Unsur hara mikro dan fungsinya
Upcoming SlideShare
Loading in...5
×

Like this? Share it with your network

Share
  • Full Name Full Name Comment goes here.
    Are you sure you want to
    Your message goes here
    Be the first to comment
    Be the first to like this
No Downloads

Views

Total Views
7,927
On Slideshare
7,927
From Embeds
0
Number of Embeds
0

Actions

Shares
Downloads
85
Comments
0
Likes
0

Embeds 0

No embeds

Report content

Flagged as inappropriate Flag as inappropriate
Flag as inappropriate

Select your reason for flagging this presentation as inappropriate.

Cancel
    No notes for slide

Transcript

  • 1. UNSUR HARA MIKRO DAN FUNGSINYA
    KELOMPOK II
    SALMIN MOINTI
    M. FAUZI SIDIK
  • 2. I PengertianUnsur Hara
    Unsur Hara adalahsenyawaorganikdananorganis yang adadidalamtanahataudengankata lain nutrisi yang terkandungdalamtanah
    Unsur Hara sangatdibutuhkanuntuktumbuhkembangtanaman. Berdasarkantingkatkebutuhannyamakadapatdigolongkanmenjadi 2 bagianyaituUnsur Hara MakrodanUnsur Hara Mikro
  • 3. II DefinisiUnsur Hara Mikro
    Unsurharamikro, yaitu: sumbermakanan yang diperlukandalamjumlah yang relatifsedikit, namunsangatpentingdanmutlakdiperlukanolehtanamansebagaimakanan. Padahaliniunsurharamikrobanyakdiperolehdaribahanorganik yang adapadatanah
  • 4. Sumberunsurharamikro : batu-batu mineral, air irigasidansisa-sisabahanorganis. Padaumumnyahanyasedikitdiperlukan, antarabeberapa gram sampai kilogram bagikeperluan 1 herktartanahdanpadaumumnyamerupakanzatkatalisatoratauzat yang dapatmempercepatpersenyawaankimiawidalamtubuhtanaman.
  • 5. III FungsiUnsur Hara Mikro
    7 unsurharamikro yang dibutuhkantanamandalamjumlahkecilantara lain Besi(Fe), Mangaan(Mn), Tembaga (Cu), Seng (Zn), Boron (B), Molibden (Mo),, Klor(Cl). BerikutMasing-masingunsurharaesensialtidakdapatsalingmenggantikan.
  • 6. G. klorofil
    Ferrit/besi (Fe) : dibutuhkantanamandalampembentukanklorofil, berperanpadaproses-prosesfisiologistanamansepertiprosespernapasan, selainitubesiberfungsisebagaiaktifatordalamprosesbiokimiadidalamtanaman, danpembentukbeberapaenzim.
  • 7. Tembaga/Cupprum (Cu) : beperansebagaiaktfiatorenzimdalamprosespenyimpanancadanganmakanan, katalisatordalamprosespernapasandanperombakankarbohidrat, dansebagaisalahsatuelemendalamprosespembentukan vitamin A dansecaratidaklangsungberperandalampembentukanklorofil.
  • 8. Seng/zink (Zn) :Kegunaansengsangatpentingantara lain sebagaikatalisatordalampembentukanprotein,mengaturpembentukanasam yang berfungsisebagaizatpengaturtumbuhtanaman. Ketersediaansengdalamtanah 1-20Ppm, sedangkankebutuhan normal tanaman 25-125ppm.
  • 9. Boron (B) : Unsuriniberfungsimenangkutkarbohidratkedalamtubuhtanamandanmenghisapunsurkalsium. Selainitu boron berfungsidalamperkembanganbagian-bagiantanamanuntuktumbuhaktif. Gejaldefisiensiharamikroiniantara lain : pertumbuhanterhambatpadajaringanmeristematik (pucukakar), matipucuk (die back), mobilitasrendah, buah yang sedangberkembangsngatrentan, mudahterserangpenyakit.
  • 10. Molibden (Mo) : berperansebagaipengikat nitrogen  yang bebasdiudarauntukpembentukan protein danmenjadikomponenpembentukenzimpadabakteribintilakartanaman.
  • 11. Klor (Cl) : berfungsisebagaipemindahharatanaman, meningkatkanosmosesel, mencegahkehilangan air yang tidakseimbang,. Jugaberperandalamfotosistem II dariprosesfotosintesis, khususnyadalamevolusioksigen.
  • 12.
    • Mangan (Mn) : Untukpenyusunanklorofil, perkecambahan, danpemasakanbuah.
    Kebutuhanunsurharamikromutlakbagisetiaptanamandantidakbisadigantikanolehunsur yang lain tentunyadengankadar yang berbedasesuaijenistanamannyasebabjikakekuranganunsurharaakanmenghambatpertumbuhantanamanitusendiri.
  • 13. Sekiandanterimakasih…