Unsur hara mikro dan fungsinya


Published on

tentang pendidikan

Published in: Education, Health & Medicine
  • Be the first to comment

  • Be the first to like this

No Downloads
Total views
On SlideShare
From Embeds
Number of Embeds
Embeds 0
No embeds

No notes for slide

Unsur hara mikro dan fungsinya

  2. 2. I PengertianUnsur Hara<br />Unsur Hara adalahsenyawaorganikdananorganis yang adadidalamtanahataudengankata lain nutrisi yang terkandungdalamtanah<br />Unsur Hara sangatdibutuhkanuntuktumbuhkembangtanaman. Berdasarkantingkatkebutuhannyamakadapatdigolongkanmenjadi 2 bagianyaituUnsur Hara MakrodanUnsur Hara Mikro<br />
  3. 3. II DefinisiUnsur Hara Mikro<br />Unsurharamikro, yaitu: sumbermakanan yang diperlukandalamjumlah yang relatifsedikit, namunsangatpentingdanmutlakdiperlukanolehtanamansebagaimakanan. Padahaliniunsurharamikrobanyakdiperolehdaribahanorganik yang adapadatanah<br />
  4. 4. Sumberunsurharamikro : batu-batu mineral, air irigasidansisa-sisabahanorganis. Padaumumnyahanyasedikitdiperlukan, antarabeberapa gram sampai kilogram bagikeperluan 1 herktartanahdanpadaumumnyamerupakanzatkatalisatoratauzat yang dapatmempercepatpersenyawaankimiawidalamtubuhtanaman.<br />
  5. 5. III FungsiUnsur Hara Mikro<br />7 unsurharamikro yang dibutuhkantanamandalamjumlahkecilantara lain Besi(Fe), Mangaan(Mn), Tembaga (Cu), Seng (Zn), Boron (B), Molibden (Mo),, Klor(Cl). BerikutMasing-masingunsurharaesensialtidakdapatsalingmenggantikan.<br />
  6. 6. G. klorofil<br />Ferrit/besi (Fe) : dibutuhkantanamandalampembentukanklorofil, berperanpadaproses-prosesfisiologistanamansepertiprosespernapasan, selainitubesiberfungsisebagaiaktifatordalamprosesbiokimiadidalamtanaman, danpembentukbeberapaenzim.<br />
  7. 7. Tembaga/Cupprum (Cu) : beperansebagaiaktfiatorenzimdalamprosespenyimpanancadanganmakanan, katalisatordalamprosespernapasandanperombakankarbohidrat, dansebagaisalahsatuelemendalamprosespembentukan vitamin A dansecaratidaklangsungberperandalampembentukanklorofil.<br />
  8. 8. Seng/zink (Zn) :Kegunaansengsangatpentingantara lain sebagaikatalisatordalampembentukanprotein,mengaturpembentukanasam yang berfungsisebagaizatpengaturtumbuhtanaman. Ketersediaansengdalamtanah 1-20Ppm, sedangkankebutuhan normal tanaman 25-125ppm.<br />
  9. 9. Boron (B) : Unsuriniberfungsimenangkutkarbohidratkedalamtubuhtanamandanmenghisapunsurkalsium. Selainitu boron berfungsidalamperkembanganbagian-bagiantanamanuntuktumbuhaktif. Gejaldefisiensiharamikroiniantara lain : pertumbuhanterhambatpadajaringanmeristematik (pucukakar), matipucuk (die back), mobilitasrendah, buah yang sedangberkembangsngatrentan, mudahterserangpenyakit. <br />
  10. 10. Molibden (Mo) : berperansebagaipengikat nitrogen  yang bebasdiudarauntukpembentukan protein danmenjadikomponenpembentukenzimpadabakteribintilakartanaman.<br />
  11. 11. Klor (Cl) : berfungsisebagaipemindahharatanaman, meningkatkanosmosesel, mencegahkehilangan air yang tidakseimbang,. Jugaberperandalamfotosistem II dariprosesfotosintesis, khususnyadalamevolusioksigen. <br />
  12. 12. <ul><li>Mangan (Mn) : Untukpenyusunanklorofil, perkecambahan, danpemasakanbuah. </li></ul>Kebutuhanunsurharamikromutlakbagisetiaptanamandantidakbisadigantikanolehunsur yang lain tentunyadengankadar yang berbedasesuaijenistanamannyasebabjikakekuranganunsurharaakanmenghambatpertumbuhantanamanitusendiri.<br />
  13. 13. Sekiandanterimakasih…<br />
