan saya minum, hasilnya badan saya rasanya enak, segar dan tetap fit, saya beli lagi 1 botol untuk menambah kebugaran fisik saya. Setiap pagi dan malam sesudah makan saya minum 30 ml. 30 ml = 6 sendok makan.
      KLIKDISINI
    • DAN MASIH ADA RIBUAN ORANG YANG TELAH MERASAKAN MANFAAT DARI KEHEBATAN PRODUK AJAIB INI, KETERANGAN LENGKAP BISA ANDA KUNJUNGI
      KLIKDISINI
    • Meningkatkanhormondan libido pria / wanita
      Meningkatkankejantananpria
      Meningkatkansemangatkerja
      Stamina prima
      Meningkatkanenergidalamberolah raga
      Memulihkantenagasehabisbekerjakeras
      Awetmuda
      Inginpunyaanak
      Ingintidurnyenyak / insomnia
      Stresdandepresi
      Orang yang tubuhnyalemahdansakit-sakitan
      Meningkatkankonsentrasidankecerdasan
      Mencegahobesitas
      Mempercepatpenyembuhanpenyakit
      Mempercepatprosespemulihansesudahoperasi
      Sakitkepala / Migrain
      Menghitamkandanmelebatkanrambut
      Sangatbaikuntukmenjagakesehatanperokok
      Memperkuattulangdangigi
      Memperlancarperedarandarah
      Melancarkanbuang air besar
      Mengurangi rasa sakitsaathaid
      Mencegahpenyakitkankerdanjantung.
      Menopause
      Mengatasi 10 L (letih, lesu, lemah, lelah, loyo, lemes, letoy, lunglai, lemot, ling-lung)
      KLIKDISINI
    • XAMthone telah disiarkan secara langsung
      di beberapa stasiun televisi
      KLIKDISINI
    • KLIKDISINI
    • PENEMUAN
      BARU
      PROGRAM GARANSI
      UANG KEMBALI
      KLIKDISINI
    • Rp.230.000,-
      KLIKDISINI
    • KLIKDISINI
    • KLIKDISINI
    • KLIKDISINI
      • Pemimpin yang tulus, ikhlas, rendah hati, berhati mulia, berbudi luhur dan berjiwa besar
      • Pemimpin Visioner.
      • Pemimpin yang memiliki entrepreneurship & leadership sejati
      • Pemimpin pemersatu suku, bangsa & agama.
      • Religius
      • Pemimpin yang Berjiwa sosial & membantu sesama
      • Berjiwa Nasionalisme sejati
      • Meraih gelar master bisnis S2 ( MBA)
      • Pemegang lisensi Akupuntur Indonesia dan Mendapat sertifikat akupuntur Beijing China.
      • Penemu produk ajaib XAMthone plus
      • Penemu sistem bisnis jaringan berbasisSyariah pertama dan satu-satunya di Indonesia dan dunia
      • Pendiri perusahaan bisnis jaringan berbasis Syariah
      • Berpengalaman dan sukses di beberapa bisnis jaringan lain sebelum mendirikan perusahaan bisnis jaringan berbasis Syariah.
      • Pemecah rekor bisnis jaringan tercepat di Indonesia & Dunia.
      • Seorang guru besar yang bijaksana.
      • Pemilik Holding Company dengan puluhan perusahaan
      • Pernah sebagai pembayar pajak perorangan terbesar di indonesia.
      • Pengasah berlian terbaik (telah terbukti mensukseskan banyak orang) dan diakui sebagai SANG MAESTRO.
    • MASUK 5 LITER
      KELUAR 7 LITER
    • MASUK 7 LITER
      KELUAR 7 LITER
    • Bisnis
      Jaringan
      BISNIS
      KONVENSIONAL
      MODAL
      KECIL
      BESAR
      ADA
      TEMPAT
      TIDAK HARUS
      PEGAWAI
      ADA
      TIDAK HARUS
      HASIL
      BESAR
      BESAR
      RESIKO
      BESAR
      KECIL
      WAKTU
      LAMA
      CEPAT
    • Modal kecilresikokecil.
      Bisamendapatproduklebihmurah.
      Bisamendapattambahanpenghasilandariselisihhargabelidenganhargajual.
      Dapatmenolongorang yang masihmenganggur
      Dapatmenolongorang yang sakit
      Bisamemberikanpenjelasanmanfaatproduklebihbanyakkepadabanyakorang.
      Bagi yang inginkayadanmemilikicita-cita, lebihcepatterwujudmelaluibisnisjaringan.
      Banyakpenghargaan yang diterima.
      KualitasPengembangandiri/kepribadianmeningkat.
      Lebihcepatuntukmemilikipasive income.
      Kesuksesandapatdiwariskan
    • CONTOH STATEMEN BONUS PADA BULAN KE-1
      Rp. 236.250,-
    • CONTOH STATEMEN BONUS PADA BULAN KE-2
      Rp. 6.587.538,-
    • CONTOH STATEMEN BONUS PADA BULAN KE-3
      Rp. 89.166.166,-
    • Peraih BKMM 31 Bulan
    • Peraih BKMM 14 Bulan
    • Peraih BKMM 10 Bulan
    • Peraih BKMM 24 Bulan
    • Prestasi Luar Biasa
      Seorang Mahasiswa
      Peraih BKMM 13 Bulan
    • Peraih BKMM 13 Bulan
      • Karyawan
      • Ibu rumah tangga
      • Pelajar dan Mahasiswa
      • Pedagang
      • Pengusaha
      • Pejabat
      • Dokter
      • Guru
      • Pengamen
      Petugas Asuransi
      Salesman
      Artis
      Atlet
      Wartawan
      Pensiunan
      Orang yang suka tantangan
      Butuh pekerjaan
      Perantau
    • Mari Saksikan
      Sambutan dari Peneliti Manggis
      & Tokoh Masyarakat
    • PROMO SAAT INI :
      PROMO SAAT INI :
      1.
      2.
      3.
      4.
      5.
      6.
      PanduanbisnisRp. 275.000,-
      Bonus 3 BotolXAMthoneRp. 690.000,-
      5 undanganPresentasiDahsyatRp. 75.000,-
      Pelatihan OPBJ DahsyatRp. 250.000,-
      Tiket GMK Rp. 25.000,-
      Web Replicate XAMthoneSENILAIRp. 10.000.000,-
      TOTAL KEUNTUNGAN Rp.11.550.000,-
      ( Promo sewaktu-waktubisaberubah! )
      1.
      2.
      3.
      4.
      5.
      6.
      7.
      8.
      Rp.11.550.000,-
      Rp.11.315.000,-
      Rp.11.575.000,-
      PROMO SAAT INI :
      PROMO SAAT INI :
      1.
      2.
      3.
      4.
      5.
      6.
      Panduan bisnis Rp. 275.000,-
      Bonus 7 Botol XAMthone Rp. 1.610.000,-
      5 undangan Presentasi Dahsyat Rp. 75.000,-
      Pelatihan OPBJ Dahsyat Rp. 250.000,-
      Tiket GMK Rp. 25.000,-
      Web Replicate XAMthone SENILAI Rp. 10.000.000,-
      TOTAL KEUNTUNGAN Rp.11.550.000,-
      ( Promo sewaktu-waktu bisa berubah! )
      1.
      2.
      3.
      4.
      5.
      6.
      7.
      8.
      Rp.11.550.000,-
      Rp.12.235.000,-
      Rp.11.575.000,-
      PILIHAN KE-1
      SPESIAL DISKON:
      Rp. 1.500.000,-
      Rp.750.000,-
      (Bonus 3 Btl, Rp.690.000,-)
      PILIHAN KE-2
      SPESIAL DISKON:
      Rp. 2.500.000,-
      Rp.1.425.000,-
      (Bonus 7 Btl, Rp.1.610.000,-)
    • SPESIAL DISKON:
      Rp. 1.500.000,-
      10 MENIT
      Rp.750.000,-
      (Bonus 3 Btl, Rp.690.000,-)
      PILIHAN KE-1
      PILIHAN KE-2
      SPESIAL DISKON:
      Rp. 2.500.000,-
      Rp.1.425.000,-
      (Bonus 7 Btl, Rp.1.610.000,-)
    • SPESIAL DISKON:
      Rp. 1.500.000,-
      5 MENIT
      Rp.750.000,-
      (Bonus 3 Btl, Rp.690.000,-)
      PILIHAN KE-1
      PILIHAN KE-2
      SPESIAL DISKON:
      Rp. 2.500.000,-
      Rp.1.425.000,-
      (Bonus 7 Btl, Rp.1.610.000,-)
    • SPESIAL DISKON:
      Rp. 1.500.000,-
      3 MENIT
      Rp.750.000,-
      (Bonus 3 Btl, Rp.690.000,-)
      PILIHAN KE-1
      PILIHAN KE-2
      SPESIAL DISKON:
      Rp. 2.500.000,-
      Rp.1.425.000,-
      (Bonus 7 Btl, Rp.1.610.000,-)
    • SPESIAL DISKON:
      Rp. 1.500.000,-
      2 MENIT
      Rp.750.000,-
      (Bonus 3 Btl, Rp.690.000,-)
      PILIHAN KE-1
      PILIHAN KE-2
      SPESIAL DISKON:
      Rp. 2.500.000,-
      Rp.1.425.000,-
      (Bonus 7 Btl, Rp.1.610.000,-)
    • SPESIAL DISKON:
      Rp. 1.500.000,-
      1 MENIT
      Rp.750.000,-
      (Bonus 3 Btl, Rp.690.000,-)
      PILIHAN KE-1
      PILIHAN KE-2
      SPESIAL DISKON:
      Rp. 2.500.000,-
      Rp.1.425.000,-
      (Bonus 7 Btl, Rp.1.610.000,-)