Your SlideShare is downloading. ×
Epaper surya 11 juli 2013 ok
Upcoming SlideShare
Loading in...5

Thanks for flagging this SlideShare!

Oops! An error has occurred.


Introducing the official SlideShare app

Stunning, full-screen experience for iPhone and Android

Text the download link to your phone

Standard text messaging rates apply

Epaper surya 11 juli 2013 ok


Published on

  • Be the first to comment

  • Be the first to like this

No Downloads
Total Views
On Slideshare
From Embeds
Number of Embeds
Embeds 0
No embeds

Report content
Flagged as inappropriate Flag as inappropriate
Flag as inappropriate

Select your reason for flagging this presentation as inappropriate.

No notes for slide


  • 1. HARGA LANGGANAN: Rp 29.000/BULAN ● BERLANGGANAN/PENGADUAN/SIRKULASI: (031) 8479 555 ALAMAT REDAKSI/IKLAN: JL. RUNGKUT INDUSTRI III NO. 68 & 70 SIER SURABAYA (031) 8419 000 PLUS MINUS UJI SIMULATOR PLUS MINUS UJI SIMULATOR Kemampuan yang Diuji Reaksi Pertimbangan perkiraan Antisipasi Sikap mengemudi Konsentrasi SISI POSITIF 1. Hasil uji makin akurat 2. Meningkatkan standar kemampuan mengemudi 3. Lebih selektif meluluskan pemegang SIM SISI NEGATIF 1. Biaya pengurusan lebih tingggi 2. Prosedur dan waktu lebih panjang 3. Peluang gagal ujian lebih tinggi 4. Kecenderungan pungli/sogokan meningkat Waktu Lebih Lama* Isi formulir Mendaftar Uji teori Uji praktek Pembayaran Bank Foto Total waktu Uji Simulator Sebelum ada simulator Setelah pakai simulator *dalam menit grafis: surya/rendra JAKARTA, SURYA - Arsenal akan tampil beda dalam kun- jungannya ke Indonesia. Mereka akan mengenakan kostum tan- dang terbaru saat beraksi me- lawan Indonesia Dream Team di Stadion Gelora Bung Karno, Jakarta, Minggu (14/7) malam. KE HALAMAN 7■ JERSEY BARU - Inilah jersey baru Arsenal yang dikenakan para pemain untuk menghadapi Dream Team di Stadion Gelora Bung Karno, Jakarta, Minggu (14/7) malam. Menggapai Puasa yang Utama I MAM Abu Hamid al Ghazalai (w. 505 Hijriah/1111 Masehi) dalam karya monomentalnya, kitab Ihya’Ulumudin mengemuka- kan tentang derajat orang yang melaksanakan ibadah puasa. Menurutnya ada tiga tingkatan orang berpuasa, yaitu puasa al `umum (standar), puasa al khusus (istimewa) dan puasa khusus al khusus (sangat istimewa). Puasa al `umum adalah puasa yang dilakukan sesuai syarat dan rukun puasa saja, yaitu mencegah diri dari makan, minum dan Dituntut Kembalikan Gelar INDAH DEWI PERTIWI I NDAH Dewi Pertiwi (22) belakangan rajin me- nyambangi kerajaan-ke- rajaan di Tanah Air. Langkah perempuan asal Bogor ini mengunjungi kerajaan- kerajaan di berbagai suku Nusantara itu terkait aksi panggungnya pada bulan Agustus 2013 mendatang. Penyanyi cantik ini akan mengangkat tema Kingdom of Indonesia di dalam kon- sep pertunjukannya. Dan hasil dari kunjungannya itu, Indah Dewi Pertiwi (IDP) biasanya dianuge- rahi gelar oleh raja-raja yang ditemuinya. “Jadi gelar itu aku Jasad Nenek Nyangkut di Lemari MALANG, SURYA - Seorang nenek tewas dan ratusan rumah terendam saat luapan air sungai menerjang empat desa di wila- yah Kecamatan Sumbermanjing Wetan dan KAMIS, 11 JULI 2013 NO. 242 TAHUN XXVI TERBIT 24HALAMAN HARGA Rp 1.000 Arsenal Pamer Kostum Baru di Jakarta HM CHOLIL NAFIS LC PHD WAKIL KETUA LEMBAGA BAHTSUL MASAIL PBNU / SEKRETARIS PENGKAJIAN MUI Simulator Bikin Mahal SIMPemohon Tambah Biaya Rp 50 Ribu■ SURABAYA, SURYA - Pertengahan tahun 2012 lalu, polisi serentak menyosialisasikan rencana penggunaan mesin simulator me- ngemudi dalam ujian mendapatkan surat izin mengemudi (SIM). Sayang sosialisasi itu berhenti di tengah jalan. Mencuatnya kasus korupsi pengadaan simulator pada Juli 2012 lalu, membuat petugas hampir di semua daerah tiarap. Tak hanya sosialiasi yang dihentikan. Perangkat simulator yang Peraturan Diteken Presiden SBY■ Dibiayai APBN Kok Masih Narik Masyarakat SAYA termasuk orang yang kaget mendengar adanya tambahan biaya dalam penerapan simulator kemudi untuk ujian pemohon SIM ini. Apalagi tambahan biaya itu tidak kecil. Tambahan Rp 50 ribu itu cukup besar. Coba bandingkan dengan biaya normal saat ini. Karut Marut Penerapan Simulator (bagian 2) Simulator Rusak dan Jadi Besi Tua SURYA/AHMAD ZAIMUL HAQ MANGKRAK - Simulator SIM di Satpas Colombo hingga kini belum pernah digunakan untuk umum. Foto diambil, Senin (9/7). A IPTU Naryadi bergegas keluar ru- angannya saat seorang anggotanya mengabarkan truk pembawa simula- tor masuk ke area Satpas pada pertengahan Oktober 2011 silam. Dari berkas serah terima barang, diketahui ada tiga unit simulator uji keterampilan berkendara yang dikirim. Ketiganya merupakan simulator untuk roda empat (R4). Barang yang dikirim masih belum dirakit. Produsen membungkus rapi bagian-bagian alat peraga ini dalam peti-peti kayu. “Bentuknya ya kita belum tahu. Masih dipeti,” cerita Naryadi, awal pekan ini. Hari itu juga isi peti dibongkar. Komponen Pertengahan 2011 Satpas Colombo Satlantas Polrestabes Surabaya mendapatkan informasi akan datangnya simulator SIM. Jumlahnya lebih banyak ketimbang pol- res lain di jajaran Polda Jatim. Satuan Penyelenggara Administrasi SIM (Satpas) pun berbenah, termasuk menyiapkan ruangan khusus. KE HALAMAN 7■ SURYA/HAYU YUDHA PRABOWO BANJIRBANDANG - Seoranganak mengamati lemari es yang terbawa banjir bandang di Desa Sitiarjo, Kecamatan Sumbermanjing Wetan, Kabupaten Malang, Rabu (10/7). DANA terbuang sia-sia yang mungkin menjadi salah satu penyebab harus dinaikkannya harga BBM...Salam. JonnyRiduanHatigoranSidabutarMadiunMagetanKotakuKotamuKotakita JADIIN game consoLe aja pak :D NovrizalDwiCahyo -@novrizal_opay kicauan KE HALAMAN 7■ KE HALAMAN 7■ KE HALAMAN 7■ KE HALAMAN 7■ NewsAnalysis SAID SUTOMO KETUA YAYASAN LEMBAGA KONSUMEN INDONESIA (YLKI) JATIM SANGAT disayangkan itu kalau dibiarkan nganggur KE HALAMAN 7■ TEAMKICKOFF.COM THE BESTOF JAVA NEWSPAPER INDONESIA PRINT MEDIA AWARD (IPMA) 2013 TRIBUN JAKARTA/JEPRIMA Foto-foto terkait dampak banjir Sitiarjo join follow @portalsurya
  • 2. | ROADTOELECTION KAMIS, 11 JULI 2013 | JAKARTA, surya - Sejumlah iklan layanan masyarakat untuk memompa partisipasi masyarakat dalam pemilihan umum terus di- lakukan Komisi Pemilihan Umum (KPU),salahsatunyamenggandeng artissebagaibintangiklannya. Ketua KPU, Husni Kamil Ma- nik mengatakan, iklan layanan masyarakat ini bervariasi seperti menyoal pemungutan suara, mengajak partisipasi pemilih. "Nanti akan melibatkan duta- duta pemilu. Bisa jadi dari ka- langan artis atau aktor atau dari kalangan yang dianggap bisa menggugah masyarakat atau pemilih untuk datang ke TPS dan berpartisipasi pada tahapan lain," terang Husni, Rabu (10/7). Husni beralasan, sejumlah ar- tis, tokoh masyarakat atau agama dalam iklan layanan masyarakat ini memberi pengaruh ke masya- rakat atau publik pemilih. Sehing- ga keterlibatan mereka mampu menyedot partisipasi publik. "Ya mudah-mudahan itu bisa membantu mengajak pemilih ke TPS (Tempat Pemungutan Suara). Selain yang paling itu kan juru kampanye, calon legislatif, partai politik, kelembagaan perannya sangat penting," harap Husni. Sementara itu, Direktur Ekse- kutif Perkumpulan Untuk Pemilu dan Demokrasi (Perludem) Titi Anggraini meminta KPU me- ninggalkan cara-cara tradisional dalam menyosialisasikan pemilu. Menurutnya sosialisasi beru- pa pengumuman dalam setiap tahapan pemilu dinilai sudah ketinggalan. Karena itu KPU harus menyosialisasikan kepada seluruh stakeholder terkait. "Konklusinya,sosialisasijangan tradisional. Jangan lagi mengang- gap hanya dengan pengumuman saja semua orang bisa ke TPS. Karena itu menjadi keharusan sosialiasi ke seluruh pemangku kepentingan (stakeholder)," ujar Titi di Gedung KPU, Jakarta. (tribunnews/ant) JAKARTA, surya - PDI Perjuangan membuka peluang untuk mengusung calon presi- den-wakil presiden dari kader sendiri. Hal itu dapat dilakukan bila suara partai pada pemilu legislatif mencapai 20 persen. "Sudah pasti kami akan usung calon sendiri. Bahkan kalau bisa 20 persen, saya yakin partai tidak akan koalisi," kata Politisi PDI Perjuangan Ganjar Pranowo di Gedung DPR, Jakarta, Rabu (10/7). Ia mengatakan dalam pilkada di sejumlah daerah, partai ber- lambang banteng moncong pu- tih itu tidak melakukan koalisi. Menurutnya, cara itu dilakukan karena mesin partai sudah ber- gerak. "Bukan sombong tapi karena mesin partainya gerak, rekrut- mennya jalan. Menghasilkan kader-kader berkualitas untuk dimajukan. Kenapa kami malah disebut sombong? Kan emang tugas partai politik itu," kata Ganjar yang merupakan Guber- nur Jateng terpilih ini. Untuk itu, Ganjar mengatakan partainya tidak menginginkan UU Pemilihan Presiden direvisi. PDIP menyetujui bila UU tersebut dien- dapkandantidakperludibahas. "Selain waktunya mepet, emangnya mau anggota-ang- gota DPR itu hadir bahas RUU Pilpres. Apalagi sekarang ini angota DPR sudah sibuk untuk urus dapilnya, pileg. Saya yakin pada lupa urus RUU Pilpres," katanya. Restu Megawati Sementara itu, elektabilitas Gu- bernur DKI Jakarta Joko Widodo sebagai calon presiden yang terus meningkat tidak membuat PDIP memutuskan kadernya tersebut sebagai calon yang diusung pada pemilu 2014. Demokrat Hadirkan Ruhut Surabaya, surya - Politisi Partai Demokrat, Ruhut Sitom- pul akan berkampanye untuk pasangan Soekarwo-Saifullah Yusuf (KarSa) dalam Pilgub Jatim 2013. "Kampanye akan dilakukan selama dua pekan," kata Ruhut ketika berada di Surabaya, Rabu (10/7). Menurut Ruhut, kampanye untuk Pakde Karwo dan Gus Ipul tersebut merupakan in- struksi langsung dari Ketua Umum Partai Demokrat Susilo Bambang Yudhoyono (SBY) untuk memenangkan pasangan ini. Menjelang gelaran Pilgub 29 Agustus nanti, Ruhut mengaku terus memantau perkembangan dan situasi politik di Jatim. Menurutnya, pasangan KarSa masih memimpin jauh dalam hal popularitas dan elektabilitas dibandingkan bakal pasangan cagub-cawagub lainnya. Karena itu, politisi yang juga artis ini yakin pasangan Pakde Karwo – Gus Ipul yang didu- kungan mayoritas partai dapat meraih kemenangan. Kejadian seperti di DKI Ja- karta, yakni tumbangnya calon incumbent yang juga didukung mayoritas partai tidak akan ter- jadi di Jatim. "Di Jatim ini, kondisinya berbeda dengan Jakarta. Di- sini relatif stabil, aman dan nyaman. Ini yang mengutung- kan bagi pasangan petahana," tandas Ruhut. Sementara itu, Dewan Pim- pinan Wilayah Partai Kebang- kitan Bangsa (PKB) Jawa Timur menyiapkan artis dangdut Ridho Rhoma dan bebe- rapa artis sebagai juru kampanye bakal pasangan Khofifah Indar Pa- rawansa-Herman Sumawiredja da- lam Pilgub Jatim. Selain itu, PKB juga menyiapkan artis sekaligus model, Arzeti Bilbina, yang merupakan calon legislator DPR RI asal daerah pemilihan Jatim I (Surabaya- Sidoarjo) dan penyanyi Nia Paramitha untuk mendampingi Kofifah keliling Jatim. "Semoga dengan adanya ar- tis-artis sebagai juru kampanye bisa membantu Khofifah-Her- man meraih hasil terbaik dan membantu perolehan suara un- tuk memenangkan Pilkada Ja- tim kali ini," tutur Ketua DPW PKB Jatim Abdul Halim Iskandar. Bambang Beri Santunan Pada kesem- patan yang ber- beda, bacagub Bambang Dwi Hartono menyan- tuni seorang ibu yang tidak bisa pulang akibat terbentur biaya usai melahirkan di Rumah Sakit Bhakti Rahayu Surabaya. "Bukan perkara berapa ang- garan yang harus dikeluarkan, tapi lebih mencegah kasus seru- pa terjadi, karena ibu ini mela- hirkan tanpa ayah. Kejadian ini tidak boleh terjadi lagi," ujarnya kepada wartawan. Bambang mengatakan, pe- ristiwa awal yang menimpa Kanti Wulandari (37), asal Ba- nyuwangi, banyak pengalam-  SURYA/HABIBUR ROHMAN SANTUNAN MELAHIRKAN - Cagub Jatim, Bambang DH berbincang dengan Kunti Wulandari warga Banyuwangi di RS Bhakti Rayayu Surabaya, Selasa (10/7). Kehadiran Bambang DH untuk memberikan santunan kepada Wulandari dengan menanggung seluruh biaya persalinan anaknya Orlando yang lahir pada 24 Juni 2013 lalu. Wulandari terpaksa tertahan di RS selama 16 hari, karena tidak mampu membayar biaya persalinan. KPU Sosialisasi Gandeng Artis PDIP Isyaratkan Tidak Koalisi Ridho Rhoma Jurkam Kofifah■ Keputusan mengenai siapa yang akan diusung oleh PDIP harus menunggu Rapat Kerja Nasional (Rakernas). Selain itu, kata Ganjar, karir Jokowi sebagai Gubernur DKI juga belum tuntas. Hal itu juga menjadi pertimbangan Ketua Umum PDIP Megawati untuk mengambil keputusan. "Kami idak pernah tahu apa yang bisa an berharga yang bisa diambil dari kasus ini. Pihaknya ber- harap tidak ada lagi bayi lahir tanpa ayah. Sementara itu, Kanti Wulan- dari yang bekerja sebagai penja- ga warung di kawasan Terminal Purabaya merasa terharu de- ngan santunan ini. "Sebenarnya mau melahirkan di bidan, tapi karena ada masa- lah di kandungan, saya dirujuk kemari. Saya mau pulang tapi belum punya biaya. Saya ucap- kan terima kasih kepada semua- nya, terutama Bambang DH dan RS Bhakti Rahayu," katanya. (uji/ant) Jika Raih 20 Persen di Pemilu■ ditetapkan Bu Mega," tuturnya. Ia mencontohkan saat penun- jukkan Jokowi untuk Pilkada DKI Jakarta, padahal saat rapat pleno sudah mengusulkan Fauzi Bowo. "Demikian juga di Jateng, semua orang bela Rustriningsih, tapi saya yang ditunjuk. Jadi pemikiran politik Mbak Mega ini misterius. Tidakadayangtahu,"tuturnya. (tribunnews/ Kalangan artis atau aktor dianggap bisa menggugah masyarakat datang ke TPS. Husni Kamil Manik Ketua KPU join follow @portalsurya
  • 3. Surya Biz Jakarta, surya - Ini kabar gembira bagi pemudik yang membawa sepeda motor pada Lebaran tahun ini. Pasalnya, Komisi V DPR menyetujui usulan pemerintah yang memberi subsidi senilai Rp 25 miliar. Subsidi ini diberikan bagi pemudik yang membawa motornya untuk mudik melalui kereta api, laut, dan angkutan darat. Kepala Pusat Komunikasi Publik Ke- menterian Perhubungan Bambang S Ervan menjelaskan, dari subsidi Rp 25 miliar itu, Perhubungan Darat mendapat porsi Rp 8,907 miliar, Perhubungan Laut Rp 7,45 miliar, dan Perkeretaapian Rp 8,64 miliar. Menurut Bambang, Kementerian Perhubungan menyatakan telah menyiapkan angkutan darat, kereta api, dan kapal untuk mengangkut total 216.705motorpemudikLebaranmendatang. "Untuk transportasi darat, sepeda motor yang bisa diangkut ada 20.000 unit dengan 40.000 penumpang," ujar Bambang, dikutip dari laman Sekretariat Kabinet di Jakarta, Rabu (10/7). Ia memaparkan, untuk mengangkut sepeda motor dengan kereta api misalnya, butuh anggaran Rp 250.000 per unit, serta biaya operasional pengembalian kereta Rp 200.000 per unit. Kementerian Perhubungan mengimbau masyarakat agar memanfaatkan subsidi ini, sehingga angka kecelakaan pemudik bisa di- eliminasi. ( Jakarta, surya - Bandara Internasional Kualanamu Sumatera Utara diyakini menjadi bandara pengumpul (hub) yang menghubungkan negara-negara di Asia Selatan danAsia Tenggara. Sekjen Asosiasi Perusahaan Angkutan Udara Nasional Indonesia (Indonesia National Air Carrier Association/Inaca) Tengku Burhanuddin mengata- kan, maskapai dari negara-nega- ra, seperti India dan Bangladesh, bakal masuk ke Kualanamu sebelum meneruskan perjalanan ke negara-negara ASEAN. "Ke depan, potensi bandara Kualanamu jadi hub internasio- nal sangat besar, terutama untuk maskapai yang terbang ke India," kata Tengku, Rabu (10/7). Menurutnya, masyarakat Sumatera Utara harus siap kedatangan warga-warga asing dari Asia Selatan bila telah menjadi hub, karena diperkira- kan banyak orang datang untuk berbisnis atau berwisata. "Di Indonesia sendiri ada dua maskapai yang segera terbang ke daerah di India. Ini pertanda baik bagi perkembangan Kualanamu," ujarnya. Bersamaan dibukanya Kualanamu, segera dioperasikan kereta bandara, yang akan mengangkut calon penumpang pesawat dari kota Medan dan se- kitarnya. Ini mendahului proyek kereta bandara Soekarno-Hatta yang hingga kini belum kelar. ( Cabai dan Bawang Masuk Mulai Juli Jakarta, surya - Pemerin- tah memastikan membuka kran impor cabai sebanyak 9.000 ton lebih dan bawang merah 16.000 ton lebih, dalam rangka mere- dam gejolak harga. Wakil Menteri Perdagangan (Wamendag) Bayu Krisnamur- thi mengungkapan, pemerintah akan mengimpor cabai rawit dan bawang merah untuk pe- riode impor Juli-Desember 2013. Impor ditujukan untuk menu- tupi kebutuhan dalam negeri sebelum masa panen. "Semester II, Juli-Desember cabai 9.715 ton, bawang merah 16.781 ton. Ini akan kita atur dengan memastikan pada satu musim panen pemasukan itu akandihentikan,"kataBayu,saat Rapat Koordinasi menyambut Lebaran di kantor Kementerian Koordinator bidang Perekono- mian, Jakarta, Rabu (10/7). Secara terpisah, Menko bi- dang Perekonomian Hatta Raja- sa mengungkapkan, harga lima komoditas bahan pokok melon- jak di minggu kedua Juli 2013. Kenaikan ini terkait mulainya hari puasa Ramadan. "Saat ini pasokan cabai dan bawang merah dari dalam ne- geri tak maksimal karena belum masukpanenraya.Musimpanen mundur Agustus, maka respons- nya ya buka kran," katanya. Pada Agustus, ketika masa pa- nen bawang merah telah berlang- sung, maka impor akan dihenti- kan. Harapannya agar bawang merah impor tak mengganggu harga cabai petani lokal. Seperti diketahui, harga cabai rawit melonjak 63,03 persen di bulan Juli ini dibanding bulan Juni 2013. Sedang harga bawang merah melonjak 49,08 persen. "Yang perlu mendapat per- hatian kita pertama, cabai rawit yang pada minggu ke 2 Juli, di- banding Juni kemarin mening- kat dari Rp 27.721, saat ini Rp 45.000. Bawang merah dari Rp 32.341 per kg menjadi Rp 48.213 per kg," jelas Hatta Selain itu, daging ayam ras naik 19,5 persen dari Rp 28.863 per kg menjadi Rp 34.493 per kg, telur ayam ras naik 9,32 persen dari Rp 18.211 per kg menjadi Rp 19.908 per kg. "Secara stok masih positif, sup- lai dijamin ketersediaannya. Tapi memang secara seasonal terjadi kenaikan harga karena perminta- an melonjak," tambahnya. Waspadai Mafia Disisi lain, pemerintah dimin- ta mewaspadai mafia importir yang biasa menahan penjualan bahan pangan untuk menunggu lonjakan harga. Hal itu dilontar- surya/sugiharto Lacak kendaraan - Manager IT Vast, Ali Gunawan (kiri), Manager Youth XL East I, Martono (tengah) dan Manajer Penjualan, Singgih Wijayanto, melihat posisi mobil yang dilacak menggunakan sistem yang disediakan XL di grand City Surabaya, Rabu (10/7). Disiapkan Jadi Hub ke Asia Selatan Pelanggan XL Dimudahkan Layanan GPS Pintar SURABAYA, SURYA - PT XL Axiata Tbk (XL) berupaya me- nambah lebih dari 5.000 pelang- gan dalam dua bulan  ke depan. Rencana itu mereka lakukan sa- lah satunya melalui peluncuran layanan XL-Vast (Vehicle Assis- tant) di Surabaya, Rabu (10/7). Vice President XL East Region, TitusDondimenjelaskan,XL-Vast adalah produk bundling yang diluncurkan melalui kerjasama dengan Rumah Air, perusahaan lokal di bidang Security IT Solu- tion yang menyediakan perang- kat seperti, Global Positioning System (GPS) kendaraan. ”Initrenbarudibidangindustri otomotif dan selular di Indonesia. Program ini adalah yang pertama dan satu-satunya di Indonesia, karena komunikasi pintar antara pemilik dan kendaraannya hanya bisa dipergunakan di jaringan XL,” kata Titus, Rabu (10/7). Manager Youth and Commu- nity East 1 PT XLAxiata Tbk East Region, R Martono mengatakan bahwa XL Vast sebenarnya tak jauh berbeda dengan produk Security IT Solution seperti GPS, yang dipasang di kendaraan. Menurutnya, kalau GPS biasa, bisa melacak posisi kendaraan, mematikan mesin jarak jauh, ser- ta menyadap percakapan di mo- bil. Tetapi lewat XL-Vast ada nilai tambah yang bisa dinikmati. "Pelanggan XL yang memakai perangkat GPS dari Rumah Air mendapatpemberitahuankapan saat mengganti oli mobil, kapan bayar pajak kendaraan, perpan- jangan STNK, KIR, dan lainnya. Pemberitahuan itu akan dikirim via sms,” urai Martono. Penambahan 5.000 nomor itu nanti dibagi dua. Sebanyak 2.500 terpasang di GPS, lalu 2.500 lain- nya di ponsel milik pelanggan.  Singgih Wiyanto, Manager Sales Rumah Air menyebutkan bahwa paket bundling GPS ken- daraan dengan XL ditawarkan di Rp 1.799.000. Pelanggan akan mendapat satu tahun gratis la- yanan data, garansi replace, ser- ta layanan siaga 24 jam. (ben) kompas/priyambodo Program mudik - Jika ingin ber-Lebaran di kampung menggunakan sepeda motor,peminat seba- iknya segera daftar pada program mudik Lebaran yang disiapkan Kementerian Perhubungan. Redam Harga Sebelum Panen Raya■ Juli, harga cabai rawit melonjak 63,03 persen dibandingkan Juni. Sedangkan harga bawang merah naik 49,08 persen Impor periode semester II 2013, cabai 9.715 ton dan bawang merah 16.781 ton ■ ■ ■ storyhighlights Pemudik Bermotor Terima Subsidi Rp 25 Miliar | HALAMAN  | | KAMIS, 11 JULI 2013 Perketat Remitansi Bank Indonesia (BI) memperketat perizinan dan pengawasan per- usahaan penyelenggaraan transfer dana (remitansi) lewat Surat Edaran BI No 15/23/DASP tahun 2013 tentang Transfer Dana yang berlaku sejak tahun ini. Selain modal dan kompensasi, bele- id ini mengharuskan penyelenggara menyerahkan rencana bisnis selama setahun ke depan dan BI berhak mengevaluasi. Rosmaya Hadi Kepala Grup Pengembangan dan Kebijakan Sistem Pembayaran BI Perum Badan Urusan Logistik (Bulog) segera memasok kurang lebih sebanyak 20 ton daging sapi per hari, untuk meredam kenaikan harga daging sapi yang hingga saat ini belum mengalami penurunan. "Jika melalui pesawat, kira-kira bisa masuk sebanyak 20 ton setiap harinya," kata Dirut Perum Bulog Sutarto Alimoeso, Rabu (10/7). Namun, kata Sutarto, hingga saat ini pihaknya masih menunggu perizinan karantina untuk melakukan impor daging sapi beku yang akan masuk melalui Bandara Soekarno-Hatta. Dari alokasi sebanyak 3.000 ton yang diterima Bulog, langkah memasukkan daging sapi dengan menggunakan angkutan udara itu diharapkan mampu menambah pasokan dengan cepat, sementara sisanya menggunakan angkutan laut. "Hingga 'H-7', yang dikirimkan masuk dari laut dan udara diharap- kan bisa mencapai 1.000 ton," ucap Sutarto. Untuk kiriman pertama daging sapi beku asal Australia melalui jalur laut, direncanakan mulai dikirim pada 15 Juli dan diharapkan masuk pada 25 Juli 2013. Berdasarkan data Kementerian Perdagangan, harga daging sapi per 10 Juli 2013 masih kisaran Rp 94.232 per kilogram, dengan harga rata-rata pada Juli Rp 92.071 per kilogram. Melalui operasi pasar ini, pemerintah menargetkan harga daging sapi di pasar bisa turun hingga kisaran Rp 75.000 per kilogram. (ant) kan Sekretaris Jenderal Asosiasi Pedagang Pasar Seluruh Indone- sia (APPSI) Ngadiran, saat dihu- bungi di Jakarta, Rabu (10/7). "Impor bahan pangan untuk memenuhi pasokan di pasar itu boleh, tapi harus dikendalikan. Pemerintah harus mewaspadai jangan sampai mafia importir itu menahan barang," kata Ngadiran. Ia menambahkan, pemerintah dalam mengeluarkan izin impor harus mematok harga jual sesuai dengan perhitungan biaya im- portir. Hal itu untuk mencegah importir memasang harga tidak wajar yang dapat merugikan pedagang lokal dan konsumen. "Saat impor tentukan ong- kosnya berapa, lalu pemerintah patok harga agar importir tidak seenaknya. Pemerintah jangan sampai dikendalikan oleh im- portir," ujarnya. Ngadiran juga meminta peme- rintah memerhatikan siklus panen petani, serta kecukupan pasokan bahan pangan hasil dari petani/ peternak, saat impor. Pemerintah juga harus mengeluarkan izin im- poruntukintervensipasaratasku- rangnya pasokan bahan pangan. Di awal Ramadan ini, menurut dia, hanya minyak goreng dan gula pasir yang harganya relatif stabil. Sedang bahan pangan, seperti daging, ayam potong, cabai dan bawang, harganya meningkat cu- kup drastis. (ant/ Pasok 20 Ton Daging Tiap Hari join follow @portalsurya
  • 4. 4 | FINANCE KAMIS, 11 JULI 2013 | I I I I I 10 I I I I I 9 I I I I I 8 I I I I I 4 I I I I I 5 I I I I I 10 I I I I I 9 I I I I I 8 I I I I I 4 I I I I I 5 I I I I I 10 I I I I I 9 SURABAYA, SURYA - PT Asuransi Umum Bumiputera Muda 1967 (Bumida) menarget- kan hingga akhir 2013 mampu menghimpun premi sebesar Rp 37 miliar. Hingga Semester I- 2013, telah mengumpulkan ku- rang lebih Rp 16 miliar di Jatim. Kepala Cabang Bumida Sura- baya, Nuris Yusuf Laksono me- ngatakan, dari total premi yang berhasil dihimpun di semester satu ini, sebagian besar berasal dari kontribusi produk Asuransi Tanggung Gugat Profesi Dokter. Asuransi Tanggung Gugat Dokter adalah produk yang membidik profesi dokter, baik dokter umum maupun spesialis, dengan premi senilai Rp 1 juta hingga Rp 7,5 juta per tahun. Produk yang ditawarkan, Bumida akan memberi pendam- pingan atau medikolegal sejak dini kepada dokter-dokter nasa- bah yang dituntut oleh pasien- nya atas dugaan malapraktik. Malapraktik adalah praktik kedokteran yang salah atau ti- dak sesuai dengan standar pro- fesi atau standar prosedur ope- rasional. Tindakan malapraktik dapat dikenai hukum kriminal dan hukum sipil. Tidak hanya pendampingan hukum, Bumida membayar ganti rugi senilai maksimal Rp 500 juta seandainya berdasarkan putusan pengadilan, dokter itut dinyatakan bersalah dan diwa- jibkan membayar ganti rugi. Nuris Yusuf mengklaim se- bagai pemilik produk asuransi profesi dokter satu-satunya. Di beberapa asuransi lain sebe- narnya ada, tapi milik Bumida berbeda karena memberikan pendampingan juga untuk dok- ter dari awal. "Kami juga menyiapkan tim pengacaranya. Asuransi lain, mungkin hanya memberi ganti rugi tuntutan," ujar Nuris kepa- da Surya, Rabu (10/7). Di Surabaya, Asuransi Tang- gung Gugat Profesi Dokter yang diluncurkan Bumida mampu mendulang premi senilai hampir Rp2miliarpertahun. Secaraaku- mulatif di Jatim, yang mencakup S ITUASI ekonomi Indonesia yang semakin berimbang siap mendukung pelaksanaan Ja- minan Kesehatan Nasional (Jamkes- nas) yang dimulai 1 Januari 2014. WakilMenteriKeuangan(Wamen- keu), Mahendra Siregar mengung- kapkan, bagi Indonesia sekaranglah waktunya masuk ke sistem univer- sal health care (layanan kesehatan menyeluruh). "Ini kalau kita lihat dari sisi bonus demografi dan kekuatan ekonomi, yang semakin berimbang," tuturnya dalam rapat kerja (raker) dengan Menteri Kesehatan, Bappe- nas, dan Komisi IX DPR di Jakarta, Rabu (10/7). Mantan komisaris PT Dirgantara Indonesia dan PT Aneka Tambang Tbk ini menjelaskan, kesiapan ekonomi nasional untuk mendukung pelaksanaan Jamkesnas itu terlihat dari kemam- puan perekonomian dalam negeri, mulai dari segi produktivitas hingga segi kon- sumsi. "Apa yang kita cita-citakan sela- ma ini untuk memperbaiki kualitas hidup sumber daya manusia di In- donesia melalui layanan kesehatan yang baik dapat tercapai. Tentunya, selaras dengan perkembangan eko- nomi yang ada," ujarnya. Tapi, pria kelahiran 1 Januari 1970 ini mengatakan bahwa sistem universal health care, bila dilihat dari sisi pengelolaan fiskal, ada yang berhasil dikelola dengan baik oleh suatu negara, tetapi ada juga yang kurang berhasil. Mahendra Siregar berharap, pemerintah dapat mencegah agar Indonesia tidak ikut masuk da- lam persoalan fiskal yang berkelanjutan melalui pembatasan subsidi bahan bakar minyak (BBM) yang kemudian akan dialihkan untuk premi ja- minan kesehatan. (ant) Adu Salur Kredit SURABAYA, SURYA - Kena- ikan suku bunga acuan atau BI Rate menjadi enam persen beberapa waktu lalu, berpo- tensi menurunkan kredit. Kini sejumlah bank mulai beradu strategi. Salah satunya, mem- perluas jaringan sehingga men- jangkau lebih banyak nasabah. PT Bank Negara Indonesia (Persero) Tbk dan PT Bank Rak- yat Indonesia (Persero) Tbk siap menambah jaringan pelayanan di Jatim tahun ini untuk meng- genjot kinerja kredit produktif. BNI akan menambah dua Sentra Kredit Menengah (SKM), di Gresik dan Sidoarjo. SKM akan melayani nasabah dengan kebutuhan kredit lebih dari Rp 15 miliar. "Dua SKM itu nanti juga meng-cover debitur-debitur di Ngoro, Kota Sidoarjo, dan Pan- daan," tutur Pemimpin Bidang Consumer dan Ritel BNI Kan- tor Wilayah Surabaya, Ryanto Wisnuardhy kepada Surya, Selasa (9/7) malam. Tak disebutkan nilai investasi dari perluasan jaringan ini, tapi Ryanto memastikan upaya itu adalah strategi BNI menggenjot kinerja kredit produktif. Hingga akhir Juni 2013, total kredit produktif BNI Kanwil Surabaya di Jatim mencapai Rp 9 triliun, meningkat 15,75 persen dibanding posisi di akhir 2012. Sedangkan kredit sektor konsumtif mencapai Rp 3,808 triliun atau meningkat 12,02 persen dibanding penyaluran hingga akhir Desember 2012. Total kredit yang disalurkan BNI di Jatim selama Juni 2013 menyentuh Rp 12,8 triliun. Hingga kini, kredit bermasa- lah di BNI Wilayah Surabaya sebesar 1,95 persen sementara kenaikan bunga kredit berkisar 0,5 hingga 1 persen. "Dampak kenaikan BI Rate belum terasa. Kemungkinan baru tiga bulan lagi.Agar tidak banyak kredit macet, kami terus bereks- pansi dan menambah nasabah baru serta meningkatkan kualitas penagihan,"paparRyanto. Sementara itu, BRI Wilayah Surabaya yang operasionalnya meliputi Madura, Surabaya, Sidoarjo, Mojokerto, Jombang, Krian, Bojonegoro, Tuban, La- mongan, serta Gresik, berenca- na menambah Kantor Cabang di Sidoarjo dan Surabaya seba- gai pengembangan dari Kantor Cabang Pembantu (KCP) yang sebelumnya melayani segmen Rp 100 juta hingga Rp 500 juta. "Kalau statusnya ditingkat- kan jadi Kacab, segmennya ikut dinaikkan menjadi lebih dari Rp 500 juta," ujar Kepala Ba- gian Bisnis Ritel dan Program BRI Kanwil Surabaya, Tjung Suharsono, Rabu (10/7). Selain penambahan dua Kan- tor Cabang, BRI juga akan me- nambah jumlah KCP. Di antara- nya adalah di Sidoarjo, Jombang, Gresik, dan Lamongan. Hingga Mei 2013, total kredit yang disalurkan BRI di Wilayah Surabaya mencapai Rp 13,4 trili- un. Rinciannya, kredit komersial (Rp4,3triliun),konsumtif(Rp2,9 triliun), Kupedes (Rp 2,8 triliun), serta kredit konsumtif yang disa- lurkan BRI melalui unit-unit. "Sisanya, kredit program nonKUR (kredit usaha rakyat) sebesar Rp 121 miliar, KUR (Rp 318 miliar), dan KUR yang disalurkan unit sebesar Rp 825 miliar," terang Tjung. Selain meningkatkan kinerja kredit, perluasan jaringan juga dilakukanuntukmeningkatkan Dana Pihak Ketiga (DPK) yang hingga akhir Mei 2013 meraup Rp 19 triliun. DPK terdiri atas Giro yang dikelola cabang (Rp 2,1 triliun), deposito cabang (Rp 5,2 triliun), tabungan cabang (Rp 3,9 triliun), serta deposito dan tabungan yang dikelola unit, masing-masing Rp 1,1triliundanRp6,7triliun. "Hingga akhir 2013 ini, kami menargetkan ada pertumbuh- an DPK sampai 20 persen," tambah Tjung. (ben) SURYA/EBEN HAEZER PANCA P POTENSI PASAR - Petugas PT Asuransi Bumiputeramuda 1967 Cabang Surabaya memaparkan produk Asuransi Tanggung Gugat Dokter, Rabu (10/7). Kini banyak rumah sakit yang mengambil kebijakan untuk mendorong para dokter mengasuransikan profesinya. Dulang Premi dari Asuransi Profesi Dokter Bank Gencar Perluas Jaringan■ HARGA EMAS PERKIRAAN PASAR 9/7 10/7 DOLAR AS/TROY OUNCE (24 KARAT) 1.256.71 1.255.41 Rp 406.000/gram MATA UANG KURS JUAL KURS BELI EUR 12,797.54 12,668.83 HKD 1,291.82 1,278.84 MYR 3,147.97 3,113.62 SGD 7,839.76 7,760.91 KURSVALAS SUMBER: BANK INDONESIASUMBER: BLOOMBERG FIGUR MAHENDRA SIREGARFIGUR Siap Masuk Jamkesmas ANTARA I I I I I 8 I I I I I 4 I I I I I 5 IHSG Jakarta 5.000 4.800 4.600 4.400 4.200 Minyak/Dolar AS 150.00 120.00 90.00 60.00 30.00 Rupiah/Dolar AS 10.000 9.900 9.800 9.700 9.600 I I I I II I I I II I I I II I I I I I I I I I I I I I I I I I I I I I I I I I I I I I I I I I I I I I I I I I I I I I I I I I I I I I I I I I I I I I I I I I I I I I I I I I I I I I I I I I I I II I I I I I I II I I I I I I II I I I I I I I I I I I I I I I4.403,80 103.53 9.983 9.956 4.433,63 4.478,65 104.69 9.981 Sesuai Peraturan Bank Indonesia Nomor 14/26/ PBI/2012 tentang Kegiatan Usaha dan Jaringan Kantor Berda- sarkan Modal Inti Bank, persentase penyaluran kredit produktif diatur berdasarkan tingkat permodalan perbankan. Semakin tinggi tingkat permodalan bank, maka kredit produktif yang harus diberikan bank bersangkutan harus semakin tinggi. ■ ■ KREDIT PRODUKTIF wilayah Kediri, Malang, Sidoarjo, dan Surabaya, produk ini berpo- tensi menggaet premi di kisaran Rp 12 miliar per tahun. Tingginya potensi itu, salah satunya didorong oleh kebijak- an sejumlah rumah sakita yang mendorong para dokternya untuk mengasuransikan dirinya melalui produk ini. “Potensinya sangat bagus, klaim juga bisa dibilang cukup kecil. Rata-rata sekitar dua per- sen,” tambah Nuris Yusuf. (ben) 102.93 join follow @portalsurya
  • 5. | JAWATIMUR| KAMIS, 11 JULI 2013 ngawi, surya - Nasib tra- gis dialami Mbah Katiran (70) dan cucunya Rohmad (11) war- ga asal Dusun Sulursewu, Desa Teguhan, Kecamatan Paron, Kabupaten Ngawi. Keduanya tenggelam di sungai tak jauh dari rumahnya, saat hendak memandikan sapinya. Diduga keduanya tenggelam di dalam kedung yang biasa digunakan warga sekitar untuk memandikan dan membersih- kan hewan ternaknya. Jasad kedua korban ditemukan sete- lah beberapa jam dicari puluh- an warga yang menggunakan peralatan seadanya itu. Awalnya, Katiran mengajak salah satu cucu lelakinya, Roh- mad untuk memandikan 2 sapi miliknya di sungai yang berja- rak 250 meter dari rumahnya. Akhirnya Rohmad mengajak ketiga temannya yang masih sebaya. Di antaranya Zidan, Rama dan Mela pergi ke sungai mengikuti kekeknya. Setelah sampai di sungai Rohmad terlebih dahulu men- coba berenang di tepian sungai sambil menunggu Katiran me- mandikan 2 sapi di sebelahnya. Sedangkan ketiga teman Roh- mad masih berada dipinggir sungai. Tanpa sebab yang jelas, saat itulah Rohmad tiba-tiba terpele- set masuk ke dalam air sungai sedalam 2 meter. Tak berselang lama, Rohmad berteriak minta tolong. Dalam hitungan detik, Katiran langsung mencoba me- nolong cucunya dengan mena- rik tangan Rohmad. Ironisnya, saat hendak menyelamatkan itu, Mbah Katiran justru menyusul cucunya yang tenggelam dan tidak muncul ke permukaan air sungai hingga berjam-jam. "Saat Rohmad terpeleset dan minta tolong dan Mbah Katiran langsung mengulurkan tangan, tetapi malah keduanya teng- gelam," terang Zidan kepada Surya, Rabu (10/7). Selanjutnya, ketiga bocah teman korban langsung lari meminta tolong warga sekitar. Tanpa menunggu lama, puluh- an warga mencari keberadaan kedua orang yang diduga tenggelam di dalam kedung sungai itu. Upaya pencarian yang dilakukan warga tanpa menggunakan alat bantu ham- pir berlangsung 2 jam. Dengan mencari di dasar sungai, akhirnya sekitar pukul 15.30 WIB, kedua korban ber- hasil ditemukan. Jenazah perta- ma berhasil diangkat dari dasar sungai adalah Rohmad disusul Katiran. Salah seorang tetangga kor- ban, Somingan (65) yang ikut mengevakuasi korban menje- laskan sudah menjadi kebiasa- an korban jika setiap tiga hari sekali selalu memandikan sapi milik korban di aliran sungai di belakang rumahnya itu. "Memang Mbah Katir setiap tiga hari sekali memandikan sapi di kali setiap siang. Aneh- nya Mbah Katir yang pandai berenang bisa tenggelam," pa- par tetangga korban ini. Untuk mengetahui penyebab tewasnya kakek dan cucunya ini tim medis dari Puskesmas Teguhan langsung memeriksa kedua jenazah korban yang sudah terbujur kaku. Ha- silnya, Katiran dan Rohmad dinyatakan tewas setelah keha- bisan oksigen saat tenggelam di sungai itu. Sementara di rumah duka kedatangan kedua jenasah dari lokasi kejadian membuat Tuminem (56) istri Katiran tak mampu membendung tangis histerisnya.(wan) Produksi Arak Dayak Digerebek blitar, surya - Pada bu- lan suci Ramadan, seharusnya semua tindakan yang menyim- pang dari agama dihindari. Tetapi di Blitar, malah ada yang sibuk meramu minuman keras jenis arak dayak. Rumah kontrakan yang dija- dikan home industry miras jenis arak Dayak berada di Jl Sumba, Lingkungan Talun, Kelurahan Klampok, Kota Blitar. Mengetahui usaha ilegal terse- but, polisi segera menggerebek, Selasa (9/7) malam. Dari rumah milik Ny Surip (82), yang dikon- trak Danduk Wicaksono (43), petugas menyita arak sebanyak 400 liter yang baru diproduksi dengan ditaruh dalam ember berukuran 50 liter. Selain itu, petugas juga me- nyita bahan mentah untuk cam- puran arak, seperti nasi yang sudah dioplos dengan ragi dan gula pasir, serta alat penyuling. Saat digerebek, Danduk tak ber- kutik karena memang sedang melayani pembeli. Danduk menuturkan, dirinya mengontrak rumah itu selama dua tahun dan baru ditempati empat bulan, bersama istrinya, Narsiah (39), dan tiga anaknya. Sebulan menempati rumah kontrakan berukuran 16x9 m2 itu, ia akhirnya memproduksi miras secara diam-diam. Meski rumah itu padat penduduk na- mun tak ada yang tahu, terma- suk tetangganya. Selain selalu tertutup, Danduk di kampung itu dikenal makelar mobil. "Saya produksi dibantu istri,," ungkap Danduk di Polsek Sa- nan Wetan. Pelanggan Tetap Setiap hari, ia mampu memproduksi arak Dayak ini sebanyak 50 liter, dengan harga per liter Rp 30.000. Enaknya, ia tak harus menja- jakan namun sudah memiliki pelanggan tetap, yang rata- rata anak muda dan tiap hari mendatangi rumahnya. "Rata-rata sehari hanya laku 30 liter sampai 50 liter. Pem- belinya datang sendiri ke sini. Untungnya, lumayan karena semua bahan membuat sendiri, yang beli hanya gula," tuturnya. Cara membuatnya, ujar Dan- duk tak rumit. Misalnya, beras sebanyak 5 kg dimasak hingga jadi nasi, kemudian dicampur dengan gula sebanyak 5 kg juga. Itu dioplos juga dengan ragi da- lam ember besar dan diberi air mentah sebanyak 25 liter, kemu- dian ditutup rapat-rapat selama tiga sampai empat hari. Setelah empat hari, campuran itu diaduk hingga larut, kemu- dian airnya disuling. Sedang ampasnya dibuang. "Kami bisa membuat arak ini belajar dari istri saya. Istri saya ini asli orang Dayak dan kami sendiri pernah tinggal di sana. Di sana, arak jenis ini sudah membudaya dan diminum se- tiap hari," paparnya. Efeknya, papar Danduk, bisa menambah nafsu makan dan membangkitkan gairah seksual. Namun, kalau diminum berle- bihan, pasti mabuk. AKBP Indarto, Kapolres Blitar Kota mengatakan, terungkapnya home industry miras itu karena kecurigaan petugas. Sebab, setiap hari banyak para pemuda keluar masuk rumah Danduk.(fiq) surya/imam taufiq arak dayak - Pasangan suami istri tidak berkutik saat digerebek polisi, sebanyak 400 liter arak dayak yang diproduksinya akhirnya disita sebagai barang bukti. Penggerebekan berawal dari kecurigaan polisi terhadap sejumlah pemuda yang keluar-masuk rumah tersangka Danduk Kakek dan Cucunya Tewas Tenggelam Polisi Sita 400 Liter Arak■ Berawal dari kecurigaan polisi yang melihat banyak pemuda keluar- masuk rumah kontrakan Danduk Polisi akhirnya menggerebek home industry arak dayak yang diproduksi sendiri sepasang suami istri Setiap hari mampu produksi 50 liter arak ■ ■ ■ storyhighlights kediri, surya - Sejumlah kepala sekolah (kasek) di Kota Kediri, mengeluhkan proses verifikasi penerimaan peserta didik baru (PPDB) dari jalur keluarga miskin (gakin). Masalahnya pihak sekolah tidak sempat melakukan veri- fikasi ulang. Verifikasi ini mes- tinya harus dilakukan dengan cara mengunjungi rumah siswa untuk membuktikan apakah benar dari keluarga miskin. Namun proses ini tidak banyak dilakukan pihak sekolah karena keterbatasan waktunya. "Karena keterbatasan waktu dan tenaga pihak sekolah tidak dapat melakukan kunjungan satu per satu ke rumah siswa yang mendaftar dari jalur ga- kin," ungkap salah satu kepala sekolah yang minta tidak di- kutip namanya kepada Surya, Rabu (10/7). Pendaftar siswa dari jalur gakin tahun ini mengalami peningkatan. Apalagi Pemkot Kediri sejak awal telah mem- berikan jatah sebesar 20 persen daripagukepadasetiapsekolah negeri untuk keluarga miskin. Masalahnya pihak sekolah tidak sempat melakukan ve- rifikasi secara menyeluruh ke rumah siswa yang mendaftar dari jalur gakin. "Kami lebih percaya surat pernyataan dari kepala kelu- rahan," tambahnya. Terkait kekhawatiran ada- nya siswa dari keluarga yang mampu tapi mendaftar melalui jalur gakin, pada saatnya akan ketahuan. "Meski kami tidak sempat melakukan visitasi ke rumah- nya, pada akhirnya akan keta- huan latar belakang keluarga- nya," tambahnya. Jika menemukan permasa- lahan seperti itu pihak sekolah akan mengembalikan kepada Dinas Pendidikan Kota Kediri. Masalahnya pihak dinas yang menangani rekomendasi pen- daftaran siswa dari jalur gakin. Pendaftaran PPDB di Kota Kediri telah diumumkan Senin (8/7) lalu. Dari kuota 20 persen untuk siswa gakin ternyata ti- dak semua sekolah terpenuhi. Dikonfirmasi terpisah Ang- gota Dewan Pendidikan Kota Kediri Heri Nurdianto meng- akui pihaknya juga menerima keluhan dari sejumlah kasek baik SMPN dan SMAN. "Ham- pir semua kasek mengeluhkan proses verifikasi siswa jalur gakin," tambahnya. Masalahnya pihak sekolah tidak punya cukup waktu me- lakukan verifikasi siswa yang daftar dari jalur gakin. Jika nanti ditemukan siswa dari keluarga mampu yang mendaf- tar melalui jalur gakin, pihak sekolah harus bersikap tegas. "Konsekuensi dari pemalsuan identitas itu siswanya harus dikeluarkan," tandasnya.(dim) Para Kasek Keluhkan Verifikasi Siswa Miskin Siswa Palsu Identitas Dipecat■ surya/sudarmawan evakuasi - Sejumlah warga mengevakuasi jenazah Mbah Katiran (70) warga Selursewu, Desa Teguhan, Kecamatan Paron, Kabupaten Ngawi yang ditemukan tewas di sungai bersama cucunya, Rabu (10/7). PENGUMUMAN KEDUA LELANG EKSEKUSI HAK TANGGUNGAN Berdasarkan pasal 6 Undang - Undang HakTanggungan No.4Th.1996, PT.Bank PaninTbk.KCU Surabaya Cendana akan melaku- kan Lelang Eksekusi Hak Tanggungan dengan perantara Kantor Pelayanan Kekayaan Negara dan Lelang (KPKNL) Surabaya ter- hadap asset debitur: 1. Agus Wahib T, berupa Tanah dan Bangunan, SHM No. 385, luas 740m2, a.n.Agus Wahib Thohary al Muhyi,SE, terletak di Ds/Kel. Leran Kec. Kalitudu Kab. Bojonegoro (harga limit Rp. 315.000.000,- / uang jaminan Rp. 80.000.000,-) 2. Vita Lintia Sari, berupa Tanah dan Bangunan, SHM No. 465, 1190 a.n. Eko Susanto, terletak di Ds/Kel. jetak Kec. Bojonegoro Kab. Bojonegoro. (harga limit Rp. 648.000.000,- / uang jaminan Rp. 162.000.000,-). 3. Sukri, berupa Tanah, SHM No. 720, luas 3460m2, a.n. Siti, terletak di Ds/Kel. Bareng Kec. Ngasem Kab. Bojonegoro (harga limit Rp. 87.000.000,- / uang jaminan Rp. 22.000.000,-). 4. Rasmi, berupa Tanah, SHM No. 644, luas 3450m2, a.n. Wasijem, terletak di Ds/Kel. sumbertlaseh Kec. Dander Kab. Bojonegoro (harga limit Rp.104.000.000,- / uang jaminan Rp. 26.000.000,-). 5. Didik Yustina Hadi, berupa Tanah dan Bangunan, SHM No. 281, luas 4530m2, a.n. Mashady, terletak di Ds/Kel. Sukorejo, Kec. Parengan, Kab.Tuban (harga limit Rp. 433.000.000,- / uang jaminan Rp. 110.000.000,-) 6. Sumiati,Hj, berupa Tanah dan Bangunan, SHM No. 64, luas 447m2, a.n. hajjah Sumiati, terletak di Ds/Kel. Sidodadi Kec. Bangilan Kab.Tuban (harga limit Rp. 125.000.000,- / uang jaminan Rp. 32.000.000,-) 7. Maryono, berupa A.Tanah dan Bangunan, SHM No. 197, luas 3084m2, a.n. Mostari, terletak di Ds/Kel. Duwel Kec. Kedungadem Kab. Bojonegoro (harga limit Rp. 61.000.000,- / uang jaminan Rp. 32.000.000,-) B.Tanah dan Bangunan, SHM No.201 , luas 1999m2, a.n. Mostari, terletak di Ds/Kel. Duwel Kec. Kedungadem Kab. Bojonegoro (harga limit Rp. 100.000.000,- / uang jaminan Rp. 25.000.000,-) C.Tanah , SHM No. 855, luas 12454m2, a.n. Maryono, terletak di Ds/Kel. Panjang Kec. Kedungadem Kab. Bojonegoro (harga limit Rp. 250.500.000,- / uang jaminan Rp. 65.000.000,-) 8. Watini, berupa Tanah, SHM No. 413, luas 450m2, a.n.Watini, terletak di Ds/Kel. Kalirejo Kec. Bojonegoro Kab. Bojonegoro (harga limit Rp. 243.000.000,- / uang jaminan Rp. 65.000.000,-) Pelaksanaan Lelang : Kamis, 25 Juli 2013, Pukul 13.50WIB Tempat Ruang Lelang KPKNL Surabaya Jl. Indrapura No.5 Surabaya Syarat-syarat Lelang : 1. Peserta lelang diwajibkan menyetor uang jaminan untuk setiap objek lelang tersebut di atas ke rekening PT. Bank Mandiri (Per- sero) Tbk Cabang Surabaya Indrapura No. Rekening 140.000.2063874, atas nama Rekening Penampungan lelang KPKNL Sura- baya, yang sudah efektif diterima 1 (satu) hari sebelum lelang dan membawa asli bukti setor pada saat pelaksanaan lelang. 2. Peserta lelang yang ditunjuk sebagai pemenang lelang wajib melunasi harga lelang yang terbentuk selambat-lambatnya 3 (tiga) hari kerja setelah tanggal pelaksanaan lelang ditambah Bea Lelang Pembeli sebesar 2% dari harga terbentuk ke rekening tersebut diatas, apabila tidak maka dinyatakan wanprestasi dan uang jaminan lelang masuk ke kas Negara. Peserta yang tidak memenangkan lelang, dapat mengambil uang jaminan lelang tanpa dikenakan potongan apapun. 3. Semua Objek lelang dijual apa adanya, dan peserta lelang wajib melakukan penawaran,paling sedikit sama dengan harga limit, apabila tidak menawar dikenakan sanksi tidak diperbolehkan mengikuti lelang selama 3 (tiga) bulan di wilayah kerja KPKNL Surabaya. 4. Apabila terjadi pembatalan/penundaan lelang maka peserta tidak diperkenankan melakukan tuntutan dalam bentuk apapun ke- pada PT.Bank Panin ,Tbk KCU Surabaya Cendana dan KPKNL Surabaya. 5. Persyaratan lelang dan ketentuan lainnya ditetapkan sebelum pelaksanaan lelang dimulai , informasi lebih lanjut hubungi PT.Bank Panin, Tbk. KCU Surabaya Cendana Jl. Kombespol M Duriyat No. 25 Telp. 081 2323 62127. Surabaya, 11 Juli 2013 PT. Bank Panin, Tbk KCU Surabaya Cendana join follow @portalsurya
  • 6. HALAMAN  | | KAMIS, 11 JULI 2013 Jawa Timur ponorogo, surya - Ke- langkaan Bahan Bakar Minyak (BBM) jenis premium (bensin) di wilayah Kabupaten Ponorogo justru berkepanjangan. Bahkan hingga hari ketiga ini, belum ada antisipasi sama sekali dari Pemkab Ponorogo maupun pihak Pertamina Depo Madiun untuk segera mendistribusikan BBM jenis bensin itu, agar tidak semakin membuat warga Kabupaten Ponorogo semakin panik. Pasalnya, hingga hari ketiga kelangkaan itu, sejumlah SPBU masih belum memiliki stok dan pasokan BBM jenis premium. Dampaknya, jika ada SPBU yang masih memiliki stok ben- sin langsung diserbu pembeli, baik dari pengguna kendaraan roda 2, empat atau lebih hingga pengecer bensin. Kondisi itu seperti terjadi di SPBU Bungkal. Sejak, Rabu (10/7) mulai pukul 07.00 WIB menjadi serbuan para pembeli bensin mulai dari konsumen asal kecamatan Bungkal, Kecamatan Ngrayun, Kecamatan Slahung dan Kecamatan Balong tumplek blek di SPBU ini. Bahkan, antreannya hingga memanjang ke jalan raya Bung- kal - Ponorogo. Ii menyusul sejumlah SPBU mulai dari di Kecamatan Slahung, Balong, Ngrayun, maupun Kecamatan Siman belum mendapatkan pa- sokan premium yang dibutuh- kan konsumen itu. Salah seorang konsumen premium yang ikut mengantre hingga 2 jam belum mendapat- kan jatah bensin, Warman (23) mengaku sudah dua jam meng- atre di SPBU Bungkal. Akan tetapi, belum mendapat jatah premium. Sementara, salah seorang kar- yawan SPBU Bungkal, Tio (27) mengaku sejak SPBU Bungkal dibuka, sudah banyak antrean calon pembeli. Pihaknya tak mengetahui siapa yang mem- beri kabar jika di SPBU Bungkal memiliki stok bensin. (wan) jember, surya - Setelah menunggu sekitar satu jam lamanya, akhirnya sidang class action pedagang Pasar Kencong di Pengadilan Negeri (PN) Jember dimulai. Sidang dimulai pukul 12.00 WIB. Namun mes- kipun setelah menunggu satu jam lamanya, pedagang harus kecewa. Sidang gugatan class action ini sejak awal berjalan lamban, pasalnya dua pekan lalu majelis hakim menunda dua minggu, kini ditunda lagi dua minggu. mendengar penundaan putu- san, tentu saja pedagang kecewa karena majelis hakim menunda kembali sidang yang seharusnya pembacaan vonis. "Karena majelis hakim belum menyelesaikan materi putusan, maka sidang ditunda dua ming- gu lagi. Berkasnya banyak, jadi pembuatan putusannya lebih lama," ujar Ketua majelis hakim Adi Hernomo Yulianto sesaat setelah membuka persi- dangan. Mendengar itu, puluhan pe- dagang yang memadati kursi pengunjung langsung berseru 'huuuuuu'. Mereka berbicara bersahutan kepada majelis. 'Jangan dua minggu pak," ujar seorang perempuan. Adi menjawab secara berselo- roh 'kalau begitu tiga minggu'. Setelah berdiskusi sebentar, majelis hakim tetap memu- tuskan pembacaan vonis akan ditunda dua minggu lagi. Ini merupakan penundaan kedua. Sebab sebelumnya, majelis sudah menunda dua minggu sehingga menjadwalkan sidang pembacaan vonis hari ini, Rabu (10/7). Meksipun telah dua minggu berlalu, majelis hakim belum menyelesaikan materi putusannya sehingga sidang ditunda dua minggu lagi, Rabu (24/7). "Berkasnya banyak sekali, kami sudah memahami isinya. Tetapi ketika membuat putusan, kan harus membuka lagi semua berkas dan barang bukti. Berkas dan barang bukti beratnya mungkin sekitar 5 - 6 kilogram," ujar Adi usai persi- dangan.(uni) | Berkasnya banyak sekali, ada 6 kilogram, tetapi kami memahami isinya. Untuk membuat putusan, tentu harus buka lagi berkas dan barang bukti. Adi Hernomo Yulianto sh ketua majelis hakim pamekasan, surya - Instruksi Dinas Pendidikan Pamekasan tentang larangan penarikan terhadap para siswa ternyata tidak digubris oleh se- jumlah sekolah. Buktinya, setelah SMK 2 Pamekasan, menarik pungutan daftar ulang kepada siswa dan telah dikembalikan, ternyata SMK 1 Pamekasan juga menarik uang daftar ulang kepada siswa- nya. Padahal Dinas Pendidikan (Disdik) Pamekasan, sudah memerintahkan kepada seluruh sekolah dari SD hingga SLA di Pamekasan, dilarang menarik uang apapun kepada siswa, ka- rena tiap siswa sudah mendapat bantuan operasional sekolah (BOS) Rp 1 juta. Uang daftar ulang bagi siswa SMK 1 Jl Pintu Gerbang, Pa- mekasan, tertuang dalam surat pemberitahuan SMK 1 Pame- kasan, yang diberikan kepada seluruh siswa saat kenaikan kelas, kelas II dan III. Surat itu ditandatangani Kepala SMK 1, Suendi dan Komite Sekolah, Moh Lutfi. Besarnya biaya daftar ulang siswa ini berbeda. Untuk siswa yang naik ke kelas II sebesar Rp 215.000 dan siswa yang naik ke kelas III Rp 190.000 dan di- haruskan dibayar pada Kamis – Jumat (5-6/7) lalu. Dari Rp 215.000 itu, rincian- nya uang BP3 Juli Rp 100.000 (untuk siswa kelas I naik ke kelas II). Untuk siswa yang naik ke kelas III, uang BP3 Rp 75.000. Biaya lomba keterampilan siswa tingkat provinsi Rp 50.000. Pre- mi asuransi Rp 20.000, atribut lo- kasi sekolah Rp 15.000. Kegiatan HUT kemerdekaan RI Rp 15.000 dan kalender 2014 Rp 15.000. Menurut siswa, surat edaran itu diberikan guru saat pemba- gian rapor kenaikan kelas Sabtu (22/6) lalu, disertai pesan, jika tidak membayar uang pendaf- taran, dianggap mundur dan siswa dicoret dari sekolah. Beberapa siswa yang mengaku sudah daftar ulang mengatakan, mereka terpaksa membayar kare- na takut dicoret dari sekolah dan dianggap mengundurkan diri. Wakil Kepala Sekolah Bidang Kesiswaan, SMK 1, Subiyanto, mengaku sampai sekarang be- lum mendapat edaran resmi dari Disdik, jika sekolahnya dilarang menarik uang pendaftaran ke- pada siswanya.(sin) k ondisi Siti Lestari Kur- niawati (10) terus terku- lai lemas di tempat tidur. Bocah yang hanya memiliki bobot 6,2 kiligram ini diduga mengalami pengecilan kepala. Putri pasangan suami istri (pasutri) Nurul Huda (30) dan Rosanah (28), warga Dusun Laok, Desa Bilaan, Kecamatan Proppo, Pamekasan, yang selama ini tergolek tak berdaya ini, membuat terenyuh Bupati Pamekasan, Achmad Syafii. Di dampingi Kepala Dinas Kesehatan (Dinkes) Pamekasan, Ismail Bey dan sejumlah stafnya, bupati mengunjungi rumah Tari, panggilan bocah yang kini tubuhnya terus me- ngecil hingga kurus kerontang, dengan berat badan hanya 6,2 kilogram, seperti bayi. Kehadiran orang nomor satu di Pamekasan itu, disambut suka cita kakek dan neneknya, Mohammad Arif (65) dan Satini (63). Sedang kedua orang tuanya, merantau ke Malang, bersama anak bungsunya. “Benar Pak, ini cucu saya. Ayah dan ibunya sudah lama tinggal di Malang, mencari nafkah di sana. Sementara Tari saya rawat di sini,” kata Ny Satini, kepada Syafii, yang ditemui di bale bambu depan rumahnya. Melihat tubuh Tari yang tergolek, Syafii menanyakan kenapa Tari sampai mengalami kondisi seperti itu. “Apakah cucu ibu ini, asupan gizinya kurang atau bagaimana,” Tanya Syafii. Lalu Satini menjelaskan, saat lahir di RSUD Pamekasan, kondisi cucunya normal, namun ketika menginjak usia 1 tahun terjadi perubahan tubuh cucunya. Tubuhnya bukan tambah besar, malah mengecil. Saat usia 4 tahun sudah dibawa ke RSUD Pamekasan, namun tidak ada perubahan. Padahal, asupan gizinya cukup, seperti susu, makanan bervita- min, bubur dan buah-buahan. Menderita Microcephalus Menurut Zainab, bidan desa setempat, Tari tidak mengalami gizi buruk, tapi terdapat penyakit penyerta kelainan otak (microcephalus) yang membuat kepalanya mengecil, sehingga tubuhnya ikut mengecil dan metabolismenya terganggu. “Upaya kami sudah maksi- mal merawat anak ini, namun tetap seperti ini,” kata Zainab. Kemudian bupati membe- rikan bantuan kepada Satini untuk pengobatan Tari. Setelah itu bupati mengun- jungi Salima (3), warga Desa Pangorayan, Kecamatan Prop- po, yang mengalami gizi buruk, karena kedua orangtuanya yang membiarkan anaknya keku- rangan gizi dan tidak dibawa ke dokter.(muchsin rasyid) Puluhan Warga Rusak Rumah jember, surya - Sekelom- pok orang misterius membuat teror di Jember. Sebuah rumah milik warga dirusak dan se- orang warga dianiaya, Selasa (9/7) malam. Rumah milik warga Desa Pontang Kecamatan Ambulu, Purwanto (35) sengaja dirusak. Akibat pengrusakan itu rumah itu berantakan, perabotan ru- mah di ruang tamu juga rusak. Kaca jendela depan pecah. Pla- fon di bagian teras juga berlu- bang akibat dilempari batu. Kasatreskrim Polres Jem- ber AKP Makung Ismoyojati mengatakan, pihaknya belum bisa menyimpulkan siapa pe- lakunya. "Karena warga sekitar tidak mau menjadi saksi atau memberikan keterangannya. Mereka memilih menjawab ti- dak tahu," ujar Makung, Rabu (10/7). Sementara, pemilik rumah itu sendiri sudah tidak ada di rumah. Ia diduga kuat kabur bersama adiknya, Heri alias Kipli (25). Tidak ada korban jiwa dalam peristiwa itu. Ha- nya saja, seorang warga setem- pat yang bernama Siswanto, yang ditengarai masih bersau- dara dengan Purwanto sempat menjadi sasaran amuk warga. Ia mengalami luka meskipun tidak sampai parah. Balas Dendam Pengrusakan rumah Pur- wanto diduga kuat dipicu pembacokan yang dilakukan Purwanto (35)terhadap Fajar Sukmono (45), seorang guru silat di Perguruan silat di Ambulu. Dari informasi yang dihimpun Surya, Fajar dibacok di jalan raya Pontang oleh Pur- wanto dan adiknya, Heri alias Kipli (25). Kejadian bermula saat Fajar mendapatkan kabar dari Pur- wanto, untuk datang ke se- buah warung Mbok Sayem di Dusun Pontang Tengah Desa Pontang Kecamatan Ambulu sekitar pukul 14.30 WIB. Saat tiba di lokasi, ternyata kedua orang ini terlibat cekcok. Usai cekcok, keduanya yang masih ada hubungan kekera- batannya ini sepakat menyele- saikannya di rumah Purwanto, tak jauh dari warung. Ternya- ta, cekcok tidak berhenti hing- ga akhirnya mereka sepakat menyelesaikan di Mapolsek Ambulu. Mereka ke Mapolsek Ambulu mengendarai mobil. Di dalam mobil sudah ada Kipli, adik Purwanto. Ketika menuju Ma- polsek inilah, keduanya meng- aniaya Fajar menggunakan sen- jata tajam yang sudah dibawa di dalam mobil. Fajar sendiri terlihat sempat melawan kare- na tangannya terkena sabetan senjata tajam yang sepertinya menangkis serangan itu. Fajar tidak berdaya karena menghadapi dua orang. Meli- hat Fajar lemas, korban lang- sung ditinggalkan di pinggir jalan. Fajar ditemukan oleh warga setempat dan dilarikan ke Puskesmas Ambulu. Namun karena kondisinya kritis, maka ia langsung dirujuk ke RSD dr Soebandi Jember. Fajar meng- alami luka bacok di kepala, tangan dan punggung. Petang harinya, ratusan orang mendatangi rumah Pur- wanto. Tanpa banyak cakap, mereka langsung melempari rumah itu memakai batu. Puas melihat rumah Pur- wanto rusak, ratusan orang itu meninggalkan rumah tersebut. Di tengah jalan, mereka sempat memukuli Siswanto.(uni) Warga sebelumnya menduga bocah yang diasuh nenenknya ini menderita gizi buruk, karena saat usia 10 tahun, bobotnya hanya 6,2 kilogram. Bahkan untuk bergerak saja, bocah perempuan ini kesulitan, sehingga hanya tergolek di tempat tidur. Menengok Bocah Penderita Microcephalus Bupati Trenyuh Melihat Kepala Tari Kian Mengecil surya/sriwahyunik rusak - Rumah Purwanto dirusak puluhan orang yang diduga dendam terhadap pemilik rumah, pasalnya Purwanto dan adiknya Kipli telah membacok Fajar Sukmono yang dikenal sebagai guru silat di Ambulu. Kini polisi masih terus olah TKP untuk menentukan motif pengrusakan rumah. SMK 1 Pamekasan Pungut Paksa Siswanya surya/sudarmawan antre premium - Premium di Ponorogo semakin langka, akibatnya antrean selalu terjadi pada SPBU yang masih memiliki stok Premium Semakin Langka surya/muchsin rasyid tergolek - Siti Lestari Kurniawati (10) hanya mampu tergolek, Bupati Pamekasan terlihat trenyuh melihat kondisi penderita Microcephalus ini. Buntut Pembacokan Pendekar Silat■ Pada selasa (9/7), Purwanto dan adiknya Heri alias Kipli membacok Fajar Sukmono (45) yang dikenal sebagai guru silat Usai menganiaya Fajar, Purwanto dan Kipli kabur Puluhan orang secara berkelompok merusak rumah Purwanto hingga ruang tamu rusak berat Puas rusak rumah, warga menganiaya Siswanto. ■ ■ ■ ■ storyhighlights Putusan Class Action Ditunda Polisi Bekuk Kurir Sabu madiun, surya - Seorang kurir narkotika jenis sabu-sabu, Rino Prayogo alias Gareng (28), warga Kelurahan Rejomulyo, Kecamatan Kertoharjo, Kota Madiun dibekuk tim buser Satu- an Narkoba Polres Madiun Kota, Rabu (10/7). Ia dibekuk saat mengantarkan paket sabu lengkap dengan peralatan hisab di Hotek Purboyo, Kota Madiun. Menurut AKP Pujuono, Kasat Narkoba Polres Madiun Kota, Gareng dikenal sebagai kurir sabu-sabu siap pakai. Karena selain menyediakan barang haram berupa paket hemat sabu-sabu, ia juga menyiapkan peralatan hisap. Mulai dari botol plus sedotan yang dipergunakan untuk menghisap sabu-sabu.(bet) Protolan SMP Bobol Toko kediri, surya - Gara-gara kurang kasih sayang orangtua- nya, AP (15) anak remaja nekat membobol toko di Jl Inspektur Brantas, Kota Kediri, Rabu (10/7). Namun apes, aksinya keburu dipergoki oleh Suparni (45) pencari pasir. Tersangka kemudian berusaha kabur tapi berhasil diamankan warga. Kasus itu kemudian dilaporkan ke Polsekta Mojoroto. Dari tangan tersangka diamankan barang bukti beru- pa dua peleg sepeda motor, tiga rokok dan bungkus kopi. TersangkaAP warga Botolengket, Kelurahan Bujel, Kecamatan Mojoroto, Kota Kediri mengaku membongkar etalase toko milik Dedy Setiawan(23) dengan alat cungkit. Pelaku berhasil diaman- kan dan kemudian diserahkan ke polsek. Karena masih di bawah umur rencananya kasusnya dilimpahkan ke PPA.(dim) LINTAS JAWA TIMUR tidur pulas Puluhan Pegawai Negeri Sipil (PNS) dan pegawai swasta sibuk mencari tempat tidur yang nyaman di seluruh sudut yang ada di Masjid Agung (Masjid Jami') Ponorogo, Rabu (10/7). Selain menghilangkan kepenatan karena pekerjaan, mereka juga mencuri waktu menunggu buka puasa.(wan)surya/Sudarmawan join follow @portalsurya
  • 7. | SURYALINES| KAMIS, 11 JULI 2013 Gedangan, Kabupaten Malang, Selasa (9/7) malam. Ny Ngatinah (73), warga RT 14 RW 3 Desa Sitiarjo, Kecamatan Sumbermanjing Wetan, sedang tidur saat air sungai Penguluran dan Mbambang meluap. Ia ting- gal bersama anak, dua cucu, dan keponakan di rumah itu. Ketika ketinggian air men- capai 1-2 meter sekitar pukul 22.00, semua penghuni rumah lari menyelamatkan diri. Tapi, Ny Ngatinah, tak bisa berbuat banyak karena penyakit tekanan darah tinggi yang dideritanya. Keponakan korban, Tiyanto, mengatakan, saat air mulai su- rut, Rabu (10/7) dini hari, jena- zah Ny Ngatinah ditemukan di kebun pisang, sekitar 25 meter dari rumahnya. Posisi nenek ini tetap berada di atas kasur yang tersangkut di atas lemari. Luapan air sungai akibat hu- jan lebat selama dua hari bertu- rut-turut ini merendam rumah sekitar 847 KK warga Desa Siti- arjo. Korban terbanyak adalah warga RW 08 dan RW 09 Dusun Rowo Terate, yakni 177 KK. "Kami terendam dalam ru- mah," ujar Ny Setyaningsih, warga RT 14 RW 3. Ia hanya tinggal berdua dengan suami, Kurnianto, karena dua anaknya bekerja di Kota Malang. Selain rumah dan perabotan rumah tangga, terjangan air juga merusak sekitar 166 hektar sawah, 145 hektar kebun pisang, drainase jalan, dan jaringan iri- gasi sepanjang 1 kilometer dari sungai Mbambang. Perabotan rumah tangga terlihat menum- puk di Jl Raya Dusun Krajan, Sitiarjo, saat air mulai surut. "Kami belum menghitung jumlah kerugian," jelas Hafi Lutfi, Kepala Pelaksana BPBD Kabupaten Malang, kepada Sur- ya Online, Rabu (10/7). Amirul Yasin dari PMI Ka- bupaten Malang menyatakan sempat mengevakuasi Ny Yati di Dusun Pulungrejo yang terendam air setinggi hampir dua meter. Setelah dievakuasi, perempuan ini diamankan di Dusun Palung. Di Sitiarjo, PMI membuka dapur umum di kantor GKJW. "Ini untuk membantu 1.881 war- ga yang jadi korban. Selain itu, siang ini akan ada kiriman 5.000 liter air bersih," jelas Muji Uto- mo, Kasubsi Penanggulangan Bencana PMI Kab Malang. Di mata warga, banjir kemarin ini lebih besar dibanding 2003. "Lihat saja deras airnya," kata Prayogo Adiputro, warga RT 53 RW 2. Guru SDN Sitiarjo 5 ini menyatakan, banjir besar pernah terjadi di Sitiarjo pada 2003, 2007, 2009 dan terakhir 9 Juli 2013. Tak hanya merusak perabotan rumah, terjangan air juga meng- hanyutkan hewan ternak. "Wa- rung permanen saya amblas," tutur Widyo Wanto (40), warga RT 14 RW 3, sambil memandangi warung berukuran 8x8 meter yang rata dengan tanah. Tetangga Prayogo, yakni Wi- wik dan Eko, kehilangan 13 ekor babi. Tiga ekor kerbau Budi juga hanyut. "Kemungkinan jumlah ternak yang hanyut masih bisa bertambah," ujar Bagyo Setyono, Kabid Tanggap Darurat dan Lo- gistik BPBD Kab Malang. Selain melanda Desa Sitiarjo yang berpenduduk 2.928 KK atau 7.716 jiwa, luapan air sungai juga merendam Desa Tambakre- jo dan Sidoasri yang juga di Ke- camatanamatan Sumbermanjing Wetan, serta Desa Sidodadi di Kecamatanamatan Gedangan. Menurut Bagyo Setyono, di Desa Sidoasri, air menggenangi sedikitnya 800 rumah. "Kades Sidoasri meminta bantuan pena- nganan kesehatan dan air bersih bagi 450 KK warga," ujarnya di Posko Bencana di GKJW Pasa- muan Desa Sitiarjo kemarin. SedangkandiDesaTambakrejo, Kades Darsono menyatakan seba- gian lahan pertanian tergenang air hingga setinggi sekitar 25 cm. Banjir juga sempat menimbulkan tanah longsor yang memutus ak- ses jalan menuju Pantai Tamban. Bupati Malang, Rendra Kresna usai sahur langsung meninjau lokasi. Ini kemudian disusul Ka- polres MalangAKBPAdi Deriyan dan Dandim 0818 Letkol Solikin. Kapolres Adi Deriyan menya- takanmengerahkan120personel Polri untuk membantu korban banjir. Sementara personel TNI AD kemarin pagi sudah bekerja bakti membersihkan jalan. (vie) sudah dipamerkan pun seren- tak dibungkus dan disimpan kembali. Belum banyak yang diketahui publik dalam sosialisasi itu. Belakangan bahkan, masyarakat lebih tahu kasus korupsinya, dibanding detil rencana penera- pan mesin simulatornya. Mayo- ritas masyarakat juga tidak tahu, penerapan perangkat teknologi itu akan berimplikasi pada biaya pengurusan SIM. “Lho masak pakai membayar. Saya kira ting- gal pakai, seperti ujian praktek begitu,” kata Edi Prianggono, seorang pemohon SIM di Sat- pas Colombo Surabaya, Selasa (9/7). Edi kaget begitu diberi tahu akan ada tambahan biaya Rp 50.000 bila penggunaan simula- tor itu diberlakukan. Bagi pria berusia 30 tahun, penambahan biaya itu cukup berat. Bagi Edi yang mengurus SIM C (untuk sepeda motor), tambahan bia- ya Rp 50 ribu itu sama dengan kenaikan 50 persen dari biaya yang berlaku. Saatinibiayapengurusan SIM C ditetapkan Rp 100 ribu. Biaya ini masih ditambah dana wajib asuransi sebesar 130 ribu. Jadi, jika simulator diterapkan, total biaya yang harus ditanggung Edi mencapai Rp 180 Ribu. Ini iaya resmi. Belum termasuk bia- ya patikelir atau pemulus ujian. Edi memperkirakan, pasti akan muncul protes atau keberatan jika masyarakat tahu adanya tambahan biaya itu. Wajar saja Edi berkali-kali ber- SimulatorBikin... DARI HALAMAN 1■ diterima untuk menjadi anggota keluarga kerajaan,” beber IDP. Namun,sayangnya,salahsatu darigelaryangditerimaIDP harusreladilepaskannya.Gelar tersebutmerupakangelaryang diberikandariKerajaanGowa. Konon,BupatiGowamerasa pemberiangelaritutidakatas seizinnya.Penyanyikelahiran 30Januari1991inipundiminta untukmengembalikannya. Saat berkunjung ke kantor redaksi, Rabu (10/7), Indah membenarkan hal itu. Menurutnya, gelar tersebut menjadi kontroversi antara pihak kerajaan dan pemerintah. “Itulah kontroversi. Di Kerajaan Gowa memang ada miss komunikasi. Ada perde- batan dengan pemerintahan, tapi detailnya seperti apa, aku enggak tahu,” kata Indah. Gelar yang diminta dikem- balikan lagi adalah Tulolonna Butta Gowa. Tak hanya itu, acara yang pernah mengangkat pemberian gelar pada Indah itu juga diminta dihentikan. “Ya, namanya acara kan mengikuti rundown, enggak bisa dihentikan begitu aja,” ucap Indah menyayangkan. Selain peristiwa yang tak diharapkan tersebut, IDP mengaku punya banyak pengalaman berkesan ketika bertandang ke sejumlah daerah. Di antaranya ketika menyambangi Pulau Samate dan bertemu dengan Raja Taher Arfan (raja di kerajaan Raja Ampat, Papua Barat). Selain disambut ramah oleh masyarakat dan keluarga kerajaan, dia juga dianugerahi gelar yakni Pin Fun Kalanafat. Artinya, Putri dari Ampat. “Disana aku diangkat secara resmi sebagai anak dari Rajat Ampat,” tutur IDP beberapa waktu lalu. Terkait aksi panggungnya yang mengangkat beragam tradisi di sejumlah kerajaan di Tanah Air, IDP menya- takan, saat ini baru enam kerajaan yang disambangi- nya. Kerajaan itu, Samudra Pasai di Lokhseumawe, Aceh, Sriwijaya, Palembang, Sumatera Selatan, Kutai Kertanegara, Tenggarong, Kalimantan Timur, Mataram, Yogyakarta, Gowa, Makassar, Sulawesi Selatan, dan Raja Ampat, Papua Barat. “Nah kurang satu kerajaan lagi, yang belum ditentukan untuk aku datangi,” pungkas IDP yang melejit lewat lagu Baru Aku Tahu Cinta Itu. (tribunnews/nva) Dituntut Kembalikan... DARI HALAMAN 1■ SURYA/HAYU YUDHA PRABOWO PORAK PORANDA - Kondisi perkampungan Desa Sitiarjo, Kecamatan Sumbermanjing Wetan, Kabupaten Malang yang porak poranda usai diterjang banjir bandang dengan ketinggian air satu hingga tiga meter, Rabu (10/7). simulator mulai dirakit. Nuryadi ingat, lima teknisi yang didatangkan khusus dari Jakarta, bekerja selama satu minggu untuk merakit tiga simulator R4 sampai bisa dipakai. Sampai perakitan tuntas, tidak satupun personel satpas yang bisa mengoperasikannya. Hingga pada 19 Desember 2011, Bripka Sugondo, anak buah Nuryadi, diutus mengikuti pela- tihan teknis mengoperasionalkan simulator. Pelatihan berlangsung cepat, hanya satu hari. Tiga simulator R4 ditempatkan di ruangan yang bersebelahan dengan ruangan Naryadi. Ruangan tersebut tergolong luas. Selain tiga simulator, terdapat pula deretan kursi yang nanti- nya digunakan pemohon SIM untuk mendengarkan sosialisasi dari polisi. Dua bulan kemudian, lima simulator R2 datang. Prosesnya hampir sama. Simulator datang masih dalam bentuk komponen terpisah. Lima simulator ini di- tempatkan di dua ruangan berbeda. Tiga simulator di satu ruangan dan sisanya di ruangan sebelahnya. Satlantas Polrestabes Suraba- ya kala itu sudah menyiapkan sederet program untuk mensosialisasikan penggunaan simulator ini sebagai bagian dari tahapan uji SIM. Di setiap ruangan, dipasang standing banner dan spanduk. Bunyi spanduk itu, ’Sosialiasi Pemberlakuan Uji Keterampilan Mengemudi Kepada Pemohon SIM A dan C’. ”Barusebatassosialiasikarena kitatidakbisamenggunakannya sebagaialatpenguji.Tapisejauh ini,kamisudahsosialisasike masyarakat,”tegasKepalaUrusan SatpasColomboAKPSiswinto. Kala itu, pemohon bisa me- minta penduan petugas satpas untuk mencoba simulator. Namun itu hanya berlang- sung dua bulan saja. Satu persatu simulator rusak. Mulai dari simulator R4 yang rusak di bagian setir, kemudian disusul simulator R2 yang mengalami kerusakan sama. Kerusakan ini ditengarai lantaran pemohon SIM yang menggunakannya secara kasar. Jumlah pemohon yang ingin mencoba pun menurun sampai akhirnya ruangan simulator ditutup. Simulator lantas hanya menjadi pajangan. ”Memang setirnya kan ringan sekali. Jadi kadang pemohon memutar-mutar setirnya saat mencoba,” ungkap Siswinto. Lama tidak dipakai, ruangan simulasi menjadi kotor dan lebih mirip gudang. Debu tebal melekat di simulator, jendela dan lantai ruangan. Malah, di ruangan yang menyimpan tiga simulator R2, lantainya tergenang air hujan yang menembus atap dan pla- fon ruangan. Warna air mulai menguning dan mengeluarkan bau tidak sedap. Baik Naryadi maupun Siswinto mengakui, tidak ada aktifitas apapun setelah ruangan simulasi ditutup. Apalagi setelah awal 2013 lalu satpas kedatangan tamu istimewa dari KPK. Lima personel KPK datang untuk memeriksa delapan simulator. Kepada petugas KPK, Naryadi menjelaskan detail kondisi simulator. ”Sayakatakanadayangrusak. Sayajugajelaskanmanasajayang rusak.Hanyaitusaja.Cumasehari merekadisini,”ungkapnya. Usai memeriksa setiap komponen simulator, personel KPK menandainya dengan cat semprot warna orange bertuliskan ’Telah Diperiksa KPK’. Praktis, kini simulator itu lebih mirip rongsokan yang disimpan di gudang. (miftah faridl) Simulator Rusak... DARI HALAMAN 1■ seks sejak terbit fajar (Subuh) sampai terbenam matahari (Magrib). Pelaksanaan ibadah puasa al `umum tidak lebih dari sekadar puasa secara fisik dan hanya memenuhi ketentuan fikih saja tanpa ada kebaikan lain yang menjadi penyempurna puasa. Puasa al khusus adalah puasa al `umum yang dilengkapi puasa panca indera dan anggota tubuh lainnya dari perbuatan munkar. Ada lima hal yang harus dilakukan agar seseorang menggapai puasa al khusus. Pertama, puasa penglihatan. Yaitu memelihara pandangan dari sesuatu yang diharamkan dan menyebabkan lalai untuk berdzikir kepada Allah SWT. Kedua, puasa ucapan. Yaitu memelihara lisan dari berkata bohong, gosip dan mengadu domba serta tidak henti hentinya dzikir kepada Allah SWT dan senantiasa membaca Alquran al Karim. Ketiga, puasa pendengaran. Sesuatu yang haram diucapkan pasti haram untuk didengarkan. Tidak boleh seseorang berdiam diri terhadap kebohongan, fitnah dan adu domba yang didengar dari orang lain. Allah SWT berfirman: “Mereka (orang orang Yahudi) itu adalah orang- orang yang suka mendengar berita bohong, banyak memakan yang haram” ( Ma’idah 5:12 ). Keempat, memelihara selu- ruh organ tubuh dari perkara haram. Barang haram sekecil apa pun akan berdampak negatif, sedangkan makanan halal akan berdampak negatif jika terlalu banyak dikonsumsi. Sungguh ironi jika seseorang berpuasa, meninggalkan kon- sumsi barang halal di siang hari sementar berbukanya dengan barang haram. Puasa seperti tersebut bagaikan orang yang membangun gedung tapi me- robohkan istananya. Rasulullah saw. bersabda: “Banyak orang berpuasa tetapi tidak mendapat apapun dari puasanya kecuali ia merasakan lapar dan haus”. HR. Muslim. Kelima, terlalu banyak makan saat berbuka sehingga perutnya penuh, kekenyangan dan sesak. Tidak ada sesuatu yang sangat dibenci oleh Allah melebihi orang yang sangat penuh isi perutnya dengan makanan. Sungguh ironi, jika seseorang berpuasa di siang hari dengan mengosongkan perut guna melemahkan nafsu jahat yang ada pada manusia, akan tetapi saat berbuka ia makan secara berlebihan bahkan sampai terasa sesak kekenyangan. Orangsepertiinitidakada bedanyaantarapuasadantidak berpuasa,karenahanyamenunda waktumakandarisiangharimen- jadimalamhari.Ironi,fenomena orangyangmelakukanibadah puasaRamadanlalumenyediakan menumakananyangtidaklumrah macamdanbanyaknyadibanding sebelasbulanlainnya. DiIndonesiasetiapmenjelang bulanRamadankebutuhanbahan pokokselalumeningkatsehingga menyebabkanhargaharganaik. Seyogianya,hadirnyabulan Ramadanyangmewajibkan umatmuslimberpuasasebulan lamanyadapatmengurangi kebutuhankonsumsiyangsecara otomatisakanmenurunkanharga karenasuplaiyanglebihdan permintaanberkurang.Namun yangterjadimalahsebaliknya. Halinimenunjukkannilainilai spiritualpuasabeluminherendan menginternaldalamkesejatian umatmuslimyangmelakukan ibadahpuasa. Puasakhususalkhususadalah selainmelakukanpuasaumum dankhususjugamemelihara pikirannyadarihalnegatifdan menjagahatinyadarikepentingan duniawidemiselaluingatdan mendekatkandirikepadaAllah SWT.Derajatpuasakhususal khusustelahmenempatkan puasatidaksekedarmengikuti ketentuanfikihtetapitelah menyertakanihsandalamsegala tindakannya,yaituselalumelihat AllahSWTdalamsegarala geraknyaataumerasakehadiran Nyadalamsegalatindakannya. Uraian tentang tingkatan pua- sa yang dipaparkan Imam Al Ghazali tersebut dapat dijadikan barometer umat muslim dalam menggapai puasa yang utama. Puasa yang utama tidak sekadar menempatkan Allah SWT, seba- gai Dzat Yang Maha Kuasa dan Perkasa tetapi juga menempat- kan Allah SWT sebagai Dzat Yang Maha pengasih dan Maha Melihat. (*) Menggapai Puasa... DARI HALAMAN 1■ Sejauh ini, saya dan YLKI memang belum pernah mene- rima keluhan atau pengaduan masyarakat. Tapi saya kira ini bukan pertanda masyarakat bisa menerima. Fakta belum adanya pengaduan ini, saya kira, lebih dikarenakan masyarakat belum mengetahui. Masyarakat belum menerima sosialisasi secara utuh. Maklum sosialisasi pene- rapan baru dilakukan sepotong, sebelum kemudian dihentikan. Tambahan biaya itu mestinya tidak perlu dikenakan. Itu tidak sesuai dengan semangat refor- masi. Termasuk juga semangat reformasi polisi. Lagi pula driving simulator itu dibiayai negara. Tuju- annya untuk memberikan layanan masyarakat yang sebaik-baiknya. Masak sudah dibiayai APBN (Ang- garan Pendapatan dan Belanja Negara), kok masih menarik biaya dari masyarakat. Saya berharap pemerintah merevisi aturan pembiayaan itu. Ke depan, sosialiasi sebaiknya bukan hanya bicara driving simu- latornya. Lebih dari itu polisi se- laku pelaksana harus membuka rencana pungutan biaya ini. Pene- rimaan dari biaya uji simulator ini nominalnya dipastikan tidak sedi- kit. Kalau polri sebagai pengelola uang itu tidak terbuka, masyara- kat akan semakin memandang sinis korp Bhayangkara. Yang paling saya khawatirkan, pemerintah dan kepolisian tetap memaksakan pemberlakukan biaya. Ini bisa terjadi karena umumnya masyarakat tidak biasa melakukan protes secara terbu- ka. Sebab masyarakat memang kerap dihadapkan pada kondi- si, tidak ada pilihan. Satu sisi masyarakat keberatan. Tapi disisi lain masyarakat sangat membu- tuhkan, termasuk SIM karena berkaitan dengan kelancaran kerja dan aktivitas sehari-hari. Masyarakat kalau dikatakan mampu bayar ya pasti mampu. Tidak ada uang tetap diusahakan ada karena memang tidak punya pilihan. Mau tidak mau ya harus ikut aturan. Kalau tidak, mereka berhadapan dengan sanksi, yang itu jauh lebih merepotkan. (idl) Dibiayai APBN... DARI HALAMAN 1■ Seperti dilansir situs Timnas Garuda, Arsenal telah memper- kenalkan jersey away teranyar- nya untuk musim 2013 2014. Jersey kuning biru ini, seperti disebutkan di situs resmi klub, akan digunakan dalam tur pra- musim Asia 2013. Warna kuning dan biru dipa- kai karena merupakan warna tradisional jersey tandang Arse- nal dan dianggap akan menarik para penggemar baru. Kerah mengambil fitur kaus polo, di- nilai pas untuk menggambarkan gaya terbaik kota London. Tiap seragam yang dibuat oleh perusahaan apparel Nike ini dibuat menggunakan hasil daur ulang 13 botol plastik menggunakan teknologi Dri- FIT agar pemain tetap nyaman sekaligus keringat terserap. “Seragam ini tampak dan terasa luar biasa. Arsenal FC dis- inonimkan dengan kuning dan biru dan saya pikir desain baru ini memadukan tradisi itu de- ngan sentuhan modern. Saya tak sabar untuk turun ke lapangan dan memakainya!” kata bintang Arsenal Theo Walcott mengo- mentari seragam barunya. Indonesiaakanmenjadinegara pertama yang bisa menyaksikan langsung seragam baru ini ka- rena menjadi destinasi pertama tur Asia The Gunners sebelum Vietnam dan Jepang. Selama di Tanah Air, mereka tidak hanya menggelar laga eksebisi mela- wan Indonesia Dream Team, tim asuhan Arsene Wenger itu juga akan menggelar beberapa kegi- atan seperti klinik kepelatihan singkat. Sesuai jadwal awal yang diri- lis pihak promotor, Arsenal akan sampai di Jakarta pada Jumat (12/7) besok, di Bandara Halim Perdana Kusuma, Jakarta Timur. Mereka dijadwalkan mendarat pada pukul 15.00 WIB. Begitu tiba, The Gunners langsung menggelar konfe- rensi pers kedatangan yang menghadirkan Manajer Arse- ne Wenger dengan dua per- wakilan pemain. Esoknya, agenda lebih padat akan menyergap Alex Oxlade Chamberlain cs. Me- reka dijadwalkan menggelar klinik kepelatihan pada sore hari, sebelum menjalani sesi latihan terbuka di Stadion Utama Gelora Bung Karno pada malamnya. Adapun tiket pertandingan Arsenal melawan Indonesia Dream Team telah dilepas ke pasaran sejak beberapa hari lalu dengan harga berbeda, mulai Rp 100.000 hingga Rp 750.000. Pembelian, antara lain dapat dilakukan melalui situs, kiostix. com, atau Ibu Dibyo. Boaz Absen Sayang, dalam laga langka ini, Kapten Timnas Indonesia, Boaz Solossa, terancam absen. Striker asal klub Persipura Jayapura itu belum pulih dari cedera yang didapatnya di laga Liga Super Indonesia menghadapi Persiram Raja Ampat, Minggu (7/7). “Sampai saat ini saya belum tahu persis soal perkembangan cederanya. Saya belum bicara lagi dengan dokter. Tapi saya tetap menyertakannya ke dalam skuad untuk menghadapi Arse- nal,” kata pelatih timnas senior, Jacksen Ferreira Tiago, kemarin. Timnas akan turun dengan nama “Indonesia Dream Team” ketika menghadapi Arsenal. Sebanyak 24 pemain yang disiapkan, termasuk Boaz dan beberapa pemain baru, seperti Rizky Pellu asal Pelita Bandung Raya, dan Rizky Ripora asal Barito Putra “Tapi kalau pun Boaz nanti tidak bermain, saya tidak risau. Masih banyak pemain berti- pikal serupa yang kualitasnya tidak kalah dari Boaz, seperti Titus Bonai, Stefanno Lilipaly, atau Ian Louis Kabes. Yang je- las, sekarang saya menunggu kondisi dan situasi Boaz ter- akhir,” ungkap pelatih asal Bra- sil itu. ( Arsenal Pamer... DARI HALAMAN 1■ Jasad Nenek... DARI HALAMAN 1■ syukur. Ia merasa beruntung ka- renasimulatorbelumditerapkan saat ia mengurus SIM kemarin. Selain beban biaya, pengguna- kan simulator dipastikan akan menambah beban pikiran. Pro- ses ujian akan jadi lebih banyak, lebih rumit, dan yang pasti lebih melelahkan. Apalagi, pemakai- an simulator juga tidak lebih mudah dibanding ujian praktek. Padahal ujian praktek selama ini masih menjadi momok. Banyak pemohon yang harus meng- ulang-ngulang ujian, baru bisa mendapatkan SIM. Kalau saja tidak muncul kasus korupsi Djoko Susilo Cs, penggu- naan simulator itu hampir dipas- tikan sudah diterapkan Juli atau Agustus2013yanglalu.Simulator itu sudah dimasukkan menjadi materi wajib ujian. Itu termuat da- lam Peraturan Kepala Kepolisian Republik Indonesia (Perkap) No- mor 9 tahun 2012 tentang Surat Izin Mengemudi (SIM). PasalPasal53ayat1(b)Perkap Nomor 9/2012 menyebutkan uji keterampilan mengemudi terdi- ri tiga materi. Tes tulis (teori), uji mengendarai simulator, dan tes praktek. ”Materi simulator memang menjadi tahapan uji. Jadi kalau lu- lus simulator, baru bisa ke tahap uji selanjutnya (praktek),” terang Paur SIMSatpasColomboAKPSiswinto ditemuiSuryaawalpekanini. Uji simulator ini cukup mulya, Menmguji kelayakan personal calon pengemudi, yang selama ini tidak masuk pemeriksaan. Mulai dari reaksi pengemudi ter- hadap berbagai kondisi di jalan. Lalu pertimbangan perkiraan dan antisipasi terhadap berbagai kondisi. Juga melihat sikap me- ngemudi. Satu lagi yang dinilai adalah tingkat konsentrasi saat mengemudi. Semua kemampuan ini sangat dibutuhkan seorang pengemudi. Intinya, jika mesin ini jika diterapkan benar-benar, hampir dipastikan pemegang SIM pastilah pengemudi yang memang memiliki kemahiran dan sikap baik dalam berlalu lintas. Target akhirnya, tertib lalu lintas meningkat dan kecelakaan bisa diminimalisir. Diteken Presiden Soal tambahan biaya, kepolisian tidak bisa disalahkan. Beban Rp 50 ribu itu bukan polisi yang memun- culkan. Angka itu sudah muncul dua tahun sebelum Kapolri me- ngeluarkan Perkap Nomor 9/2012. Tepatnya tahun 2010. Ketika itu, si- mulator masih digodok di Mabes Polri. Angka Rp 50 ribu ditetap- kan pemerintah melalui Peraturan Pemerintah (PP). Peraturan yang ditandatangani Presiden Susilo Bambang Yudhoyono itu tentang jenisdantarifatasjenispendapatan negarabukanpajak(PNBP). “Jadi biaya yang ditarik itu masuk sebagai Pendapatan Ne- gara Bukan Pajak (PNBK),” te- gasAKP Siswanto. Jadi, kata dia, biaya untuk uji simulator itu di- tetapkan sama di seluruh satpas di Indonesia. Penerapan simulator dipasti- kan juga akan menambah pan- jang antrean pengajuan SIM. Uji mengendarai simulator, seorang pemohon harus menghabiskan 15 sampai 20 menit. Itu belum termasuk waktu yang dimakan oleh antrean membludak. Saat ini Satpas Colombo Su- rabaya mematok target layanan 60 menit untuk pemohon A dan C. Rinciannya, uji teori 20 menit, uji praktik 20 menit, pembayaran bank, isi formulir, registrasi dan foto masing-masing 5 menit. Ten- tu saja pada praktiknya pemohon tidaklangsungmendapatkanSIM dalam waktu 60 menit. Bila simu- lator diterapkan, berarti target waktu itu harus ditambah 20 me- nit, sehingga menjadi 80 menit. Plafon waktu itu bisa saja ber- tambah lama. Pasalnya, pemohon SIMbarudiSatpasColombocukup banyak. Dalam sehari, satpas mela- yanilebihdari200pemohon. Pantauan Surya, para pemo- hon yang memasukkan data ad- minstrasinya sekitar pukul 09.00 WIB, paling cepat bisa menda- patkan SIM pada sore harinya. Kalau simulator diterapkan, bisa saja sampai petang baru kelar. Bukan hanya lamanya waktu yang akan bikin pemohon SIM ketir-ketir. Sulitnya melampui ujian itu akan menjadi tantangan tersendiri. Dalam sosialisasi dan uji coba yang dilakukan polisi di Colombo, para polisi sendiri 50 persen lebih yang tidak bisa me- menuhi standar nilai kecakapan yang dipatok. (idl/ian) join follow @portalsurya
  • 8. tulungagung, surya - Gara-gara majelis hakim me- nunda agenda sidang, seorang tahanan mengamuk dan meru- sak jeruji besi ruang bui di Peng- adilan Negeri Tulungagung, Rabu (10/7). Ibrahim alias Budheng (32), tahanan perkara senjata tajam asal Kalidawir itu bahkan melu- kai seorang polisi yang berjaga. Budheng baru reda emosinya setelah diredam oleh seorang pengunjung sidang. Meski aksi Budheng mengaki- batkan pintu besi rusak, tidak ada tahananlainyangmemanfaatkan- nya untuk kabur. Namun, para pengawal tahanan dari Kejaksa- an Negeri terpaksa membawa lagi semua tahanan ke Lembaga Pemasyarakatan. Semua tahanan pun urung disidang. Usai mengamuk, Budheng mengaku jengkel terhadap jak- sa maupun hakim yang telah menunda sidangnya. Dia meng- anggap, sidang perkaranya bisa dilakukan. "Kasus saya karena senjata tajam, masalahnya kenapa sidangnya ditunda, buang-bu- ang waktu saja," kata Budheng seperti ditirukan seorang saksi dari sesama tahanan. Terpisah, Kepala Seksi Pidana Umum Kejaksaan Negeri, Dwi Setyo, berjanji memeriksa anak buahnya terkait masalah ini. "Saya akan periksa jaksa yang bertugas, dan saya berjanji sege- ra menyidangkan perkara ini," katanya. Menurut dia, sebenarnya agenda sidangnya adalah pemeriksaan saksi, dan men- datangkan 2 saksi korban. Se- orang di antaranya memutus- kan tidak datang karena takut bersaksi setelah terjadi insiden tersebut. Itu sebabnya, jaksa pun menunda persidangan. "Kami akan coba bujuk saksi untuk bersedia datang pada si- dang berikutnya," janjinya. Sementara,KepalaPolresAKBP Whisnu Hermawan Februanto melalui Wakil Kepala Polres Kompol Indra Lutrianto membe- narkan, anggotanya jadi sasaran emosi tahanan hingga menderita luka pada pelipis kanan. Anggota Polri bernama Aip- tu Badrun itu dijahit 4 jahitan pada lukanya. Kini, dia masih menjalani perawatan di RS Bhayangkara. Dijelaskan, Aiptu Badrun sebe- narnya terkena benturan pintu besi yang dirusakBudheng.(yul) Tahanan Rusak Jeruji Besi dan Lukai Polisi Jaringan Ekstasi Lapas Mulai Sentuh Apartemen surabaya, surya - Aparte- men makin kerap dijadikan ba- gian peredaran narkotika. Unit Idik I Satreskoba Polrestabes Su- rabaya menangkap Steven (24), warga Embong Malang Suraba- ya, ketika baru mengambil paket narkoba di sebuah apartemen di Surabaya Barat. Dalam penangkapan Minggu (7/7) itu, polisi menyita 10 butir pil ektasi berlogo hati seberat 2,7 gram dan tujuh butir pil warna cokelat susu berlogo OO, sebe- rat 1,89 gram. “Tersangka kami tangkap di lobi apartemen saat hendak mengambil barang,” kata Kanit Idik I AKP Haryoko, Rabu (10/7). Dalam penyidikan, Steven mengaku mengambil paket itu atas perintah seseorang yang tidak dia tahu identitasnya. Ia hanya tahu, orang itu berada di Lapas Pamekasan. “Masih kami kembangkan, karena tersang- ka mendapat barang tersebut dengan sistem ranjau,” kata Haryoko. Sebelumnya, polisi menang- kap Daniel (23), warga Candi, Sidoarjo yang mengaku mem- beli ekstasi pada seorang napi Lapas Pamekasan. Dari Daniel, polisi menyita 13 butir ekstasi dan mendapatkan nama Steven. “Barang dari Daniel adalah pil kiriman ketiga. Pada kiriman pertama Daniel memesan 50 bu- tir dan kiriman kedua 100 butir,” tambah Leo. Satreskoba juga menangkap tersangka lainnya yang terlibat dalam jaringan LP. “Mereka jaringan Lapas Madiun,” kata Wakasat Narkoba Polrestabes Surabaya Kompol Leonard Si- nambela. Tiga di antaranya adalah Yati (25), Ismono (42), dan Amir (25) merupakan tersangka yang terkait peredaran narkoba di Lapas Madiun. Pertama, polisi menangkap Yati ditangkap di Jalan Klakah Rejo dan menyita 0,3 gram sabu-sabu. Dalam interogasi, Yati menyebut nama Ismono yang ketika ditangkap juga mempunyai buti 0,3 gram sabu-sabu. Darikeduaorangini,polisike- mudian menangkap Amir yang membawa 10,7 gram sabu-sabu yang diakuinya berasal dari La- pas Madiun. “Sabu-sabu dari LP itu diranjau di daerah Pasuruan. Satu kali transaksi bisa menca- pai 15 gram sabu-sabu,” ujar Leo. (ook) Menangis Saat Pacar Salat winda viska W inda Viska (29) terharu saat menyaksikan kekasihnya, Mulyadi Tan, menjadi mualaf, 8 Juli 2013 di masjid kawasan Pondok Indah, Jakarta Selatan. Keinginan kekasih memeluk Islam di bulan Ramadan, diakui Winda sangat kuat. “Cowok aku jadi mualaf, baru dua hari lalu. Yang jelas, dia dapat hidayah. Karena hidayah itu bisa datang kapan saja. Belum tentu juga kita yang dari kecil Islam bisa dapat hidayah,” tutur Winda yang ditemui di sela-sela syuting Sahurnya OVJ, di Gedung Trans TV, Jakarta Selatan, Rabu (10/7) dini hari. Sebelum mualaf, keingintahuan Mulyadi sangat besar terkait agama Islam. Bahkan, tak jarang ia berinisiatif mencari tahu sendiri, baru dikonsultasi- kan pada Winda atau guru mengajinya. Saat akan berangkat ke masjid untuk diislamkan, Winda sengaja datang telat. Winda hanya ingin memastikan kekasihnya benar-benar ingin menjadi seorang muslim. “Aku minta dia untuk terakhir kalinya meyakin- kan diri, dia benar atau enggak mau jadi mualaf. Ternyata, dia sudah menemukan kedamaian (setelah menjadi mualaf). Aku sempat nangis lihat dia salat dua rakaat habis jadi mualaf, dia nanya di mana kiblatnya,” ucap Winda berkaca-kaca.(tribu- nnews/nva) Instruksi dari Napi Lapas Pamekasan■ HALAMAN  | KAMIS, 11 JULI 2013 jakarta, surya - Baru hari pertama Ramadan, acara hibur- an lawakan yang ditayangkan televisi saat sahur, Rabu (10/7) dinihari, memantik kecaman para ulama dan pengawas siara televisi Pemimpin Pondok Pesan- tren Asshiddiqiyah Dr KH Noer Muhammad Iskandar SQ menilai tayangan lawakan bertentangan etika dan vulgar. Iskandar mengaku diprotes ke- luarganya yang nonton televisi usai sahur. Kata Iskandar, dalam tayang- an itu, seorang pembawa acara bertingkah konyol dengan cara mencandai rekannya yang wanita tanpa merasa bersalah. “Pelawak ini bergandengan tangan dengan orang yang bukan muhrimnya dan ditayangkan ketika orang sedang sahur,” tegas Iskandar di Jakarta,Rabu(10/7). Menurut sang ulama, tidak sepantasnya televisi membuat program yang malah berten- tangan nilai-nilai Ramadan. “Televisi jangan merusak sua- sana Bulan Suci Ramadan. Se- baliknya, mendukung tercipta- nya kegiatan yang mendorong praktik beribadah,” tandasnya. Sebagai bentuk tanggung- jawab kepada bangsa, Ketua MUI, KH Maruf Amin minta semua tayangan program Ra- madan, sesuai nilai akhlakul kharimah sehingga tercipta situasi Ramadan yang khu- syuk dan khidmat. “MUI ber- harap media tak menyiarkan tayangan bermuatan ramalan, kekerasan, lawakan berlebihan, serta cara berpakaian tak sesuai akhlakul kharimah,” tegasnya. KomisionerKomisiPenyiaran Indonesia (KPI), Azimah Suba- gijo tak kalah tajam mengkritik stasiun televisi yang menyiar- kan tayangan tak mendidik saat Ramadan. “Tidak sepantasnya program tayangan membawa simbol simbol agama, lalu jadi lelucon,” tegasnya. Menurut Azimah, jika sang produser kreatif, lawakan yang disajikan tetap sehat. ‘’KPI berharap tayangan tayangan televisi bisa membawa spiritual Ramadan. Bukan acara acara yang memperdengarkan kata kata pornografi,” tuturnya. Sebelum Ramadan, KPI telah memantau seluruh tayangan televisi dan radio di Indonesia dan minta sajian acara spiritual Ramadan yang bermutu. Tetapi ketika dievaluasi hingga Rabu, KPI masih menemukan banyak tayangan kurang pantas.Misal- nya, banyak tayangan bermate- ri keagamaan, tapi tak dipandu ahlinya. Menurut Anggota KPI, Nina Armando, lembaganya kini fokus memantau tayangan ko- medi nakal, terutama saat sa- hur dan berbuka puasa. Tahun lalu, KPI menemukan banyak pelanggaran, seperti pelecehan individu dan pelanggaran hak perlindungan anak. “Tahun lalu, KPI menjatuhkan sanksi pada tujuh program di tujuh stasiun televisi,” tutur Nina. Ia pun memperingatkan sta- siun-stasiun televisi tak meng- ulanginya. “Jika tetap melanggar dan pelanggarannya berat, maka sanksinya bisa pemotongan du- rasi hingga penghentian prog- ram,” tandas Nina. Pembina Masyarakat TV Sehat, Fahira Idris memang menginginkan adanya toleran- si yang ditunjukkan lembaga lembaga penyiaran Indonesia saat Ramadan. Dia mengata- kan, toleransi itu dalam bentuk keseimbangan porsi antara lawakan dan ibadah. “Misalnya, dulu lawakan 90 persen, ibadahnya 10 persen, maka saat Ramadan unsur ibadahnya jadi 60 persen dan lawakan 40 persen saja,’’ ujar Fahira yang juga minta orang- tua ikut menyaring tontonan anak-anaknya.(tribunnews/ zul/ant/rol) Ulama Kecam Lawakan Sahur ANTARA /Rahmad TARAWIH DI TENDA - Sejumlah umat muslim korban gempa Aceh terpaksa melaksanakan ibadah salat Tarawih Ramadan pertama dilaksanakan di dalam tenda darurat di lokasi pengungsian Kute Glime, Kecamatan Ketol, Aceh Tengah, Selasa (9/7).  banda aceh, surya - Korban gempa Kabupaten Aceh Tengah menunaikan salat Tarawih hari pertama bulan suci Ramadan, Selasa (9/7), di lokasi pengungsian dengan menggu- nakan tenda, karena masjid dan meunasah di daerah itu sudah rusak berat. Meskipun dalam suasana seadanya, umat Islam yang menjadi korban gempa tetap melaksanakan salat Tarawih dengan khusuk dan hikmat di tenda-tenda yang disediakan di lokasi pengungsian. Dilaporkan, puluhan warga memenuhi tenda besar yang memabg disediakan di lokasi pengungsian Desa Gute Gelime, Kecamatan Ketol, untuk me- nunaikan salat Tarawih. Untuk memperlancar ibadah selama bulan suci Ramadhan, pemerin- tah memberi bantuan 50 tenda besar untuk kegiatan shalat Tarawih. Kepala Badan Nasional Pe- nanggulangan Bencana Syam- sul Ma’arif menyatakan, pe- merintah sudah menyalurkan 50 tenda yang disebarkan ke Aceh Tengah 40 lembar dan si- sanya untuk Kabupaten Bener Meriah Bertindak sebagi imam adalah Tgk Amami yang juga imam masjid di daerah itu. Warga mus- lim dan muslimah tetap khusuk menunaikkan shalat Tawarih 11 rakaat termasuk witir. Sebelum salat, Imam Amami minta warga menjadikan musi- bah itu sebagai pelajaran dan introspeksi diri, sehingga umat Islam tetap diberi kekuatan dan ketakwaan kepada Allah SWT. Dikatakan, Amami, sebenar- nya Allah SWT masih sayang kepada warga di daerah ini, karena masih setingkat rumah yang menjadi rusak, sedangkan jiwa dan raga masih sehat bu- gar. “Coba, andaikan Allah men- coba musibah pada malam hari, mungkin akan banyak lagi kor- ban, karena warga masih tidur semua,” katanya Pada musibah gempa berke- kuatan 6,2 skala Richer, Selasa (2/7), Kabupaten Aceh Tengah merupakan daerah terparah, sehingga seluruh sarana iba- dah rusak berat. Menurut data terakhir, jumlah korban tewas dalam gempa kali ini adalah 39 orang. Sementara, enam orang lain belum ditemukan. (ant) Tarawih Pertama Korban Gempa di Tenda KPI Ancam Hentikan Program Konyol■ KH Noer Muhammad Iskandar SQ mengaku diprotes anaknya yang menyaksikan acara tak pantas usai sahur. Hasil evaluasi KPI, hari pertama puasa sudah ditemukan banyak siaran yang tidak pantas. ■ ■ storyhighlights jakarta, surya - PT TC Indonesia telah mempersiapkan dana investasi khusus untuk memperkuat penetrasi pasar. Beberapa daerah menjadi incaran pembukaan kantor cabang untuk mela- yani 3S (Service, Sales, Sparepart). "Kami siapkan 40 juta dolar AS sampai 50 juta dolar AS untuk membangun ca- bangbaru,termasukrenovasidanrelokasi cabang di Jatim," tutur President Director PT Motor Image Indonesia, Glenn Tan di sela peresmian headquarters Subaru di Pondok Indah Jakarta, Rabu (10/7). Pembukaan cabang dan sejumlah ren- cana bisnis itu membuktikan keseriusan Subaru terjun di pasar otomotif Indonesia dalam jangka panjang. Apalagi, produk SUV,ForesterdanXVcukupdiminatipasar. Tahun ini, Subaru menargetkan bisa menjual 2.500 unit. "Di semester perta- ma tahun ini memang kurang meng- gembirakan, penjualan kami masih 600 unit. Tapi kami yakin mencapai target," papar Glenn Tan. Untuk itulah, selain menyediakan dana khusus untuk investasi, Subaru menyediakan anggaran khusus publika- si kurang lebih 10 juta dolar guna mem- bangun citra. Lewat penambahan dan penyegaran cabang, Subaru berharap dapat meningkatkan penjualan. Glenn Tan juga menyatakan, dalam waktu dekat, akan meresmikan cabang di Malang dan ekspansi di Jatim dengan merelokasi Cabang Surabaya. Deputy General Manager Subaru, Sut- risno Lesmono menambahkan, untuk Cabang Malang lebih cepat diresmikan karena hanya perlu merenovasi semen- tara cabang di Surabaya membutuhkan waktu karena harus membeli lahan sen- diri. (rey) Subaru Incar Malang dan Surabaya KARACHI - Sebuah bom meledak di Karachi, Pakistan, Rabu (10/7). Bom itu menewaskan pengawal pribadi Presiden Pakis- tan Asif Ali Zardari dan dua orang lainnya yang sedang berada di dekat markas partai Zardari, Partai Rakyat Pakistan, yang memerintah provinsi Sindh. (ap) Pengawal Presiden Pakistan Tewas Dibom TRIBUN JAKARTA/JEPRIMA SURYA/YUL NGAMUK - Ibrahim alias Budheng (38), warga Kalidawir, Tulungagung saat diperiksa di Polres Tulungagung, Selasa (10/7) kembali membu- at onar di PN Tulungagung. join follow @portalsurya
  • 9. | S EPERTI terlihat di Jalan Tembok Gede dan Tembok Lor, orang berdesak-de- sakan membeli beragam menu takjil yang dijajakan. Mungkin bagi orang awam, menemukan penjual menu takjil di sana tak mudah. Lokasinya berada di kawasan Blauran. Jalan Tembok Gede berada di salah satu gang di kawasan itu. Ketika masuk ke dalam gang, aktivitas di sana biasa saja. Namun setelah masuk lebih jauh lagi, di jalan kampung yang sempit, penjual takjil bertebaran. Masuk pukul 16.00, warga di sana berduyun-duyun membeli PROSES pemeriksaan Kevin Stefano oleh Komisi Yusidial (KY) hanya sebatas pengum- pulan data. Pada kesempatan itu, selain diberi 10 pertanyaan, Kevin juga menyerahkan berkas vonis dari Pengadilan Negeri (PN) dan undangan pemeriksaan sebagai tambahan bukti. Ditemui usai diperiksa KY, Kevin menuturkan bahwa dia hanya diperiksa sebagai korban dugaan suap itu. Makanya, pe- meriksaan KY itu hanya seputar kronologis kejadian ketika diri- nya diduga diperas hakim. "Ada 10 pertanyaan yang diajukan pada saya," jelasnya usai menjalani pemeriksaan di Hotel Bumi, Surabaya, Rabu (10/7). Diungkapkan, pemeriksaan Dua Jam KY Periksa KevinTerkait Dugaan Suap Hakim dan Jaksa Tanpa Dikawal Oleh Teman-temannya ■ ■ SURABAYA, SURYA - Kasus du- gaan suap yang melibatkan Kevin Stefano terhadap hakim dan jaksa menarik perhatian Komisi Yudisial (KY) untuk menanganinya. Ini ter- lihat dengan kedatangan anggota KY ke Surabaya dan memeriksa Kevin. Pemeriksaan dilakukan di Hotel Bumi Surabaya. Kevin yang juga anak dari anggota DPRD Suraba- ya, Baktiono, datang tanpa dika- wal teman-temannya. Kemudian, sekitar pukul 09.30, dia naik ke lan- tai sembilan dan bertemu dengan anggota KY. Proses pemeriksaan itu berjalan lebih dari dua jam, dan berakhir sekitar pukul 12.00. Begitu pemeriksaan tuntas, sa- lah seorang anggota KY, Kol Purn Sarman Mulyana, menjelaskan bahwa pihaknya bersama dua staf KY lainnya baru sebatas menggali informasi dari keterangan Kevin. "Kami sudah mengumpulkan informasi dari Kevin. Ini sema- cam investigasi awal, atau kalau di polisi istilahnya penyelidikan," paparnya saat ditemui di Hotel Bumi, Rabu (10/7). Dijelaskan, untuk saat ini pihak- nya hanya sebatas mengumpul- kan keterangan terkait sejauhma- na keterbuktian pelanggaran yang dilakukan hakim Heru Mustofa. Kemudian, dari keterangan Kevin itu, pihaknya akan membawa data itu ke Jakarta. "Dari situ akan dianalisis sejauh- mana pelanggaran hakim Heru Mustofa," katanya. Ketika disinggung tentang hasil penyelidikan KY, pihaknya belum bisa memastikan. Pasalnya, setelah KE HALAMAN 15■ SURYA/SUDHARMA ADI MENGAIS REZEKI - Berbagai menu takjil dijajakan penjual di daerah Tembok Lor dan Tembok Gede menjelang buka puasa, Rabu (10/7). Bulan puasa atau Ramadan, tak hanya menjadi bulan penuh rahmat bagi umat muslim untuk mendapatkan ampunan. Bulan itu juga menjadi berkah bagi penjual makanan dan minuman yang menjajakan menu takjil untuk berbuka puasa. Berkah Penjual Takjil Tembok Gede Jualan Kue Ludes Dalam Setengah Jam SURYA/HABIBUR ROHMAN AKSI SPIDERMAN - Ini salah satu cara yang dilakukan petugas pembersih kaca gedung untuk menghibur tamu-tamunya di Hotel The Alana Jalan Ketintang Surabaya, Rabu (10/7). Petugas tampak sigap dalam membersihkan dan merawat kaca bangunan hotel itu. Selain menghibur aksi Spiderman ini juga menjadi tontonan menarik bagi warga di sekitarnya. Sapu Angin Surya Berlaga di Australia SURABAYA, SURYA - Mobil bertenaga surya yang dirancang mahasiswa Teknik Mesin ITS dengan nama Sapu Angin Surya siap berlaga pada World Solar Challenge 2013 di Australia pada 6-13 Oktober 2013 "Mobil Sapu Angin Surya itu sedang menja- lani proses fabrikasi, tinggal proses rakit saja. Insya-Allah, mobil itu akan kami luncurkan pada 17 Agustus (Hari Kemerdekaan RI)," kata Manajer ITS Solar Car Racing Team, Agus Mukhlisin, Rabu (10/7). Didampingi dosen Teknik Mesin ITS selaku pembimbing, Muhammad Nur Yuniarto, ia menjelaskan pihaknya menargetkan masuk 10 besar dalam lomba mobil surya tingkat dunia yang pertama kali diikuti tim ITS itu. "Bahkan, ITS menjadi satu-satunya wakil In- donesia dalam lomba mobil surya yang tahun Seniman Serba Bisa RISQI KAMILA K ETIKA mendaftar untuk bergabung sebagai tenta- ra, Sersan Kepala (Serka) (Mus/W) Risqi Kamila, tahunya adalah menjadi tentara Korps Wanita Angkatan Laut (Kowal). “Tahunya adalaah tentara yang gagah dan tugasnya adalaah pe- rang. Mempertahankan dan men- jaga kedaulatan Negara Kesatuan Republik Indonesia (NKRI),” kata Serka Risqi ketika ditemui di sela upacara penerimaan mahasiswa angkatan 34 Sekolah Tinggi Teknik Angkatan Laut (STTAL) di komplek Komando Pengembangan dan Pendidikan Angkatan Laut (Kobangdikal), beberapa waktu yang lalu. Tapi begitu lolos sebagai Ko- wal, ternyata wanita kelahiran Indramayu ini malah mendapat tugas yang jauh dari bayang- annya untuk terjun di medan perang. Tapi malah mendapat tugas di kesatuan musik. Kesatuan musik ini merupakan tentara yang tugasnya di bidang musik. Jadilah tugas sehari-hari Serka Risqi ada di bidang ini. Mulai berlatih menyanyi, main peralatan musik, baik secara solo, maupun bersama grup. “Beda jauh kan. Tapi tetap ada kejasmanian yang membuat kami tetap latihan fisik sebagai 1.150 Guru Madin Terima Beasiswa S1 SURABAYA, SURYA - Se- banyak 1.150 guru madrasah diniyah (madin) di Jatim akan mendapatkan beasiswa kuliah S1 di pergurun tinggi. Kepastian itu setelah ada penandatangan nota kesepahaman (MoU) an- tara Pemprov Jatim dengan 34 Perguruan Tinggi Agama Islam (PTAI) di Kantor Gubernur Ja- tim, Rabu (10/7) siang. MoU ditandatangani Guber- nur Soekarwo dengan Koordi- nator Kopertais Jatim, Prof Dr Abdul A’la dan Rektor STAIN Jember, Prof Dr Babun Suharto. Program ini sudah berlangsung sejak 2006 lalu dan berhasil me- nguliahkan 6.000 guru madin. Dari jumlah itu, yang sudah lu- lus 3.500 orang. Pakde Karwo mengatakan, pemberian beasiswa kuliah S1 bagi guru madin merupakan upaya meningkatkan kualitas pendidikan diniyah dan pendi- dikan Islam di Jatim. Pendidik- an agama dinilai penting, kare- na akan jadi basis moral, etika, dan spiritual bagi masyarakat. “Jika basis itu tak dimiliki, maka pertumbuhan ekonomi Jatim tertinggi se-Jawa dan Su- matera tak akan ada gunanya,” tegasnya. Menurut Pakde, pendidikan harus direkonstruksi agar bang- sa ini dapat bertarung di tingkat ASEAN menyusul akan diber- lakukannya AFTA mulai 2015. Nah, saat itulah persaingan bi- dang pendidikan dan jasa akan jadi sangat terbuka antarnegara SURYA/SUDHARMA ADI DUGAAN SUAP - Anggota KY, Sarman Mulyana (kiri), usai memeriksa Kevin Stefano (kanan) di Hotel Bumi, Surabaya, Rabu (10/7). Perluas Kandang Satwa hingga Area Parkir SURABAYA, SURYA - Wali Kota Surabaya, Tri Rismaharini, memerintahkan pelaksana tugas Asisten II, M Taswin, untuk se- cepatnya mengelar koordinasi penyerahan Kebun Binatang Su- rabaya (KBS). Ini setelah Kemen- terian Kehutanan telah memberi persetujuan kepada Perusahaan Daerah Taman Satwa KBS atau PD TSKBS untuk mengelolanya. "Kami berharap besok Pak Taswin sebagai Plt Asisten II su- dah rapat koordinasi proses pe- nyerahan KBS dengan Kemen- hut," kata Risma, Rabu (10/7). Dijelaskan Risma, pihaknya menginginkan setelah KBS dike- lola BUMD, pemkot akan segera melakukan penataan. Baik itu penataan area KBS menjadi le- bih baik dan memenuhi standar konservasi, maupun penataan manajemen pengelolaan KBS. Dengan demikian KBS nantinya bisa menjadi lebih baik dari se- belumnya. Termasuk kondisi kesejahteraan bagi satwa koleksi bisa terjamin semuanya dengan menerapkan sistem perlaku- an alami. "Keinginan itu kami harapkan bisa diwujudkan di KBS," ucap Risma. Selain itu, menurut Risma, pihaknya juga menginginkan adanya perluasan KBS dengan memanfaatkan area parkir un- tuk penambahan kandang sat- wa. Nantinya perluasan kan- dang tersebut untuk semua jenis ayam dan fasilitas lain, KY memeriksa Kevin Stefano di lantai sembilan Hotel Bumi Surabaya selama dua jam KY hanya sebatas mengumpulkan keterangan dan data akan dibawa ke Jakarta Hasil pemeriksaan terhadap Kevin diplenokan oleh anggota komisioner KY Kasus suap muncul berawal dari kasus kecelakaan yang menimpa Kevin Stefano ■ ■ ■ ■ STORYHIGHLIGHTS HALAMAN 9 | | KAMIS, 11 JULI 2013 HIDUNG TERSUMBAT JADI PLONG Nama Ayam Bakar Wong Solo tentu sudah tak asing. Rasanya yang khas membuat paket menu ayam ini disuka pehobi kuliner. Namun, bagi yang ingin menikmati menu lain tidak usah khawatir. Ayam Bakar Wong Solo menyiap- kan beragam menu pilihan. BACA HALAMAN 11 Tunjungan Life Serahkan Berkas Vonis ANTARA SIAP BERLAGA - Personel ITS Solar Car Racing Team menunjukkan replika mobil Sapu Angin Surya yang merupakan hasil rancangannya, di kampus setempat, Rabu (10/7 KE HALAMAN 15■ KE HALAMAN 15■ KE HALAMAN 15■KE HALAMAN 15■ KE HALAMAN 15■ SURYA/HABIBUR ROHMAN Ini salah satu cara yang dilakukan petugas pembersih kaca gedung untuk menghibur tamu-tamunya di Hotel The Alana Jalan Ketintang Surabaya, Rabu (10/7). Petugas tampak sigap dalam membersihkan dan merawat kaca bangunan hotel itu. Selain menghibur aksi Spiderman ini juga menjadi KE HALAMAN 15■ SURYA/SRI HANDI LESTARI join follow @portalsurya
  • 10. | SURABAYALINES| KAMIS, 11 JULI 2013 data dari Kevin diolah di Jakarta, maka ini juga akan diplenokan oleh komisioner KY. "Memang perlu waktu untuk menganalisis keterangan saksi," tuturnya. Apakahadarencanauntukmemanggilha- kim Heru Mustofa? Ia hanya berujar bahwa itu semua tergantung hasil pengolahan kete- rangan saksi. Yang pasti, pihaknya hanya se- batas pengumpulan informasi saja. Seperti diketahui, munculnya dugaan suap berawal dari kasus kecelakaan yang menimpa Kevin. Namun, berkas kecelaka- an yang terjadi Juni 2012 itu ternyata baru masuk Kejari Surabaya pada 2013. Saat itu, tanpa pengacara, dia menjalani proses pe- limpahan tahap kedua. "Saya bertemu dengan jaksa, Ibu Suci Anggraeni," kata Kevin waktu itu. Dari situ, transaksi pertama terjadi. Me- reka membicarakan cara agar hukuman yang menimpa dirinya bisa diringankan. Mereka pun sepakat dan Kevin membe- rikan uang Rp 3 juta. Jaksa pun berjanji memberikan tuntutan percobaan. Setelah itu, sidang pun berlanjut hing- ga tuntutan. Sebelum tuntutan dibacakan, Jaksa Suci mengatakan kalau sulit dituntut percobaan karena pasal yang didakwakan ancaman hukuman maksimal 5 tahun pen- jara. Kesepakatan kembali terjadi, di mana Kevin dituntut 8 bulan penjara setahun percobaan plus denda Rp 1 juta. LalusaatsidangputusanRabu(3/4),per- kara ini ditunda. Saat itu, dia menyerahkan uang kedua kali ke Jaksa Suci Rp 3 juta di Kejari Surabaya, sekitar pukul 08.00. Kemudian setelah sidang tunda itu, ha- kim Heru Mustofa mengajak dirinya ke ruang hakim dan meminta sejumlah uang. Lalu, sidang Rabu (10/4), Kevin ditemani beberapa teman kuliahnya menerima vo- nis dari majelis hakim. Dia divonis bersa- lah dan dihukum 6 bulan penjara percoba- an 10 bulan plus denda Rp 500.000. (sda) 2013 diikuti 47 tim dari 26 negara, tapi kami ingin membuktikan bah- wa mahasiswa Indonesia mampu bersaing dengan tim-tim dari per- guruan tinggi ternama seperti To- kai University, Michigan, Stamford University, MIT, dan sebagainya," katanya. Menurut dia, lomba mobil berte- naga surya itu mempertandingkan tiga kategori yakni challenger class yang diikuti 29 tim, cruisser class 10 tim, dan adventure class diikuti oleh 18 tim. "Kami ikut dalam challenger class yang merupakan kelas masterpiece mobil surya yang bisa dikembang- kan, karena mobil surya di kelas itu memiliki empat roda, meski hanya satu penumpang," katanya. Dua kategori lainnya adalah cru- isser class dengan dua penumpang yang tidak 100 persen mengandal- kan tenaga surya, karena bisa di- charge pada stasiun pengisian bahan bakar umum lainnya, sedangkan adventure class dengan tiga roda dan satu penumpang. (ant) itu dilakukan di kamar Ketua tim penyidik KY, Sarman Mulyana itu. Meski dilakukan di kamar hotel, namun proses pemeriksa- an dilakukan secara formal dan administratif. "Ada tiga orang yang me- meriksa. Pemeriksaan secara formal, karena saya juga tan- datangan berkas pemeriksaan itu," jelasnya. Mengenai hasil pemeriksaan, dia mengaku tak diberitahu oleh KY. Hanya yang pasti, KY akan segera menindaklanjuti kete- rangannya itu. Maka dari itu, dia pun berharap bahwa keadilan yang dicari bisa didapatkan. "Memang hakim Heru Musto- fa sudah dikotak di Pengadilan Tinggi (PT) Surabaya. Namun hukuman itu belum setimpal dengan apa yang diperbuatnya," tuturnya. (sda) tentara. Dan ini tidak kalah membanggakan lho,” ucap Risqi. Karena kemampuannya bernyanyi dan bermain mu- sik, yang ditampilkan sambil mengenakan pakaian dinas, membuatnya bisa tampil di mana-mana dan disaksikan ba- nyak kalangan. Termasuk para pejabat dan pimpinan TNI. Tak hanya itu, Risqi pun men- dapatkan kesempatan untuk belajar bidang kesenian lain, yang sebelumnya tidak pernah terbanyangkan ada di kesatuan TNI. Ia juga belajar seni memba- ca Alquran. Akhirnya, wanita yang di luar kegiatan dinas, sering tampil berjilbab ini, juga pernah menyabet juara dalam lomba Musabaqoh Tilawatil Quran (MTQ) tingkat Komando TNI AL di Surabaya. “Alham- dulilah dapat juara 1,” ujarnya sambil tersenyum. Jadi meski status sebagai tentara wanita, namun dari tugasnya, Serka Risqi merasa le- bih pada sebagai seniman serba bisa. Hal ini menjadi kebangga- an tersendiri dan membuatnya semakin cinta pada profesi ten- tara wanita yang digelutinya, dan tugas yang telah diperin- tahkan. Apalagi tugasnya ini tidak membuatnya terkurung di satu komando atau kesatuan saja. Tapi juga bisa membuatnya pin- dah tugas di daerah lain. Seperti saat bertugas di Jakarta dulu, Risqi malah sempat menjadi vokalis grup band. “Semoga selalu diberi kelan- caran dan bisa memberi manfa- at,” tandas Risqi yang kini telah fasih memainkan berbagai alat musik. (rie) takjil yang dijajakan. "Pembeli di sini tak hanya dari warga sekitar sini saja, tapi ada juga yang dari Blauran dan Krang- gan," tutur Sita, penjual es ko- pyor kepada Surya, Rabu (10/7). Diungkapkan, jalan kampung itu selalu dimanfaatkan penjual untuk menjajakan menu takjil ketika Ramadan tiba. Untuk penjual menu takjil, ada sekitar 30 orang yang menggelar da- gangan di jalan itu. Mereka berjualan selama Ramadan, mulai pukul 15.00 hingga masuk Isya. Jika laris, maka lapak pun ditutup saat Maghrib. "Saya menjual es kopyor dan es buah seharga Rp 2000. Belum ada sejam, dagangan saya su- dah habis," paparnya. Dari sekitar 30 penjual menu takjil, sebagian menjual goreng- an, minuman es dan kue-kue ser- ta pukis. Tak hanya itu saja, ada juga penjual rujak cingur, nasi bebek, nasi lalapan hingga gado- gado yang juga diserbu pembeli. Seperti jualan kue dan minuman milik Orien. Dia menggelar berbagai macam kue dan puding, mulai ketan durian hingga puding coklat. Dengan harga hanya Rp 1.500 per buah- nya, dalam setengah jam saja, semua kuenya hampir ludes. "Ini kuenya memang kami buat sendiri. Selama ini kami berjualan kue dengan menitip- kan ke tempat lain. Tapi untuk momen ini sepertinya memba- wa berkah karena jualan kami laris," urainya. Hal senada juga dialami pen- jual kue dan makanan bernama Yumima. Selain berjualan lauk seperti sate daging dan usus, dia juga menjual beragam kue, seperti lumpia goreng, kue lum- pur hingga kue talam (bahan dari beras diberi abon). "Lumpia dan kue talam cukup laris. Harganya pun terjangkau, Rp 1.500 per buahnya," jelasnya. Perempuan yang sudah menjanda ini mengaku cukup bersyukur, karena jualan takjil selama Ramadan ini membawa keuntungan hampir dua kali lipat dari hari biasa. Sehari- hari, dia juga jualan kue-kue di dekat rumahnya, tapi penjual tak sebanyak saat ini. Makanya, dia pun rela memberi diskon sampai Rp 1.000 untuk tiap kue yang dibeli. "Namun ketika Ramadan, jualan takjil benar-benar mem- bawa untung," pungkasnya. (sudharma adi) Serahkan... DARI HALAMAN 9■ Seniman... DARI HALAMAN 9■ Sapu Angin... DARI HALAMAN 9■ Jualan Kue... DARI HALAMAN 9■ Dua Jam... DARI HALAMAN 9■ surya/sri handi lestari pendidikan perwira - Para siswa Pendidikan Pembentukan Perwira (Diktukpa) ketika tiba di Markas Brigif-1 Marinir, Gedangan, Sidoarjo, Rabu (10/7). SURABAYA, surya - Sebanyak 39 siswa pendidikan pembentukan perwira (diktuk- pa) marinir angkatan 42, mengikuti praktik pasukan yang akan berlangsung mulai 10- 6 Juli 2013. Mereka diterima Komandan Brigif-1 Marinir Kolonel Marinir Markos di ruang rapat Brigif-1 Marinir, Gedangan, Sidoarjo, Rabu (10/7). Kedatangan 39 siswa diktukpa marinir ke Brigif-1 Marinir itu dipimpin Komandan Sekolah Perwira Infanteri Pusdikif Kodikmar Letkol Marinir Muharom Ahmad Fauzi. Dalam sambutannya, Kolonel Marinir Markos mengatakan, sebagai calon koman- dan peleton para siswa diktukpa marinir harus bisa memberikan contoh yang baik kepada anggota yang akan dipimpinnya. Selain itu, juga selalu menjaga hubungan kekeluargaan dengan prajurit. “Jangan sampai ada pelanggaran yang kalian lakukan selama melakukan praktik pasukan di Brigif-1 Marinir. Patuhi semua peraturan yang berlaku di satuan,“ tegas orang nomor satu di Brigif-1 Marinir itu. Sebelum mengakhiri sambutannya, Ko- mandan Brigif-1 Marinir berpesan kepada para perwira yang ditunjuk sebagai pem- bimbing para siswa diktukpa marinir agar memberikan pembinaan sesuai dengan aturan yang ada. Dengan harapan selepas dari Brigif-1 Marinir, mereka mendapat ilmu dan wawasan sebagai bekal untuk diaplikasikan di satuan. Turut hadir dalam kesempatan tersebut, Wadan Brigif-1 Marinir Letkol Marinir Su- liono, Pasops Brigif-1 Mar Letkol Marinir Gatot Mardiyono, Pasintel Brigif-1 Mar Mayor Marinir Azrin, Danyonif-3 Mar Let- kol Marinir Dede Harsana, Danyonif-5 Mar Letkol Marinir Joni Sulistiyawan, Dankima Brigif-1 Mar Mayor Marinir Irwanto dan Perwira dijajaran Brigif-1 Mar. (rie) 7 Hari Praktik Pasukan di Brigif-1 Marinir Gedangan KonjenJepang KagumiSurabaya SURABAYA, surya - Kota Surabaya dan Kota Kitakyushu, Jepang memantapkan kerja sama sister city dalam bidang lingkungan hidup, khususnya pengurangan karbon dan pe- ngelolaan lingkungan. Komit- men kerja sama itu disepakati dalam forum Joint Crediting Mechanism (JCM) Feasibility Study (FS) di Kantor Bappeko Surabaya, Rabu (10/7). Wali Kota Surabaya Tri Ris- maharini mengatakan, Peme- rintah Kota Surabaya memang banyak belajar tentang penge- lolaan lingkungan dari Jepang, utamanya dari Pemerintah Kota Kitakyushu. "Komitmen itu pula yang mendasari terjalinnya Green Sister City antara kedua kota tersebut," kata Risma saat membuka JCM-FS yang juga di- hadiri Konsulat Jenderal (Kon- jen) Jepang di Surabaya Noboru Nomura dan Sekretaris Menteri Lingkungan Hidup (Sesmen LH) Hermien Roosita. Menurut Risma, kerja sama antara Surabaya dan Kitakyushu dimulai pada 1997 dengan fokus pada pengelolaan sampah. Na- mun, pada masa-masa awal, wali kota mengakui kerja sama kurang berkembang pesat, lalu pada 2005 kedua kota sepakat lebih meng- intensifkan program lingkungan, seperti metode Takakura dan pembangunan rumah kompos. "Hasilnya, volume sampah yang masuk ke tempat pembu- angan akhir (TPA) berkurang 10 hingga 20 persen," terangnya. Kerja sama yang telah terjalin, lanjut dia, kini mulai dikem- bangkan lebih komprehensif de- ngan adanya penandatanganan MoU antara Pemerintah Kota Surabaya dan Kitakyushu untuk menyepakati sembilan program pengelolaan lingkungan. "Tahun lalu Surabaya dan Kitakyushu menyepakati pe- ngembangan sembilan program, di antaranya pembuatan tempat pembuangan sementara (TPS) terpadu, instalasi pengolahan air limbah (IPAL) komunal, dan pengelolaan kawasan industri yang lebih ramah lingkungan," ujarnya. Forum JCM-FS tersebut diiku- ti 26 orang yang tergabung da- lam 12 institusi di Pemerintahan Jepang. Dari dalam negeri, seba- nyak enam instansi pemerintah ikut ambil bagian. Kabag Kerja Sama Pemkot Surabaya Ifron Hady menam- bahkan, Surabaya merupakan kota yang paling berhasil me- nerapkan konsep pengelolaan lingkungan. Atas dasar itu, seki- tar tahun 2009 Pemerintah Kota Kitakyushu menjadikan Sura- baya sebagai percontohan di 40 kota, baik di dalam maupun luar negeri. Kemajuan Kota Surabaya, dia- kui Konjen Jepang di Surabaya Noboru Nomura. Ia mengata- kan, dirinya tiga kali mendapat penempatan tugas di Kota Pah- lawan. Jadi, dirinya tahu betul perkembangan Surabaya, ter- masuk kemajuan infrastruktur, namun menurutnya yang paling berkesan adalah kemajuan dari segi lingkungan hidup. "Saya mengucapkan terima kasih karena sudah membuat Surabaya sebagai kota yang ber- sih, indah, dan nyaman. Saya berharap harus ada implemen- tasi nyata dari forum ini, yang bisa memberi dampak positif bagi masyarakat," katanya. (ant) Surabaya-Kitakyushu Mantapkan Program Lingkungan■ Kerja sama antara Surabaya dan Kitakyushu dimulai sejak 1997 dengan fokus pada pengelolaan sampah Pada 2005, kedua kota sepakat mengintensifkan program lingkungan, seperti metode Takakura dan pembangunan rumah kompos Hasilnya volume sampah yang masuk ke TPA) berkurang 10 hingga 20 persen ■ ■ ■ storyhighlights termasuk tempat cangkrukan. "De- ngan begitu siapapun bisa menikma- ti KBS baik siang maupun malam," ujar Risma. Memang, ungkap Risma, sejumlah keinginan untuk melakukan perbaikan KBS terus diinventarisir. Termasuk kei- nginan membangun kompleks seaworld di dalam KBS. Seperti seaworld nuansa bawah laut yang ada di Jakarta untuk bisa dinikmati pengunjung secara be- bas. "Yang pasti, kami berharap KBS ke depan menjadi lokasi konservasi satwa sekaligus tempat wisata modern ikon Kota Surabaya," tutur Risma. Seperti diketahui, penyerahan pe- ngelolan KBS kepada Pemkot Suraba- ya sesuai dengan surat nomor: S.387/ Menhut IV/2013 tertanggal 3 Juli 2013 tentang Izin Pengelolaan Kebun Bina- tang Surabaya. Surat itu sendiri ditan- datangani oleh Menteri Kehutanan, Zulkifli Hasan. Dalam suratnya, Kemenhut memper- silakan PD TSKBS melakukan penge- lolaan sambil menunggu turunya izin konservasi. Selain itu, Kemenhut mem- berikan tiga catatan yakni PD TSKBS harus menyertakan tim teknis ahli kon- servasi, tanah KBS tetap dipertahankan untuk konservasi dan tidak untuk ke- perluan lain, serta tetap berkoordinasi dengan BKSDA dan Tim Pengelola Se- mentara (TPS) KBS. Surat Kemenhut tersebut dengan tembusan ke Presiden RI dan sejumlah lembaga Pemerintahan dan DPRD serta Ketua Tim Pengelola Sementara KBS. "Kami merespon positip atas turunya surat dari Kemenhut itu, dan ini seba- gai awal baru dalam pengelolaan KBS," kata Mochammad Machmud, Ketua DPRD Surabaya. (aru) ASEAN plus Korea Selatan, Je- pang, China dan India. “Jika nanti diberlakukan, do- sen dari Malaysia atau Thailand bisa dengan mudah mengajar di sini (Jatim). Mungkin juga ada yang menawarkan pembantu rumah tangga dari Filipina. Ma- kanya itu semua harus diantisi- pasi,” terangnya. Untuk itu, pembangunan pendidikan berbasis agama, lan- jut Pakde Karwo, menjadi kebu- tuhan dasar. Jika ingin merekon- struksi masyarakat yang baik maka pendidikan agama harus jadi prioritas dalam pendidikan. Basis spiritual harus diatas ba- ngunan moral dan etika. Tidak ada gunanya pintar tapi tidak punya etika. “Pendidikan spiritual itu pen- ting, dan yang harus mentrasfer itu seorang guru bukan laptop. Tidak bisa diwakilkan dengan teknologi,” imbuhnya. Koordinator Kopertais Jatim, Prof Dr H Abdul A’la, menjelas- kan melalui program ini guru- guru madin bisa meningkatkan wawasan dan kesejahteraannya. Pertumbuhan ekonomi Jatim di atas rata-rata nasional. Jika guru Madin sebagai masyarakat san- tri tidak punya wawasan yang memadai, maka proses belajar mengajar tidak akan maksimal. “Makanya, penguatan guru Madin harus dilakukan. Prog- ram ini sangat strategis, teruta- ma untuk pedesaan, misalnya di daerah Madura yang masih punya pandangan, bahwa ti- dak bersekolah jika anak tidak masuk madrasah diniyah. Jadi program ini sangat pas,” terang- nya. Menurut A’la, melalui kerja- sama ini, pada 2013 ini sebanyak 1.150 guru madin lulusan SMA akan dikuliahkan S1 di 34 PTAI. Seperti, STAIN Jember, Institut Ilmu Keislaman Annuqoyah Sumenep, Institut Agama Islam Tribakti Kediri dan STIT Mu- hammadiyah Bojonegoro. (uji) 1.150 Guru... DARI HALAMAN 9■ Perluas Kandang... DARI HALAMAN 9■ Agus Setiawan Pimpin KRI Badau surabaya, surya - Ko- mandan KRI Badau-841, Ma- yor Laut (P) Yulis Andreas Lo- rentus, resmi digantikan oleh Mayor Laut (P) Agus Setiawan. Serahterima jabatan (Sertijab) komandan kapal perang itu berlangsung di ruang rapat Satuan Kapal Patroli (Satrol) Koarmatim, Ujung, Surabaya, Rabu (10/7). Sertijab yang dipimpin lang- sung oleh Komandan Satu- an Kapal Patroli (Dansatrol ) Koarmatim, Kolonel Laut (P) Suhartono, itu berlangsung dalam upacara militer yang di- ikuti oleh Perwira, Bintara dan Tamtama di lingkungan satuan kapal patroli. Mayor Laut (P) Agus Setia- wan, perwira lulusan Akade- mi TNI Angkatan Laut (AAL) Angkatan 46 ini sebelumnya pernah menjabat sebagai Ko- mandan KRI Weling-822 jajar- an Lantamal VII Kupang, se- dangkan pejabat lama Mayor Laut (P) Yulis Andreas Loren- tus, perwira lulusan AAL Ang- katan 44, selanjutnya menem- pati jabatan barunya sebagai Kasi Taktik Staf Operasi Satrol Koarmatim. Komandan Satrol Koarma- tim dalam amanatnya antara lain mengatakan sosok seorang Komandan bagi suatu satuan operasional sangat mewarnai gerak langkah satuan tersebut. "Karena itu keberhasilan sua- tu satuan operasi tidak lepas dari kemampuan seorang ko- mandan dalam melaksanakan pembinaan yang terarah, efek- tif dan efisien serta berkelan- jutan terhadap anggota yang dipimpinya," jelasnya. Lebih lanjut menurutnya, se- tiap komandan KRI memiliki tugasdantanggungjawabyang tidak ringan sebagai pembina kesiapsiagaan dan kemampu- an alutsista yang diawakinya. Sehingga setiap saat mampu hadir di laut untuk menega- kan dan mempertahankan ke- daulatan serta mengamankan keutuhan wilayah perairan yu- risdiksi nasional. (rie) komandan baru - Mayor Laut (P) Agus Setiawan, komandan KRI Badau- 841 bersama Mayor Laut (P) Yulis Andreas Lorentus dalam sertijab di ruang Satrol Koarmatim, Ujung, Rabu (10/7). surya/sri handi lestari join follow @portalsurya
  • 11. Malang Life MALANG, SURYA - PT Liga Indonesia (PT LI) baru memutuskan penundaan laga Arema Cronous kontra Mitra Kukar, sedang pe- nundaan kontra Persisam Samarinda di Stadion Segiri belum ada kepastian. Sesuai jadwal awal, Are- ma Cronous akan dijamu Persisam pada 1 Agustus 2013. Apabila PT LI tidak mengubah jadwal laga ini, maka masa recovery pe- main Singo Edan semakin minim. Sebab, Arema harus melakoni laga kontra Mitra Kukar pada 29 Juli 2013. “Yang sudah dipastikan mundur hanya laga Arema lawan Mitra Kukar,” kata Sudarmaji, Media Officer Arema Cronous kepada Sur- ya, Rabu (10/7). Sebelumnya manajemen hanya mendapat pemberita- huan lisan dari PT LI. Karena laga kontra Mitra Kukar mundur sehari, otomatis laga Persisam juga mundur sehari. Tetapi, manajemen harus menunggu surat lanjutan dari PT LI terkait laga kontra tim berjuluk Pesut Mahakam ini. Sementara, tawaran uji coba untuk Arema Cronous dari klub luar negeri mulai berdatangan, salah satunya klub asal Malaysia. Nanti- nya, Arema akan menjalani uji coba dalam event berta- juk persahabatan Malaysia- Indonesia. Informasinya, manajemen Arema telah mendapat undangan dari Malaysia Broadway terkait tawaran uji coba itu. Manajeman Are- ma sudah bertemu dengan perwakilan media Malaysia. Jika memang diundang, Arema akan mengikuti event itu, apalagi akomodasi ditanggung pihak Air Asia. Sistem uji coba yang di- tawarkan klub Negeri Jiran itu adalah home away seba- gai persiapan pra-musim liga musim depan. Manaje- men Arema masih menung- gu penyusunan jadwal uji coba, tetapi kemungkinan uji coba itu akan digelar antara Oktober sampai No- vember 2013. Selain Arema, klub lain di Indonesia yang juga mendapat undangan serupa adalah Semen Pa- dang dan Persib Bandung. (ekn/ jay) Kontra Persisam Masih Misterius H ARIYANTO tak dapat menyembunyikan rasa gembiranya begitu Rega menjulurkan tangannya untuk berjabat tangan dengan Wali Kota Peni. Satu per satu pemain BM juga berjabat tangan untuk pamitan dan mohon doa restu kepada orang nomor satu di Kota Malang ini. “Alhamdulillah mas, Rega menjadi pemain inti. Saya bangga, semoga dia dan kawan-kawannya mampu menorehkan prestasi interna- sional,” kata Hariyanto. Menurut Haryanto, dari para pemain BM, Rega merupakan satu-satunya anak dari kalang- an tidak mampu. Kini Rega duduk di kelas VI SDN Sragi, Talun, Blitar. Meski orangtua- nya tidak mampu, Rega mem- punyai semangat yang tinggi bermain bola. Melihat bakat dan semangatnya yang tinggi, Haryanto nekat mengikutkan Rega dalam seleksi BM yang digelar Pengcab PSSI Kota Malang. Harapan Haryanto anaknya lolos seleksi terkabul. Bahkan, Rega yang menempati posisi gelandang ini mampu menjadi pemain inti BM yang dibesut Roy Samai. “Kami memilih Malang karena sepakbolanya maju. Harapan kami tim ini mampu meraih juara di Swedia,” ujarnya. Haryanto juga berharap, tim BM ini tetap utuh sampai anak-anak memasuki usia ke sepakbola profesional. “Yang jelas, harapan kami ke depan Rega bisa menjadi pemain bintang sehingga mampu menopang ekonomi keluarga,” kata Heryanto. Kegembiraan juga menyeli- muti Sudirman yang puteranya Syarif Hidayutullah juga menja- di pemain inti BM yang mewakli Maling Jarah Rumah Pensiunan Kolonel Kuras 16 Arloji Bermerek■ MALANG, SURYA - BIni per- ingatan bagi warga Kota Ma- lang untuk selalu waspada dan terus meningkatkan keamanan lingkungan. Sebab, saat Rama- dan seperti sekarang banyak pencuri bergentayangan de- ngan sasaran rumah kosong yang ditinggal penghuninya beribadah di masjid. Bukti pencuri mulai meng- obok-obok rumah kosong yang ditinggal penghuninya beriba- dah di masjid telah menimpa rumah Kolonel (Purn) Maulud Hidayat (64) di Jalan Danau Tondano A3-F43 Perumahan Sawojajar, Kecamatan Kedung- kandang, Kota Malang. Selasa (9/7), rumah korban disatroni kawanan pencurian saat diting- gal Sholat Taraweh. Para pelaku membawa kabur 16 arloji dan 70 gram perhiasan emas. Keluarga Maulud Hidayat sudah menjalankan ibadah puasa sejak Selasa (9/7). Se- perti biasanya, keluarga ini KE HALAMAN 15■ SURYA/DAVID YOHANES DIBOBOL - Nurhayati menunjukkan pintu garasi rumahnya yang dibobol kawanan pencuri, Selasa (9/7) malam. Para pelaku membawa kabur belasan arloji, perhiasan emas, dan ponsel senilai Rp 75 juta. Senyum penuh kegembiraan menyelimuti Ha- riyanto, warga Talun, Kabupaten Blitar, setelah Rega, puteranya, bersama tim Banteng Muda (BM) U-12 dilepas Wali Kota Malang, Drs Peni Suparto MAP, di Balai Kota, Rabu (10/7). Tim sepakbola BM U-12 ini akan mewakili Indonesia berlaga dalam kejuaraan di Swedia. Ketika Banteng Muda Kembali Berlaga di Swedia Sang Bapak Berasa Rega Bisa Menjadi Pemain Bintang SURYA/HAYU YUDHA PRABOWO BATI SUTRA - Sejumlah karyawan Andis Batik Druju menorehkan canting pada kain Sutera di Desa Druju, Kecamatan Sumbermanjing Wetan, Kabupaten Malang, Rabu (10/7). Andis Batik Druju yang memiliki 35 karyawan kewalahan melayani permintaan pesanan batik tulis yang dibanderol Rp 300.000 hingga Rp 30 juta ke sejumlah kota-kota besar di Indonesia. Investor China Mulai Survei Semen Kabupaten KEPANJEN, SURYA - Potensi bahan baku semen Kabupaten Malang yang mencapai lebih dari 60 miliar meter kubik dili- rik oleh investor China. Bupati Malang Rendra Kresna menga- takan sudah tiga kali pihaknya melakukan pertemuan dengan pihak yang digandeng investor China itu, yakni manajemen PT Senopati Dirgantara Perkasa. Pembicaraan terkait rencana pembangunan pabrik semen di wilayah Malang selatan. “Sekarang investor China ber- sama manajemen PT Senopati sudah berada di Malang dan berencana tinggal selama sekitar satu bulan untuk melakukan survei dan pengujian bahan baku di sejumlah titik,” katanya, Rabu (10/7). Bahan baku semen yang di- survei dan diuji tersebut adalah jenis kaolin. Titik-titik yang me- miliki kandungan kaolin antara lain di Kecamatan Pagak, Ge- dangan, Bantur, Sumbermanjing Wetan dan Kalipare. Menurut Rendra, survei dan Mahasiswa Sedot Ganja Agar Bisa Tidur MALANG, SURYA - Seorang mahasiswa sebuah perguruan tinggi swasta ternama di Jalan Tlogomas dicokok polisi pada Jumat (5/7) lalu. Pria, sebut saja PG (20) ini, diketahui mengon- sumsi ganja. Bahkan ia telah mengonsumsi barang haram itu sejak masih kelas XII SMA. PG ditangkap polisi saat berjalan di depan kampusnya. Dari saku celananya, polisi me- nemukan satu poket ganja dan satu lintingan ganja seharga Rp 100.000. “Pelaku kami tangkap dengan barang bukti dan langsung kami sidik,” terang Kasubag Humas Polres Malang Kota,AKP Dwiko Gunawan, Rabu (10/7). Menurut Dwiko, penangkap- an PG bermula dari seorang pengedar bernama CH. CH me- rupakan pemain lama pengedar ganja di Malang Raya. Kedua- nya diketahui baru saja melaku- kan transaksi di wilayah Karang Ploso, Kabupaten Malang. CH masih dalam pengejaran, sementara PG berhasil ditang- kap. Keduanya diketahui baru kenal satu bulan lalu dan satu kali melakukan transaksi. “Kami masih mengembang- kan kasus PG, karena penjual barangnya masih kabur,” tam- bah Dwiko. Kepada polisi, PG mengaku sudah kenal ganja sejak kelas XII SMA. Warga Jalan Tirto Utomo, Lowokwaru, Kota Malang ini, awalnya hanya coba-coba kare- na ada teman yang punya ganja. Dari sekadar mencoba itu, PG akhirnya ketagihan. Sejak saat itu PG selalu ber- usaha mengalokasikan uangnya untuk membeli ganja. Namun ganja tersebut hanya digunakan sendiri. “Saya tidak pernah menggu- nakanganjaramai-ramaidengan teman,” akunya. Lebih jauh PG mengaku selalu menggunakan ganja se- SURYA/NEDI PUTRA AW DITANGKAP - Kasubag Humas Polres Malang Kota AKP Dwiko Gunawan (kanan), bersama PG (20), mahasiswa sebuah PTS tersangka pengguna ganja yang berhasil diamankan bersama sejumlah barang bukti di Mapolres Malang Kota, Rabu (10/7). Keluarga korban berangkat Sholat Taraweh pukul 08.30 WIB. Sampai di rumah pukul 20.00 WIB korban kaget karena pagar dan pintu garasi dalam kondisi terbuka. Korban berupaya mencari pelaku, tetapi pelaku telah kabur membawa 16 arloji bermerek dan 70 gram perhiasan emas. ■ ■ ■ STORYHIGHLIGHTS Stok Daging Dijamin Aman MALANG, SURYA - Kebu- tuhan daging di Kota Malang dijamin aman hingga Lebaran nanti, meski stok yang ada tidak bisa menekan harga di pasaran. Dinas Pertanian lebih fokus un- tuk menjaga kesehatan daging selama permintaan masyarakat tinggi. Kabid Peternakan Dinas Pertanian Kota Malang, drh Yudhi Broto, mengakui terjadi kenaikan permintaan daging selama Ramadan hingga Idul Fitri mendatang. Lonjakan per- mintaan daging di pasaran ini yang memicu kenaikan harga secara signifikan dari harga Rp 81.000 per Kg menjadi kini Rp 95.000 per Kg. “Jadi kenaikan harga itu ka- rena permintaannya memang tinggi. Bukan karena tidak ada barang di pasaran,” terang Yu- dhi saat ditemui Surya di Balai Kota, Rabu (10/7). Yudhi menambahkan, pada kondisi normal setiap hari ada sekitar 50 ekor sapi yang disem- belih untuk kebutuhan warga Kota Malang. Namun, karena permintaan yang meningkat, maka setiap hari ada tujuh ekor sapitambahanyangdisembelih. Jumlah tersebut belum bisa me- nekan harga di pasaran. Meski begitu, cukup mengendalikan harga agar tidak terlalu tinggi. Selain itu faktor transportasi juga memicu naiknya harga da- ging sapi. Dari total sapi yang disembelih, hanya sekitar 18 HALAMAN 9 | | KAMIS, 11 JULI 2013 | KE HALAMAN 15■ KE HALAMAN 15■ KE HALAMAN 15■ KE HALAMAN 15■ SURYA/NEDI PUTRA AW SIAP BERLAGA - Tim SSB Banteng Muda yang mewakili Indonesia di ajang The World Youth Cup di Swedia, saat dilepas Wali Kota Malang Drs Peni Suparto (tengah), di Balai Kota, Rabu (10/7). join follow @portalsurya
  • 12. | MALANGLINES| KAMIS, 11 JULI 2013 menjalankan Sholat Taraweh di sebuah masjid dengan jarak sekitar 10 menit apabila ditempuh meng- gunakan mobil. “Sehari sebelumnya kami sekeluarga juga Sholat Taraweh bersama-sama,” ungkap Nurhayati, istri Maulud Hidayat, saat ditemui di rumahnya, Rabu (10/7). Nurhayati menceritakan, rumahnya itu dihuni dia bersama suami dan seo- rang anak serta seorang cucu. Sekitar pukul 18.30 WIB, keluarganya berang- kat ke masjid hingga pukul 20.00 WIB. Namun selesai Taraweh suaminya mengajak berkeliling mencari makan- an kebab. Sampai di rumah sekitar pukul 20.00 WIB, Nurhayati mengaku terke- jut sebab pagar dan pintu garasi sudah dalam keadaan terbuka. Padahal, saat mereka berangkat semuanya sudah dalam keadaan dikunci. “Suami saya sadar apabila rumah dibobol maling. Karena itu dia lang- sung keluar mobil dan lari ke dalam rumah berusaha mencari pelaku,” ujarnya. Namun, para pelaku sudah tidak ada. Dari bekas yang ditinggalkan, lanjut Nurhayati, pelaku diperkirakan berjumlah empat orang. Mereka me- manjat pagar besi setinggi lebih dari empat meter dan kemudian merusak pintu garasi dengan linggis. Darigarasiparapelakuleluasamasuk ke dalam rumah karena pintu tengah tidak pernah dikunci. Kawanan pencuri ini kemudian merusak pintu kamar utama yang ditempati Nurhayati dan suaminya. Di kamar ini, para pelaku mengobrak-abrik isi kamar untuk men- cari benda berharga. “Karena pintu kamar saya cukup tebal dan kuat, mereka merusaknya. Bekas linggisnya membentang sepanjang 50 cm,”katanya. Dari dalam kamar utama pelaku berhasil membawa sembilan arloji bermerek milik Nurhayati dan empat arloji bermerek milik Maulud. Arloji yang dicuri antara lain bermerek Rado, Bonia, Guess, dan Alexander Christie. Bukan itu saja, perhiasan emas koleksi Nurhayati seberat 70 gram juga disikat pelaku. Anehnya, seperti disengaja para pelaku meninggalkan satu arloji ma- sing-masing untuk Nurhayati dan Maulud. “Yang ditinggal kebetulan yang harganya tidak terlalu mahal. Entah disengaja atau tidak,” tambah Nurhayati. Dari kamar utama, para pelaku ber- alih ke kamar sebalah yang ditempati anak Nurhayati dan cucunya. Di ka- mar ini pelaku mengambil dua arloji. Selain itu, dua ponsel korban juga ikut dibawa kabur. Usai menguras harta korban, para pelaku kabur dan meninggalkan ru- mah korban dalam keadaan berantak- an. Menurut Nurhayati, total kerugian seluruh barang yang dibawa pencuri sekitar Rp 75 juta. Kejadian tersebut dilaporkan Nurhayati ke Polsek Ke- dungkandang. Dua Kali Kemalingan Saat para pelaku beraksi, di garasi korban sebenarnya ada sebuah mo- bil Toyota Rush dan sebuah Honda Scoopy. Nurhayati mengaku bersyu- kur karena kedua kendaraan itu tidak ikut dibawa kabur pelaku. Maulud Hidayat adalah purnawira- wan TNI AD dengan pangkat terakhir Kolonel. Di rumah yang ditempati sejak tujuh tahun lalu ini, keluarga ini sudah dua kali kemalingan. Sekitar dua tahun lalu, sebuah sepeda motor yang baru saja dibeli juga hilang di- gondol maling. Petugas Polsek Kedungkandang telah melakukan olah tempat kejadian perkara (TKP). Menurut Kasubag Hu- mas Polres Malang Kota, AKP Dwiko Gunawan, tren kejahatan saat puasa memang selalu meningkat. Untuk itu Polres Malang Kota menambah patroli rutin yang dilakukan. Dwiko mencontohkan, jika biasanya patrolidilakukanlimakali,selamapuasa bisa dilakukan hingga dua kali lipatnya. Namun demikian, masyarakat harus bersikap waspada menjaga keamanan lingkungan.Sebab,tidakmungkinpolisi sendirian mengamankan wilayah Kota Malang. “Kegiatan patroli memang ditingkatkan, tetapi masyarakat harus tetap terlibat,” terangnya. Selain itu, polisi juga menggan- deng Satpol PP Kota Malang untuk menjaga ketertiban selama Ramadan. Rencananya, dua institusi ini akan melakukan razia bersama untuk me- respons keluhan masyarakat selama Ramadan. (day) pengujian bahan baku tersebut dimaksudkanuntukmengetahui dan memastikan seberapa besar kandungan kaolin yang menjadi bahan baku semen. Ia menge- mukakan pihaknya juga sudah membeberkan secara gamblang bahan baku semen yang ada di Kabupaten Malang sesuai studi kelayakan yang pernah dilaku- kannya beberapa waktu lalu. “Sekarang kalau investor ingin mengujinya sendiri, ya dipersi- lahkan,” tegasnya. Investasi Rp 3 Triliun Mengenai perizinan, Rendra mengatakan pengajuan izin administrasi eksplorasi untuk mendapatkan rekomendasi dari Kementerian Energi Sum- ber Daya Mineral (ESDM) juga sudah dilayangkan, bahkan dana investasinya pun sudah disiapkan, yakni sekitar Rp 3 triliun. Adanya investasi di bidang industri Semen tersebut, kata Rendra, tidak hanya mengun- tungkan pemkab, tapi juga ma- syarakat sekitar yang terserap langsung sebagai tenaga kerja. Tenaga kerja yang terserap dan terkait langsung dengan pabrik, katanya, bisa mencapai seribu lebih dan yang tidak ter- kait langsung, tapi menopang keberadaan pabrik bisa menca- pai 5.000 orang. “Kami berharap hasil studi kelayakan yang dilakukan investor ini cocok dan pem- bangunan pabrik semen di Kabupaten Malang segera ekor dari Kota Malang. Semen- tara sisanya didatangkan dari daerah sekitar yang mempunyai populasi sapi tinggi. Sejak kenaikan harga bahan bahar minyak (BBM), harga sapi dari luar kota juga ikut naik. Namun, ketersediaan sapi yang siap disembelih dijamin aman hingga Idul Fitri. Di tengah kebutuhan daging yang tinggi, Dinas Pertanian lebih fokus melakukan pengawasan daging yang beredar di pasaran. Jangan sampai ada pihak yang tidak bertanggung jawab meman- faatkan kondisi itu. Misal, men- jual daging sapi yang disembelih dengan cara digelonggong. Menurut Yudhi, pengawasan rutin kualitas daging pun kini diintensifkan. Setiap hari ada petugas khusus dari Dinas Per- tanian yang memantau kesehat- an daging. Selain itu kesehatan secara umum, seperti bebas ca- cing hati dan daging yang busuk juga menjadi perhatian. Daging yang dijual harus dipastikan bebas bahan berbahaya atau di- campur daging hewan lain yang tidak halal. (day) Indonesia di Swedia. Menurut Sudirman, anaknya sudah ikut sekolah sepakbola (SSB) sejak usia 8 tahun. Awalnya Syarif yang menempati bek sayap ini bergabung dengan klub Asyabab Sukorejo, Pasuruan. Setelah itu, Syarif pindah dan bergabung di SSB Lawang, Kabu- paten Malang. Begitu ada seleksi pemain BM tahun lalu, Syarif mengikutinya dan lolos, bahkan menjadi pemain inti. “Kami harap tim yang telah berprestasi internasional ini terus diperta- hankan,” papar Sudirman. Tim BM U-12 akan mewakili Indonesia di ajang The World Youth Cup, Gothia Cup 2013 yang digelar di Kota Gothen- burg, Swedia, 12-21 Juli 2013. Kemarin sebanyak15 pemain BM telah dilepas Peni Suparto. Sebelumnya, tim BM juga mewakili Indonesia di ajang yang sama pada 2010 di Afrika Selatan dan 2012 di Swedia. Saat di Swedia, BM mampu lolos di 16 besar. Tim binaan asal Malang ini harus angkat koper setelah tunduk dari wakil Siprus. Bonus Rp 37Juta Peni berharap prestasi yang diraih BM tahun ini lebih baik dari tahun lalu. Apabila tahun lalu hanya mampu lolos di 16 besar, tim pelatih dan pemain harus berusaha lolos sampai babak final. Perlu diketahui, jawara Gothia Cup tidak mendapat hadiah uang sepeserpun. Ma- kanya untuk memacu semangat tim BM, Pemkot sudah menyi- apkan bonus sebesar Rp 37 juta. Menurut Peni, bonus ini akan diberikan apabila prestasinya lebih baik dari sebelumnya. “Kalau bisa masuk final. Sekalipun masuk semi final, bonus tetap akan kami ber- ikan,” kata Peni. Wali kota dua periode ini menegaskan terpilihnya BM sebagai wakil Indonesia menunjukan sepakbola di Kota Malang masih diperhitungkan. Makanya, dia minta tim BM menunjukkan prestasi terba- iknya. Di ajang pembinaan sepakbola internasional itu, BM memang mewakili Indonesia. Tetapi bagi warga Indonesia, BM adalah jelmaan pembinaan sepakbola lokal Kota Malang. Menurutnya, bertanding di bulan Ramadan memang bisa menjadi kendala bagi tim bina- an Roy Samai ini. Stamina dan kondisi fisik pasti mempenga- ruhi pemain. Tetapi, Peni minta tim BM harus tetap semangat. “Jangan terpengaruh dengan peserta lain yang memang tidak berpuasa. Justru orang yang puasa itu harus lebih semangat, dan jangan mengeluh,” ujarnya. Terpisah, Roy Samai mengaku masih buta kekuatan lawan. Meski begitu, dia telah mengin- struksikan para pemain untuk bermain dari kaki ke kaki, bukan long pass. Dalam kejuaraan ini, BM bergabung dengan Meksiko, Swedia Adan Swedia C. “Kami harus mampu meraih juara grup agar bisa lolos ke babak selanjut- nya karena target prestasi kali ini harus bisa masuk minimal empat besar,” pungkas Roy. Ditambahkan, BM mewakili Indonesia setelah menjadi juara nasional. Di final BM meng- alahkan Persikabo Bogor pada 6 Juni lalu.(ekn/jay) Stok Daging... DARI HALAMAN 9■ Investor... DARI HALAMAN 9■ Maling jarah... DARI HALAMAN 9■ surya/nedi putra aw TOLAK PERUMAHAN - Sejumlah pengguna jalan melintas di depan lapangan Jl Danau Bratan, Perumahan Sawojajar I, Kota Malang, Rabu (10/7). Warga kawasan ini menolak rencana pembangunan perumahan baru di atas lahan yang diklaim sebagai fasilitas umum (Fasum) ini. malang, surya - Univer- sitas Brawijaya (UB) mulai me- lakukan seleksi terhadap ma- hasiswa khusus penyandang disabilitas. Tes yang digelar mulaiRabu(10/7)hinggaJumat (12/7) itu diisi dengan seleksi psikologi dan tes wawancara bagi mahasiswa dan orangtua mahasiswa yang mengikuti tes. Sepertidikutipdarihttp://prase-, jumlah peserta yang mendaftar pada Seleksi Program Khusus Penyandang Disabilitas (SPKPD) pada tahun ini seba- nyak 35 orang. Setelah dilaku- kan proses seleksi administrasi, didapatkan sebanyak 24 perserta lolosuntukmelaksanakanproses tes wawancara dan tes psikologi. Staf di Pusat Studi dan La- yanan Disabilitas (PSLD), Shinta mengatakan, bahwa pada tahun ini terdapat psikotes dan tes wa- wancara dengan orangtua. Ta- hapan tersebut, tidak dilakukan pada tahun sebelumnya. Sebab, berdasar pengalaman peneri- maan tahun pertama, tim PSLD menganggap bahwa psikologi dan kepedulian serta dukungan orang tua juga sangat menen- tukan kelancaran proses studi mahasiswa selama belajar. Selain itu, proses seleksi tahun ini juga lebih ketat dibandingkan tahun lalu. Pada tahun ini peser- ta yang mendaftar disyaratkan lama studi pada tingkat Sekolah Menengah Atas (SMA) selama tiga tahun. Pada tahun lalu, per- syaratan lama studi SMA maksi- mal hingga sembilan tahun. “Berdasarkan pengalam- an angkatan pertama, kami menganggap bahwa mahasis- wa mempunyai prestasi yang bagus jika ada dukungan yang bagus pula, sehingga kami merasa perlu untuk menggali lebih jauh tentang psikologi, latar belakang dan dukungan orangtua. Harapannya proses studi mahasiswa dapat berjalan dengan lancar dan tanpa ham- batan yang berarti,” ungkap Shinta, Rabu (10/7).(isy) Seleksi Mahasiswa Disabilitas UB Diperketat Setor Nama PNS Dapat Rumah malang, Surya - “Setor Nama Dapat Rumah”. Itulah slogan yang sedang digagas oleh Dinas Pekerjaan Umum (PU) Kota Malang. Slogan itu dicetuskan untuk mendukung program rumah murah untuk Pegawai Negeri Sipil (PNS). “Sekilas kalau didengar kan enak dan menarik minat. Hanya setor nama bisa dapat rumah,” ujar Jarot Edy Sulistyono, Kepa- la Dinas PU Kota Malang, kepa- da Surya di Balai Kota Malang, Rabu (10/7). Menurut Jarot, slogan tersebut bukan slogan kosong. Sebab, kini pihaknya sedang meran- cang perumahan murah dan terjangkau untuk PNS, khusus- nya golongan I dan II. Golongan ini merupakan kelompok PNS dengan gaji terendah. Sebagai gambaran, seorang PNS dengan golongan I A yang baru masuk kerja mempunyai gaji pokok sekitar Rp 1.040.000. Dengan hanya mengandalkan gaji yang mereka terima tiap bu- lan, para PNS golongan ini akan sulit untuk membeli rumah. “Kami sedang mendata jum- lah PNS di dua golongan ini. Karena, pada dasarnya kami tahu bahwa banyak di antara mereka yang belum mempunyai rumah,” ujar Jarot. Diungkapkan Jarot, saat ini rencana tersebut masih dimatang- kan. Jarot berharap tahun depan rencana ini sudah bisa diwu- judkan. Saat ini pihaknya masih mencari lokasi untuk proyek itu. Rencananya, rumah murah untuk PNS ini harganya di bawah Rp 100 juta. PNS yang berminat tidak perlu uang muka dan langsung cicilan pertama. Besaran cicilan juga akan disesuaikan dengan kemampuan finansial mereka. Meski murah, rumah ini nan- tinya tidak “murahan”. Jarot menjamin lokasi rumah sangat strategis, dekat tol, bebas banjir, dan mempunyai view (peman- dangan) indah. Namun, Jarot mengaku tidak tahu pasti berapa alokasi dana untuk proyek ru- mah murah bagi PNS ini. Sebab nantinya DPU akan menggan- deng Kementerian Perumahan Rakyat (Kemenpera). Selain itu, DPU juga sedang menggagas rumah susun sederha- na sewa (rusunawa). Rusunawa ini diperuntukan masyarakat Kota Malang dengan penghasilan ren- dah. Jarot mengungkapkan, satu twinblockrusunawainiakandiba- ngundisekitarGORKenArok. Pemkot Malang berkewajiban menyediakan tempat rusunawa ini, dan dana selebihnya akan ditanggung Kemenpera. Saat ini pembangunan rusunawa terse- but sudah masuk proses tender oleh Kemenpera. Rencananya ada lima twin block rusunawa yang akan dibangun di wilayah timur Kota Malang. Alasannya, perkembangan Kota Malang mengarah ke timur. Meski disebut rusunawa, nantinya ba- ngunan itu akan dibuat mirip de- ngan hotel melati, dengan fasilitas taman, pengolahan dan pemilihan sampah,sertaairbersih.(day) DPU Merintis Rumah Murah Golongan I■ 15 Sang Bapak... DARI HALAMAN 9■ belum tidur. Biasanya, kamar kosnya di Tlogomas ditutup rapat-rapat sebelum meng- hisap ganja. Usai mengguna- kan ganja, PG mengaku lebih rileks dan bisa tidur dengan nyenyak. “Saya menggunakan ganja agar tidur bisa lebih nyenyak. Makanya saya gunakan saat menjelang tidur,” katanya. Namun karena kesenang- annya ini, PG dijerat dengan pasal 111 undang-undang 35 tahun 2009 tentang kepemi- likan narkotika golongan I dalam bentuk tanaman. An- camannya niminal 4 tahun penjaran dan maksimal 12 tahun penjara.(day) Mahasiswa... DARI HALAMAN 9■ Kami merasa perlu untuk menggali lebih jauh tentang psikologi, latar belakang dan dukungan orangtua shinta staf seleksi psld ub terealisasi,” ucapnya. Beberapa waktu lalu grup Bosowa juga pernah melaku- kan kajian terkait pendirian semen di Kabupaten Malang, karena potensi bahan baku- nya cukup melimpah dan bisa dieksplorasi selama 600 tahun dengan kapasitas produksi se- kitar 2 juta per tahun. Namun, bahan baku semen yang ada tidak sesuai dengan spesifikasi yang diinginkan oleh Bosowa, sehingga investasi sebesar Rp1,5 triliun hingga Rp2 triliun itu dibatalkan.(ant) join follow @portalsurya
  • 13. 10 | SURABAYABLITZ KAMIS, 11 JULI 2013 | SURABAYA, surya - Bulan Ramadan ternyata tidak mem- buat para pejudi menghentikan kegiatannya. Terbukti, polisi ber- hasil menggerebek sebuah arena judi kartu remi yang digelar di Jl Raya Karang Pilang Gang Melati Surabaya, Rabu (10/7). Dari penggerebekan tersebut, polisi berhasil menangkap em- pat orang warga yang sedang asyik bermain judi. Mereka ada- lah Ismanu (55), warga Karang Pilang Gang Merpati, Johanes Feberuntu (34), juga warga Gang Merpati, Hartono (36), tinggal di Gang Melati, dan Ladri (60) juga tinggal di Gang Merpati. ”Selain mengamankan empat tersangka, dalam penggerebek- an ini petugas juga mengaman- kan barang bukti berupa dua set kartu remi dan uang yang digunakan bertaruh,” ujar Kanit Reskrim Polsek Karang Pilang AKP Sugimin. Diceritakan pula, penggere- bekan terhadap arena judi ter- sebut bermula dari banyaknya laporan masyarakat bahwa di daerah itu kerap digunakan sebagai tempat bermain judi. Bahkan, saat bulan Ramadan pun para pejudi juga memiliki rasa sungkan melakukan perbu- atan yang dilarang hukum dan agama tersebut. “Setelah ditelusuri, ternyata memang ada perjudian di sana. Petugas pun langsung melaku- kan penangkapan terhadap para pejudi ini,” sambung Sugimin. Dalam pemeriksaan, para pe- judi tersebut mengaku hanya iseng bermain judi kartu un- tuk mengisi waktu luang saja. ”Iseng-iseng saja, Pak,” jawab seorang tersangka singkat. (ufi) Nekat Judi di Bulan Ramadan surabaya, surya - Untuk pengamanan selama Ramadan, polisi rutin menggelar patroli sahur. Polrestabes Surabaya membekali anggotanya dengan kentongan selama berpatroli. Kasatsabhara, AKBP Iwan Set- yawan, mengatakan, pihaknya telah mempersiapkan sekitar 50 anggota Sabhara, untuk patro- li. "Nantinya mereka ditugaskan utamanya di perumahan-peru- mahan," kata Iwan, Rabu (10/7). Menurutnya, dibekalinya ken- tongan selain berpatroli, upaya ini juga untuk mendekatkan po- lisi dengan masyarakat. "Mereka akan berpatroli sekitar pukul 02.00, atau menjelang sahur. Sambil berpatroli, mereka juga bisa membangunkan warga un- tuk makan sahur," tambah Iwan. Patroli sahur sudah dimulai oleh Polres Pelabuhan Tanjung Perak, dengan patroli sahur se- kitar pukul 02.30. Kapolres Pelabuhan Tanjung Perak, AKBP Aries Syahbudin, mengatakan patroli sahur ini un- tuk menciptakan kondisi aman di lingkungan masyarakat. Apalagi menjelang sahur juga merupakan jam rawan tindak kriminalitas."Kegiatan ini juga menyatukanmasyarakatdengan polisi, karena dalam patroli ini kami juga mengajak masyarakat turut serta," jelas Aries. Selama patroli, polisi juga meng- imbau agar masyarakat, utamanya remaja dan anak-anak, tidak ber- main bola di jalanan selama bu- lan puasa. "Itu membahayakan bagi diri sendiri dan pengguna jalan yang lain," katanya. (ook) Mereka akan berpatroli sekitar pukul 02.00, atau menjelang sahur. Sambil berpatroli, mereka juga bisa membangunkan warga untuk makan sahur. AKBP Iwan Setyawan KASATSABHARA Takut Pelaku Kabur ke Luar Negeri SURABAYA, surya - Warga korban kasus penipuan dan penggelapan 245 sertifikat tanah asal Bangkalan dan Sam- pang, Madura, Rabu (10/7), kembali mendatangi Polda Jatim. Mereka meminta polisi mencekal Hadrawi Mubarok, warga Banyuates, Sampang dan Ko Tjunaidi Wibowo, warga Jl Dukuh, Surabaya, gar tidak kabur ke luar negeri. Kedua orang itu sebelumnya telah dilaporkan para korban ke Polda Jatim sebagai pelaku penipuan dan penggelapan ser- tifikat tanah. “Kami memohon Polda Jatim supaya melakukan pencekalan terhadap dua orang ini. Sebab, kami mendapat ka- bar bahwa Hadrawi hendak ke Arab Saudi, dan Ko Tjunaidi ke China,” ujar Rohman Hakim, pengacara korban penipuan saat di Mapolda Jatim. Supaya kedua orang yang diduga pelaku penggelapan ser- tifikat tanah yang nilai totalnya sekitar Rp 500 miliar itu tidak kabur ke luar negeri, para kor- ban berharap polisi segera ko- ordinasi dengan pihak Imigrasi agar secepatnya mencekal me- reka. “Para korban sangat kha- watir dua pelaku utama tersebut melarikan diri. Karena itu, kami layangkan surat permohonan cekal ini,” tandasnya. Terkait penanganan perkara- nya, Rohman menyampaikan beberapa perkembangan. Di antaranya, telah dilakukan gelar perkara di Polres Bangkalan yang juga dihadiri penyidik Pol- da Jatim, Irwasda dan Propam Polda Jatim, Senin (8/7). Bahkan, beberapa petugas juga datang langsung ke lokasi tanah dan bangunan yang ser- tifikatnya telah menjadi korban penipuan. Penyidik sempat bertanya dan berkomunikasi langsung dengan para warga yang telah menjadi korban. Selain itu, warga korban peni- puan juga berencana menggelar istighotsah akbar di Bangkalan yang bakal diikuti sekitar 5.000 warga. Mereka bakal mengun- dang Kapolda Jatim Irjen Pol Unggung Cahyono, Pangdam V/Brawijaya, Kapolsek Bang- kalan, para tokoh ulama, akade- misi dan sebagainya. Sebagaimana diketahui, seba- nyak 245 sertifikat tanah milik para korban di 24 kecamatan di Kabupaten Bangkalan dan Sam- pang tak jelas keberadaannya setelah dijaminkan ke Hadrawi pada 2008. Awalnya Hadrawi datang ke warga dan menawar- kan paket kredit lunak jangka pendek dengan bunga yang ringan. Warga pun banyak yang tertarik karena dijanjikan tanpa ada survei dan cukup dengan jaminan sertifikat. Mereka ber- amai-ramai menjaminkan serti- fikat tanahnya untuk mendapat pinjaman Rp 5 juta, Rp 10 juta, bahkan ada yang sampai men- dapat lebih dari Rp 100 juta. Warga rata-rata dikenakan jatuh tempo selama dua tahun. Namun, saat hendak meluna- si utangnya, ternyata sertifikat sulit keluar. Bahkan, belakang diketahui bahwa ratusan sertifi- kat tanah tersebut telah berbalik nama menjadi milik orang lain dan telah dijaminkan di bank BRI cabang Perak Barat Suraba- ya. (ufi) SURYA/HABIBUR ROHMAN MENGAFANI JENAZAH - Mengisi kegiatan selama Ramadan, sejumlah pelajar SMA Muhammadiyah 2 Surabaya, belajar cara merawat dan mengkafani jenazah yang diperagakan dengan manekin pada Ramadan Mubarak 1434 H di sekolah mereka, Rabu (10/7). Perumahan Jadi Sasaran Patroli Sahur Bazar Ramadan di 10 Kawasan surabaya, surya - Untuk menstabil- kan harga kebutuhan, Pemkot Surabaya menggelar Bazar Ramadan di 10 lokasi. Masing-masing di halaman Sentra Ikan Bulak pada tanggal 11-13 Juli, Rusun Ran- du 12-14 Juli, Rusun Penjaringan Sari 13- 15 Juli, Lapangan Gunung Anyar 14-16 Juli, dan di Rusun Grudo 18-20 Juli. Selain itu, bazar juga diadakan di La- pangan Voli Simohilir pada 19-21 Juli, di halaman Kantor Kecamatan Tandes 20-22 Juli, halaman Gedung Pandan Sari Keca- matan Benowo 21-23 Juli, halaman SMP Negeri 11 pada 26-28 Juli serta di Lapang- an Waru Gunung 27-29 Juli. Kepala Dinas Perdagangan dan Perin- dustrian (Disperdagin) Kota Surabaya, Widodo Suryantoro, mengatakan, 10 lo- kasi tersebut mendapat prioritas Bazar Ramadan karena mayoritas penduduk- nya berpenghasilan menengah ke bawah. Hal ini setelah fenomena kenaikan harga kebutuhan menjelang masuknya bulan Ramadan dan Hari Raya Idul Fitri selalu terjadi setiap tahun. "Kondisi tersebut cukup memberatkan sebagian warga terutama yang berpeng- hasilan pas-pasan," kata Widodo, Rabu (10/7). Dalam Bazar Ramadan tersebut, me- nurut Widodo, selain menyediakan ane- ka barang kebutuhan dengan harga yang terjangkau, juga sebagai momen memper- kenalkan produk usaha dari sejumlah pro- dusen dan usaha kecil menengah (UKM) kepada masyarakat. "Jenis produk yang dijual meliputi sem- bako, pakaian, makanan, minuman, akse- soris, buku, kerajinan tangan, dan lain se- bagainya," ucap Widodo. Disperindag sendiri, menurut Widodo, dalam menggelar seluruh rangkaian bazar di bulan Ramadan ini melibatkan sekitar 30 perusahaan produsen dan 122 UKM. “Dan kami berharap rangkaian kegiatan bazar ini dapat dimanfaatkan masyarakat dengan sebaik-baiknya," tutur Widodo. (aru) surya/sri handi lestari berubah pola - Penumpang saat turun dari kapal yang baru tiba di Dermaga Ujung, Pelabuhan Tanjung Perak Surabaya, Rabu (10/7). Korban Penipuan Sertifikat Datangi Lagi Polda■ Korban penipuan dan penggelapan 245 sertifikat tanah asal Madura kembali mendatangi Polda Jatim, Rabu (10/7) Mereka meminta polisi mencegal dua orang yang diduga sebagai pelakunya Sebelumnya mereka telah melapor ke Polda Jatim karena kesulitan sertifikat Ternyata sertifikat itu telah dijaminkan di sebuah bank oleh seseorang. ■ ■ ■ ■ storyhighlights SURABAYA, surya - Pem- bahasan perubahan Raperda Bangunan oleh Pansus DPRD Surabaya menemui jalan buntu. Pansus menganggap pembahas- an besaran denda pelanggar izin mendirikan bangunan (IMB) kurang tepat, karena Rencana TataRuangdanWilayah(RTRW) Kota Surabaya yang baru belum disahkan Bappenas. Ketua Pansus DPRD soal Ra- perda Bangunan, Ine Listiyani mengatakan, raperda bangunan tersebut harus menyesuaikan dengan perda RTRW. Jika RTRW belum disahkan, tapi Perda Ba- ngunan sudah disahkan tentu terjadi ketidak sesuaian. "Tentu akan muncul banyak persoalan nantinya jika Raperda Bangunan telanjur disahkan ternyata ber- tentangan dengan RTRW," kata Ine Listiyani usai raker Pansus, Rabu (10/7). Atas kekhawatiran tersebut, pansus mengambil keputusan untuk menghentikan sementara pembahasan raperda bangunan sampai ada kepastian hasil ko- ordinasi dengan bagian hukum Kemendagri. Sementara itu, Dinas Cipta Karya dan Tata Ruang (DCKTR) akan secepatnya koordinasi de- ngan bagian hukum Kemen- dagri. Plt Kepala Dinas Cipta Karya dan Tata Ruang (DCKTR) Pemkot Surabaya, Eri Cahyadi mengatakan, sebetulnya Raper- da Bangunan tersebut hanya terkait retribusi denda bangun- an yang tidak memiliki IMB. Dengan demikian tidak ada ka- itan antara raperda bangunan dengan persoalan RTRW Kota Surabaya yang belum disetujui Bapenas. (aru) Dewan Stop Pembahasan Raperda Bangunan surya/m Taufik doyan judi - Empat pejudi nekat yang diamankan di Polsek Karang Pilang, Rabu (10/7). Kesulitan Ungkap Identitas Mayat Pria Dalam Karung surabaya, surya - Polisi masih kesu- litan mengungkap kasus penemuan mayat pria muda dalam glangsing atau karung yang ditemukan di pinggir sungai Wono- kromo. Wakasatreskrim Polrestabes Surabaya, Kompol Hartoyo, mengatakan bahwa pi- haknya masih kesulitan untuk menemukan identitas korban. ”Identitas korban belum kami temukan, identitas korban sangat ber- guna untuk mengungkap kasus ini,” kata Hartoyo, Rabu (10/7). Menurutnya, berdasarkan hasil visum, korban mengalami remuk di rahang kanan, dubur rusak, wajah memer, dan badan ha- ngus. Diduga korban meninggal pada pukul 23.00 hingga 05.00. Mengenai rusaknya dubur korban, Har- toyo tak mau berspekulasi, apakah itu dika- renakan korban sodomi atau akibat benda tumpul. Hingga saat ini, polisi telah melakukan pemeriksaan terhadap delapan saksi. Sak- si-saksi tersebut adalah orang yang melihat kantung mayat tersebut saat ditemukan. Dugaan sementara, pembunuhan ini dila- kukan lebih dari dua orang. Diduga pelaku dan korban merupakan satu kelompok. Adapun ciri-ciri yang ditemukan di tubuh korban dalah memiliki tato di lengan kanan- nya. Tapi, karena bekas terbakar, tato terse- but jadi kabur. Selain itu, di jari tangan kana- nya mengenakan cincin perak dengan mata warna hijau dan lidahnya ditindik. "Sejauh ini belum ada keluarganya yang datang. Karena itu, belum diketahui identi- tas atas mayat tersebut,” sambung Kapolsek Wonokromo, AKP Roman Smaradhana El- haj. (ook/ufi) surabaya, surya - Meski puasa baru memasuki hari pertama, namun PT Angkutan Sungai Danau dan Penyebe- rangan (ASDP) sudah mem- berlakukan pola baru untuk pelayanan penyeberangan rute Dermaga Ujung menuju derma- ga Kamal, Bangkalan. Hal itu diungkapkan Manajer Usaha PT ASDP, Wildan Jazuli, di sela penyambutan rombongan Kapolda Jatim bersama tim dari komisi III DPR RI yang melaku- kan pantauan jalur mudik wila- yah Kota Surabaya, Rabu (10/7). “Mulai hari ini atau H-30, kami sudah melakukan pola baru dengan mengoperasikan enam kapal,” jelasnya. Enam kapal itu, polanya, empat operasional di siang hari. Dua operasional di malam hari. Pola ini berlangsung hingga H- 7. Pada H-7, pola akan diganti, dengan menyiagakan seluruh enam kapal ini agar siap ope- rasional selama 24 jam. Hal ini berdasarkan estimasi kenaikan jumlah penumpang yang akan menggunakan jasa kapal pe- nyeberangan sebesar 5 persen atau rata-rata per hari mencapai 12.000 sepanjang H- 7 hingga H + 7 mendatang. “Kalau kondisi saat ini sih, hari biasa rata-rata antara 5.000 hingga 7.000 penumpang. Me- mang dibandingkan dengan sebelum ada Jembatan Surama- du, jumlahnya bisa mencapai puluhan kali limpat. Sementara saat ini tinggal sekitar 30 persen- nya saja. Namun Yuli, begitu Wildan Jazuli biasa disapa, mengaku optimistis masih akan banyak warga yang memanfaatkan fasilitas kapal penyeberangan Ujung-Kamal yang ditempuh dalm waktu 45 menit ini. “Tetap optimis. Kita kan tidak bisa berhenti. Tetap harus me- nyediakan. Toh masyarakat bisa mendapatkan pilihan lain trans- portasi untuk ke Madura sesuai kenyamanan mereka,” jelas Yuli. Sementara itu, prediksi pun- cak kenaikan penumpang Le- baran melalui Dermaga Ujung, diperkirakan pada H-1 dan H+3. Selama dua hari tersebut penumpang penyeberangan di- prediksi mencapai 12.000. Jum- lah itu lima persen lebih banyak dibanding jumlah penumpang tahun lalu. Bila melihat kalender, Yuli menegaskan, kebiasaan pe- numpang penyeberangan tidak sama dengan angkutan lain- nya. ”Idealnya terjadi kenaikan pada tanggal 3 dan 4 Agustus atau akhir pekan. Tetapi kami memperkirakan, justru pada H- 1 itulah akan terjadi gelombang mudik,” tegasnya. Khusus mulai H-7 hingga H + 7, untuk meningkatkan keaman- an dan kenyamanan pemudik di Dermaga Ujung, PT ASDP ber- sama pihak terkait di kawasan dermaga ujung akan mendirikan posko gabungan dari unsur TNI AL, Polri, Gapasdap, Pelabuhan IndonesiaIII,OtoritasPelabuhan dan Kantor Kesyahbandaran Utama Tanjung Perak. (rie) Operasionalkan Enam Kapal di Ujung-Kamal join follow @portalsurya
  • 14. HALAMAN 11 | | KAMIS, 11 JULI 2013 Culinary | Ayam Bakar Wong Solo AMUN, bagi yang ingin me- nikmati menu lain tidak usah khawatir. Pasalnya, Ayam Bakar Wong Solo juga sudah menyiapkan beragam menu pilihan. Untuk sayu- nya ada Oseng-Oseng Kikil, Oseng- Oseng Tempe, atau Oseng-Oseng Teri Lombok Ijo. Selain itu, juga ada Sambal Lado Cumi, Sambal Lado Terong, dan Sambal Lado Pete. “Untuk tumisan ada kangkung, sedang menu lainnya yaitu Tahu Tempe Goreng atau Tahu Tempe Penyet,” ujar Wawan, Perwakilan Ayam Bakar Wong Solo, Jl Walikota Mustajab, Surabaya. Masih kurang? Ayam Bakar Wong Solo ini juga menyediakan menu seafood yang disajikan dalam kemasan Nasi Goreng Seafood, dan Mie Goreng Seafood. Menurut Wawan, selain menu utama tersebut, yang banyak diincar pengunjung Ayam Bakar Wong Solo adalah sambal. Di resto ini tersedia beragam sambal, seperti Sambal Tera- si Mentah, Sambal Matang, atau Sambal Cabe Ijo yang semuanya siap disantap dalam keadaan fresh, alias langsung dibuat pada saat ada pemesanan. Menu sambal ini jadi andalan lantaran jaminan rasa pedasnya. “Pokoknya, kalau ada yang sedang sakit flu, hidung tersumbat, pasti plong setelah menikmat sambal ini,” cetus Wawan. Sebagai penyegar, Ayam Bakar Wong Solo menawarkan aneka minuman yang me- legakan dahaga. Pilihannya antara lain Es Blewah, Es Alpukat, Soda Gembira, Es Buah, dan Es Campur. Khusus Es Campur, disamping ada cao, tape singkong, dan coco pandan, di dalamnya ada pula kacang merah dan jagung manis. “Ini minuman kesukaan saya kalau ke sini. Rasa jagung manisnya benar-benar spesial,” ujar Sandriana, ma- hasiswi sebuah perguruan tinggi swasta yang mengaku sering mengajak teman- temannya mampir makan di Ayam Bakar Wong Solo di Jl Walikota Mustajab itu sepulang kuliah. Untuk jenis milk shake, resto yang sudah merambah di banyak kota besar bahkan di Malaysia dan Singapura ini menyajikan Melon Milk Shake, Orange Milk Shake, dan Strawberry Milk Shake. (pra) Dari GuruSMA Sukses Jualan Ayam A YAM Bakar Wong Solo berawal dari perjalanan panjang Puspo Wardoyo. Sempat menjadi guru SMANegeri di Blabak, Muntilan, Jawa Tengah, pria kelahir- an Solo ini menjajal peluangnya berwiraswas- ta saat hijrah ke Medan pada tahun 1991. Hanya dengan modal awal Rp 700.000, Puspo pun membuka lapak kaki lima di pinggir jalan di SMA II Padang Golf Polonia, Medan. Ketika itu label Ayam Bakar Wong Solo sudah digunakan. Berkat ketekunan, ketangguhan, serta ketaqwaannya, Puspo berhasil mengem- bangkan usahanya hingga kini jadi 12 merek. Disamping Ayam Bakar Wong Solo, label brand lain yang berada dalam bendera Puspo adalah Ayam Penyet Surabaya, Ayam Goreng Lombok Ijo, Ayam Kq-5, Mie Ayam Kq-5, Mie Jogja Pak Karso, Mie Kocok Mang Uci, Mie Ayam Jamur, Iga Ba- kar Mas Giri, Steak Kq-5, Raja Sate, Gudeg Muntilan Mbok Jayus dengan 127 outlet tersebar di Indonesia, sedang di Malaysia ada lima, dan satu lagi di Singapura. “Dalam waktu dekat kami buka juga di Saudi Arabia dan Australia,” kata Puspo. Di Jawa Timur, Wong Solo Grup ada enam brand, yaitu Ayam Bakar Wong Solo di sembilan outlet di Malang, Sidoarjo, Jem- ber, Gresik, Jombang, Surabaya, Madiun, dan Mojokerto. Sedang Ayam Penyet Suroboyo ada em- pat outlet, yaitu di Malang, Madiun, Kediri, dan Gresik. Untuk Iga Bakar Mas Giri dan Mie Jogja Pak Karso masing-masing ada satu outlet di Malang. Ada pula Mie Kocok Mang Uci di Ma- diun dan Surabaya. Dan Gudeg Muntilan Mbok Jayus satu outlet di Kediri. Apa kunci sukses Wong Solo Grup? Puspo lalu mengutip Alquran surat Al Mukminun yang intinya orang mukmin yang beruntung adalah yang khusyuk dalam salatnya sehingga timbul jiwa kesalehan sosialnya. “Dia juga harus mampu meninggalkan pekerjaan yang sia-sia. Dengan bekerja keras dia dijamin dapat harta. Dan agar hartanya berkah, halal, serta berlipat ganda, maka dia harus membayar zakat. Sisihkan sebagian harta 10-30 persen untuk fisabilil- lah. Insyaallah dijamin kaya harta dan kaya hati,” tutur Puspo. (pra) DeliveryOrder,SatuMenupunDilayani D ISAMPING total service, Wong Solo Grup memiliki standarisasi bumbu hingga kesamaan rasa di antara outlet dengan merek (brand) yang sama bisa terjaga mutunya. “Karena itu menu di Wong Solo Grup dapat dinikmati siapa saja tanpa harus jauh-jauh keluar dari kota tempat tinggalnya,” ungkap Wawan. Lantaran standarisasi itu pula, menu sajian Wong Solo Grup siap bersaing dengan resto lainnya. “Meski menunya sama, tetapi cita rasanya beda dengan warung sejenis,” ujar Wawan. Menurut Wawan, outlet-outlet Wong Solo Grup juga melayani nasi kotak, baik dalam partai besar maupun kecil dan harga terjangkau. Untuk nasi kotak ini bervariasi sesuai selera, dapat memilih sesuai menu paket maupun ditambah menu lain yang tersedia. Bagi yang tak sempat keluar rumah, atau kantor misalnya, Wong Solo Grup juga menerima layanan antar. “Tidak ada batasan minimal. Bahkan pesan satu menu pun kami layani,” tutur Wawan sambil menambahkan catatan pemesan di sekitar alamat outlet terdekat. (pra) Nama Ayam Bakar Wong Solo tentu sudah tak asing. Rasanya yang khas membuat paket menu ayam bakar maupun ayam gorengnya disuka pehobi kuliner. Di Ayam Bakar Wong Solo ini tersedia beragam sambal, seperti Sambal Terasi Mentah, Sambal Matang, atau Sambal Cabe Ijo yang semuanya siap disantap dalam keadaan fresh, alias langsung dibuat pada saat ada pemesanan. Hidung Tersumbat JadiPlong “Dia juga harus mampu meninggalkan hati,” tutur Puspo. (pra) FOTO-FOTO: SURYA/PRAMUDITO/DOKUMEN AYAM BAKAR WONG SOLO ada batasan minimal. Bahkan pesan satu sambil menambahkan catatan pemesan di Cabang Surabaya (031) 5344655 Cabang Malang (0341) 325326 Cabang Kediri (0354) 7003770 join follow @portalsurya
  • 15. 12 | GRESIKPLUS KAMIS, 11 JULI 2013 | tuban, surya - Dalam sepe- kan, Polres Tuban menerima dua kali laporan pencabulan anak di bawah umur. Laporan pertama, NK (16) mengaku menjadi kor- ban pencabulan Nazirudin (22), warga Sidorukun, Desa Weden, Kecamatan Bangilan hingga me- lahirkan seorang bayi laki-laki. Laporan berikutnya datang dari keluarga MM (15) di Ke- camatan Tambakboyo. Mereka mengaku anaknya hamil tujuh bulan karena dicabuli tetangga mereka sendiri, Narto (26). "Kor- ban (MM) yang masih kelas 2 SMP ini dicabuli tersangka hing- ga hamil tujuh bulan," kata AKP Wahyu Hidyat, Kasat Reskrim Polres Tuban, Rabu (10/7). Wahyu mengatakan perbu- atan pencabulan Narto ini ber- langsung sejak Januari lalu. Saat itu MM yang masih bertetangga itu resmi menjalin hubungan terlarang dengan pria asal Desa Pabean, Kecamatan Tambakbo- yo. MM sering menyambangi rumah Narto sepulang sekolah. Kesempatan ini kemudian di- gunakan Narto untuk menyetu- buhi MM hingga sembilan kali, lalu MM hamil tujuh bulan. "Kehamilan korban ini ter- bongkar ketika orang tua kor- ban curiga dengan kondisi perut anaknya. Setelah didesak MM bercerita, lalu kasus ini dilapor- kan pada kami," kata Wahyu. Nartokemudianditangkappo- lisi di rumahnya dan dijerat Un- dang-Undang No 23 Tahun 2002 tentang pencabulan anak diba- wah umur. Ancaman hukuman- nya 12 tahun penjara. (dri) gresik, surya - Dinas Sosial Kabupaten Gresik meng- aku tidak dilibatkan dalam pendataan keluarga miskin yang berhak menerima dana Bantuan Langsung Sementara Masyarakat Mandiri (BLSM). Data langsung dari Pusat ke- mudian diturunkan ke Kantor Pos Kabupaten. "Jika ada masyarakat yang mengeluh karena tidak terima BLSM, Dinsos tidak bisa ikut mengecek karena Dinsos tidak dilibatkan dalam pendataan penerima BLSM, sehingga banyak penerima dana BLSM yang salah sasaran," kata Agus Budiono, Kepala Dinsos Kabu- paten Gresik, Rabu (10/7). Diberitakan sebelumnya, belasan warga Kelurahan Si- dokumpul, mendatangi Kan- tor Kelurahan lantaran tidak mendapatkan dana BLSM, padahal mereka dari golongan yang tidak mampu. Untuk menyelesaikan permasalahan ini, Kementerian Sosial akan mengadakan pertemuan Dinsos se Indonesia untuk memberi masukan tekenis data penerima dana BLSM agar tepat sasaran. Penyalur Dana Sementara, Kepala Kantor Pos Cabang Gresik Iwan Andri Wijanarko, mengatakan bahwa Kantor Pos Cabang hanya me- nyalurkan dana BLSM. Data juga langsung dari Pemerintah Pusat. Beberapa Kecamatan yang sudah dapat dana BLSM, antara lain, Balongpanggang, Benjeng, Manyar, Kedamean, Driyorejo, Cerme, wringinanom dan Sidayu. Sampai harin ini sudah 50 ribu orang lebih dari total war- ga 77.751 orang yang sudah te- rima BLSM. "Ada warga yang tidak mengambil dana BLSM, kemungkinan warga tersebut sudah mampu," imbuhnya. (st38) b eberapa kendaraan me- mang nekat melintasi jalur itu karena memang hendak menuju areal lahan sawah yang ada di timur dan barat ring road. Atau warga Deket yang menca- ri jalan pintas menuju kota atau sebaliknya. Jalan lingkar itu kini kondisinya rusak parah membuat pengguna jalan kerepotan, lantaran harus berjalan zig – zag mencari celah jalan yang bisa dilintasi. Sementara jika turun hujan, ring road itu menjadi jalan mati. Tidak ada satu pun kendaraan --roda dua ataupun roda empat-- yang mau melintas. Selain jalan sulit dilalui, tanahnya berlumpur sehingga roda kendaraan dipastikan berlepotan tanah yang sangat kotor. “Kalau dulu masih bisa dilewa- ti. Baik hujan maupun kemarau tidak ada masalah lewat ini jalan ring road. Tapi kalau sekarang, selain merusakkan kendaraan yang melintas juga sangat sulit untuk dilewati," ungkap Sunaryo warga Tambakboyo kepada Surya, Rabu (10/7). Sebelum kondisinya hancur seperti sekarang ini, jalan lingkar banyak dimanfaatkan untuk belajar mengemudi, baik belajar menyetir sepeda motor maupun mengemu- di mobil. Tapi pemandangan itu sekarang tidak lagi bisa dijumpai. Jangankan untuk pengemudi pe- mula atau dipakai belajar menge- mudi, mereka yang sudah mahir mengemudi pun menghindari jalan lingkar itu. "Mau lewat situ resiko- nya sangat tinggi, selain kendaraan rusak karena tersangkut batu dan terperosok, juga kotor," gerutu sa- lah seorang warga Deket. Keberadaan lampu penerangan jalan umum (PJU) yang terpasang sepanjang ring road juga dinilai warga mubazir. Siang hari saja masyarakat kerepotan melintas, apalagi pada malam hari. Parahnya ring road itu karena tidak tersentuh perbaikan. Jalan hancur dan berle- potan tanah liat yang muncul ke permukaan. Warisan Faried Tiga tahun lalu, jalan ring road yang mulus itu pernah dimanfa- atkan untuk jemuran tinja. Kini ring road penuh kubangan besar dan dalam. Ring road peninggalan pemerintahan saat bupati R M Faried SH itu dibangun pada 1990. Jalan lingkar itu semula dimak- sudkan untuk mengurai kepa- datan arus lalu lintas yang terjadi di sepanjang jalan raya pertigaan Dekat hingga pertigaan tugu Adi- pura Jl Lamongrejo- Jaksa Agung menuju kota hingga Babat. Namun langkah pemerintah membangun ring road kini sia – sia. Bahkan masyarakat yang memiliki sawah di kanan – kiri sepanjang jalan ring road ada yang memberanikan diri memanfaatkan jalan tersebut untuk jalur pintas mengairi air ke lahan sawah mereka. Air dari barat jalan dialirkan ke timur dan sebaliknya. "Dinas PU Bina Marga mesti- nya bisa mengalokasikan dana perawatan untuk ring road. Ini juga banyak dimanfaatkan masya- rakat,"cetus Suamah, salah satu warga. Sayangnya, Kepala Dinas PU Bina Marga Supandi sulit diak- ses. Beberapakali ponsel miliknya sudah dihubungi Surya, namun ponsel itu tidak pernah aktif. (ha- nif manshuri) Endus Politik Uang Pilwali mojokerto, surya - Suasana makin panas pascapenetapan 6 pasangan bakal calon menjadi calon wali kota dalam Pil- wali 29 Agustus 2009. Salah satu pasangan independen, Drajat Stariadji, saat ini telah mencium indikasi praktik politik uang (money politics). "Ada pihak kandidat lain yang terang- terangan berani memberi uang lebih tinggi. Ada yang bilang, kalau ada yang berani membagi uang Rp 10.000, kandidat itu sanggup membagi Rp 20.000 dan seterus- nya. Ini kan indikasi kuat akan praktik money politics. Tapi kami tak mau tunjuk hidung," kata Drajat, Rabu (10/7). Drajat yang berpasangan dengan Yanto (salah satu Kades) meminta kepada Pan- waslu dan KPUD bekerja profesional. Dra- jat bersama timnya akan membentuk tim khusus untuk mengawal praktik money politics tersebut. Tim ini yang akan me- mantau cara berdemokrasi kandidat lain soal politik uang. Tim yang dinamakan tim Predator ini juga siap melaporkan ke Panwaslu jika terjadi money politics. Dia berharap semua kandidat agar berdemokrasi mencari du- kungan suara dengan demokratis. Tak diko- tori dengan politik uang. "Kalau saya pakai uang, darimana dapat uang," kata Drajat. Labih jauh pasangan Drajat Stariadji- Yanto (DY) mengklaim bahwa hanya di- rinya yang layak menjadi pesaing utama pasangan incumbent Mas'ud Yunus-Suyit- no (MY). Berkali-kali, Drajat menegaskan bahwa hanya dirinya dan pasangan MY yang saat ini memiliki massa riil. "Bagi kami, hanya saya dan MY yang nanti akan berebut ketat perolehen suara. Sebab, kami dan MY memilki massa riil dengan loyalis tinggi," ungkap Drajat, Selasa (9/7). Peta Kekuatan Pernyataan Drajat bisa jadi tepat. Ang- gota dewan tiga periode dari partai PKPI ini memetakan kekuatan atas dirinya dan MY. Drajat dikenal tokoh masyarakat yang memiliki basis massa di bawah yayasan sosial Mojopahit. Sebuah lembaga sosial untuk para kaum marjinal dan penyakit masyarakat. Ini dibuktikan saat dirinya harus meme- nuhi dukungan KTP sekitar 10.000 lembar. "Sebenarnya dengan lolosnya saya sebagai calon wali kota adalah sudah kemenangan. Kemenangan awal. Tapi harus diikuti ke- menangan berikutnya. Saya yakin dengan massa riil saya," kata Drajat. Drajat bersama tim pemenangannya yakin jika Pilwali berjalan fair, tanpa ke- curangan, dan tidak melakukan money politic membabi buta, dirinya yang akan membuntuti perolehen suara MY dalam Pilwali 29 Agustus 2013. "Untuk itu, kami mendesak agar Panwas- lu dan KPUD benar-benar bekerja serius. Semua harus berjalan fair tanpa money politic," tantang Drajad. Sementara itu Calon pasangan lainnya, Ayub Busono-Mulyadi (Abdi) tak ingin terlena dengan situasi menjelang coblosan Pilwali Mojokerto. Banyak pasangan calon mengklaim didukung kaum loyalis dan suara riil. Abdi sendiri juga mengaku ba- nyak dukungan untuk dirinya. Meski dia enggan menyebutkan secara detail pendu- kung riil ini. Kepada Surya, Mulyadi menuturkan bahwa dukungan untuk dirinya dan Ayub makin banyak. "Tapi kami tak akan terlena dengan situasi apa pun. Kami tetap fokus pada pemenangan kami sendiri," ujar Mu- lyadi. (fai) Hampir sekitar 20 tahun jalan lingkar (ring road) dari Tambakboyo – wilayah Deket sepanjang 2,8 km menjadi jalan altrenatif bagi para pengguna jalan, utamanya ma- syarakat Deket Kulon dan masyarakat lainnya. Namun sejak dua tahun terakhir ini masyarakat enggan melintas di jalan lingkar itu. Mengapa? Infrastruktur Jalan Ring Road yang Tidak Dirawat Pengemudi yang Mahir Ogah Lewati Jalur Itu surya/adrianus adhi truk terguling - Sebuah truk diesel K 5212 AC memuat bahan bangunan dari Surabaya tujuan Tuban menabrak pohon, lalu terguling di jalur Pantura Jatim, di Jl HOS Cokroaminoto, Rabu (10/7). Tidak ada korban jiwa. Tampak warga mengevakuasi barang bahan bangunan. Dinsos Tak Terlibat Pendataan BLSM surya/hanif manshuri jalan RUSAK - Jalan lingkar Tambakboyo dan Kecamatan Deket, Lamongan, rusak parah sepanjang 2,8 Kilometer, padahal baru dibuka dua tahun lalu. Sepekan, Dua Pencabulan Calon Independen Lawan Inkumben■ Enam bakal calon wali kota Mojokerto sudah ditetapkan oleh KPUD Kota Mojokerto Pasangan Independen Drajad - Yanto tantang Inkumbent Mas'ud Suyitno karena klaim sama-sama memiliki massa riil Cawali Drajad - Yanto mencium ada politik uang jelang Pilwali Mojokerto Pasangan Cawali Ayub Busono - Mulyadi low profile menyikapi pilwali ■ ■ ■ ■ storyhighlights lamongan, surya - Sete- lah mengungkap klinik kesehat- an di Babat yang tak memiliki izin. Kini muncul lagi permasa- lahan serupa. Klinik Assalam, sebuah pelayanan kesehatan swasta di Kecamatan Maduran, Lamongan, kedapatan belum memiliki tiga ijin sekaligus. Sementara sudah sejak lama Klilik Assalam beroperasi meski tanpa mengantongi izin. Kli- nik tanpa izin ini menambah panjang klinik kesehatan yang beroperasi tanpa ijin. Sedangkan Klinik Assalam ini terjaring saat tim operasi penertiban yang ter- diri dari anggota Satpol PP dan Dinas Kesehatan menyisir Keca- matan Sekaran dan Maduran. Dari hasil penyisiran petugas sejak sepekan ini, tim itu menda- pati empat pelayanan kesehatan swasta yang membuka kegiatan serupa. Dua klinik kesehatan berada di Kecamatan Sekaran dan dua unit usaha lainnya ber- ada di Kecamatan Maduran. Namun dari empat pelayanan kesehatan swasta tersebut, ha- nya satu unit usaha klini yang kedapatan tidak memiliki izin, yakni Klinik Assalam. "Dokter Irwan selaku pemilik usaha sudah kami beri peringatan pertama agar segera melengkapi izin," tegas Kepala Satpol PP Tony Tamtama Jati, Rabu (10/7). Pihak Satpol PP Kabypaten Lamongan mengancam, jika su- rat peringatan pertama ini tidak ditanggapi serius dengan peng- urusan izin, artinya pemilik nya- ta-nyata tidak mau mengurus se- mua perizinan. "Jika peringatan pertama diabaikan, maka tidak menutup kemungkinan Pemkab akan melakukan tindakan lebih tegas dengan cara menutup pe- layanan kesehatan swasta yang bersangkutan. Untuk saat ini cukup surat peringatan untuk segera melengkapi segala per- izinan," kata Tony. Tiga Perda Klinik Assalam ditengarai tidak hanya melanggar satu perizinan saja, melainkan ada tiga perizinan sekaligus yang belum dilengkapi sebagiamana diatur dalam tiga peraturan daerah terkait izin usaha klinik kesehatan. Tiga aturan yang dilanggar itu, yakni Perda Nomor 06 tahun 2007 tentang Bangunan di Kabupaten Lamongan dan Perda 02 tahun 2012 tentang Ijin Gangguan (HO). Juga be- lum memiliki Perda nomor 10 tahun 2009 tentang Retribusi Penyelenggaraan Pelayanan Kesehatan Swasta. Menurut Tony, pemkab sama sekali tidak bermaksud mem- persulit berdirinya layanan kesehatan oleh pihak swasta. Se- mua mempunyai hak yang sama untuk berusaha. Tapi, tandas- nya, yang penting segala macam persyaratan harus dipenuhi. Apalagi pelayanan kese- hatan juga sangat dibutuhkan masyarakat. "Tapi kalau tidak ada izin dan tidak ada itikad mengurus izin pasti akan kami tidak segan-segan menutup usaha klini kesehatan itu," tan- das Tony. (st36) Satpol PP Razia Klinik Tak Berizin Klinik Assalam Langgar 3 Perda■ surya/moch sugiyono dana blsm - Belasan warga Kelurahan Sidokumpul, Gresik, mela- porkan ke kejanggalan penerima BLSM, Selasa (9/7). TAHUKAH Anda beberapa bentuk Gastritis kronis dapat meningkatkan risiko kanker lambung dan jika dibiarkan tidak terawat dapat menye­ babkan peptic ulcers dan pendarahan pada lambung? Bagi Anda yang menderita maag, kini tak usah ragu me­ milih Gentong Mas sebagai solusi cerdas untuk mengatasi keluhannya. GentongMas adalah minu­ man herbal dengan kan­ dungan vita­ min dan nutrisi bermutu.Bahan utama Gentong Mas yaitu Gula Aren dan Nige­ lla Sativa (Hab­ batussauda) terbukti memi­ liki banyak manfaat untuk kesehatan. Habbatussauda bermanfaatuntukmemelihara pembuluh darah, perbaikan sistem saraf, optimalisasi ak­ tifitas hormon, meningkatkan proses penyembuhan dinding lambung, meningkatkan daya tahan tubuh dan bersifat anti bakteri. Selain itu juga, Hab­ batussauda dapat mengatasi gangguan tidur dan relak­ sasi. Cabe Jamu yang terdapat dalam Gentong Mas ber­ manfaat untuk mempercepat penyembuhan mukosa lam­ bung. Sedangkan kandungan yang terdapat dalam Kayu Manis bersifat anti kembung dan mules. Kapulaga dalam Gentong Mas bermanfaat sebagai anti muntah serta radang lambung. Dan Gula Arenbermanfaatuntukmenu­ runkan penyerapan lemak dan perbaikan sistem saraf. Sugeng Wahyudi (46 thn) adalah salah seorang yang telah membuk­ tikan manfaat h e r b a l i n i , “20 tahun la­ manya aktifitas saya terganggu karena maag. Perut sering terasa kem­ bung, ulu hati nyeri, muntah, dan kepala terasa pusing, tidak nyaman sekali rasanya.” Terang ayah 3 anak terse­ but. Bertahun­tahun bero­ bat, akhirnya ia tahu solusi yang tepat, “Untuk mengatasi maag, sekarang saya memilih minum Gentong Mas.Ternya­ ta, setelah minum selama 1 tahun, kini sakit maag jarang kambuh, keluhannya pun tidak saya rasakan lagi. Saya sudah merasakan manfaatnya sejak minum kotak pertama.” Ungkap PNS tersebut. Gastri­ tis atau lebih dikenal sebagai maag berasal dari bahasa Yu­ nani yaitu Gastro, yang berarti perut/lambung dan Itis yang berarti inflamasi/peradangan dengan gejala­gejala seperti perih atau sakit seperti ter­ bakar pada perut bagian atas yang dapat menjadi lebih baik atau lebih buruk ketika makan, mual, muntah, ke­ hilangan selera, kembung, terasa penuh pada perut ba­ gian atas setelah makan, ke­ hilangan berat badan. Karena telah merasakan manfaatnya, Sugeng berharap semoga pengalaman baiknya dapat bermanfaat bagi orang lain, “Mudah­mudahan pengala­ man saya yang mendapat kesehatan dengan cara alami bermanfaat bagi orang lain.” Pungkas warga Ds. Srandil, Kec. Jambon, Kab. Ponorogo, Jawa Timur tersebut. Manfaat yang hebat bagi kesehatan dan rasa yang lezat membuat semakin banyak masyarakat yang mengkon­ sumsi Gentong Mas. Untuk informasi lebih lanjut silahkan kunjungi Bagi Anda yang membu­ tuhkan Gentong Mas bisa didapatkan di apotek/toko obat terdekat atau hubungi: 14047 24 jamTarif lokal: (Tlp Rumah dan CDMA), SMS ke: 08.1122.14047 D E P K E S R I P ­ I R T: 8123205.01.114. (ikl) Sakit Maag Sudah Tidak Dirasakan Informasi Pemasangan Iklan Hubungi : Hakim - 0812345 94787 | Meidy - 031 83356990 join follow @portalsurya
  • 16. | | KAMIS, 11 JULI 2013 HotLinePublicService Reinhard Yeremia Mahasiswa Ilmu Komunikasi Universitas Airlangga Surabaya Penelusuran Nielsen Audien- ce Measurement menemukan, 94 persen masyarakat Indonesia me- ngonsumsi media melalui televisi. Hal ini menjadikan potensi bagi pembuat produksi media menam- pilkan karyanya melalui televisi. Berbagai program dibuat untuk menarik penonton. Salah satu yang menarik perhatian adalah program berunsur komedi. Mulai dari sinetron, talk show, hingga acara hiburan berkonten komedi. Faktanya, program kome- di di Indonesia terkadang tak mencerdaskan sama sekali dan menciderai konsep masyarakat multikultur yang menghormati perbedaan dan menempatkan diri pada posisi setara. Terbuk- ti, banyak laporan ke Komisi Penyiaran Indonesia (KPI) karena lawakan berbau diskriminasi, penokohan yang melecehan dan menyudutkan terkait SARA. Selain itu, adegan saling me- nyakiti justru menjadi hal lucu. Padahal dalam jangka panjang dapat memicu penonton kecil untuk menirukan hal tersebut. Hal ini jelas merugikan. Program yang semula digunakan sebagai hiburan justru menimbulkan konflik karena kontennya tak mendidik. Padahal salah satu hak warga negara adalah untuk mendapatkan hiburan yang sehat. Sebagai konsumen yang cerdas, selayaknya mengawal ber- bagai tayangan, termasuk tayangan komedi agar tetap sehat untuk dikonsumsi. Menyambut bulan Ramadan, media berlomba membuat konten bertema Ramadan. Banyak iklan makanan, minuman dan berbagai program baru terkait ramadan. Selayaknya masyarakat lebih cer- das memaknakan gambar, simbol atau bahasa yang ditayangkan te- levisi. Penonton dapat melakukan filtrasi tayangan yang sehat dan layak untuk dikonsumsi. KomedianIndonesiasepatutnya lebihcerdaslagimemerankantokoh- tokohtertentu.Menjagaperilaku danpembicaraan.Taksembarangan berbicaraapalagiberolok-olokberle- bihan,karenasetiaptampilanmereka akandirepresentasikansendirioleh khalayak. Mendapatkanhiburan yangsehatadalahhaksetiapwarga negara.Namun,menjadipenonton yangcerdasadalahpilihan. (http://surabaya.tribunnews. com/2013/07/06/penonton- yang-cerdas) Veteran Dalam atau dising- kat Vetdam hanya gang kecil di Kota Malang. Laiknya gang pada umumnya, Vetdam pun tak terlalu istimewa bila tak ada es pak Kumis. Es pak Kumis pun sama dengan es lainnya yang banyak dijajakan di Ma- lang. Es cendol berkuah santan, dengan campuran tape, cincau, rumput laut, agar-agar, aneka buah dan siraman sirop. Yang menjadikan es pak Kumis berbeda pada cara penyajiannya karena Pak Kumis membebas- kan pembelinya melade- ni dirinya sendiri alias prasmanan. Pembeli yang mayoritas mahasiswa itu bebas meracik sendiri es dengan isi berbeda.Ada yang suka es cendol, ada yang doyan es buah, atau puas dengan es cincau. Ada yang mengambil ba- nyak dan ada yang meng- ambil secukupnya sesuai porsi perut mereka. Tak hanya itu saja, pak Kumis juga membiar- kan pembeli membayar sesukanya dengan pa- tokan tarif bawah Rp 2.500 per porsi. Atau, bayar sesuai takaranmu! Pak Kumis juga membebaskan pembeli mengambil sendiri uang kembaliannya! Bersikap jujur dan adil yang diterapkan di kedai es prasmanan vetdam Pak Kumis ini membuat es Pak Kumis terasa berbeda citarasanya. Coba saja! ( uniknya-es-prasmanan) awal puasa Ramadan tahun ini kembali terjadi perbedaan. Pendapat rukyat fi wilayatul hukmi dan hisab imkan rukyat menetapkan awal puasa pada Rabu (10/7/2013) karena hilal masih terlalu rendah untuk di- rukyat dan bekum memenuhi kriteria imkan rukyat. Sedang hisab wujudul hilal dan rukyat global menetapkan awal puasa pada Selasa (9/7/2013) karena eksistensi hilal sudah ada se- dangkan di Arab Saudi hilal sudah tinggi. Persoalan hisab rukyat sesungguhnya persoalan sifat ijtihadiyah, tak ada kebenaran mutlak atas sifat ijtihadiyah. Kebenar- annya terkadang bersifat temporal dan situasional. Makna bulan Ramadan adalah untuk menjadi pri- badi yang bersih, santun, dan menjalin silaturrahim. Jadi, meski beda, tak harus mengakibatkan perselisih- an yang menimbulkan citra buruk umat Islam. Karena penetapan awal bulan adalah masalah ke- yakinan beragama yang tak dapat diintervensi. Selain itu paksaan untuk seragam dan mengikuti pemerintah akan bertentangan dengan UUD 1945 terutama pasal 29. Di Indonesia, tidak puasa saja tidak dilarang, mengapa beda puasa jadi masalah? Mari sambut puasa Ramadan dengan santun. Marhaban ya Ramadan. Muh Hadi Bashori SHI Pengasuh Al-Ishlah Islamic Astronomy Club Lamongan (http://surabaya.tribunnews. com/2013/07/10/toleransi- perbedaan) Toleransi Perbedaan Menjadi Penonton Cerdas Bukan meladeni dirinya sendiri, pembeli es Vetdam juga bebas membayar dan mengambil sendiri uang kembaliannya! SUARA PUBLIK Anda punya keluhan atau pendapat terkait pelayanan umum? Jangan pendam sendiri. Anda punya hak untuk bersuara. Kirim SMS ke 083 831 686 299 083 857 517 888 PAKISAJI KEPANJEN PARAH - Jalan Raya Pakisaji - Kepanjen Malang rusak berat. Mohon dinas terkait sgr membenahi krn san- gat berbahaya bg pengendara, sebelum semuanya terlambat! 628560404xxxx SPBU WIYUNG - kpd pimpinan SPBU Wiyung mohon diperbaiki pelayanan operator lapangan, krn sya sdah 2x mengisi bensin Rp 7000 tp sll diisi Rp 100000 dan akhirnya sy hrs bayar lebihnya. Mengecewakan! 628968544xxxx LAMPU PETUNJUK ARAH - mhon utk dinas terkait agar lampu penunjuk arah ke DTC, khusus pasar tradisional diperhatikan krn membahayakan pengunjung, tepatnya di atas tangga depan toko emas krn klau jatuh membuat celaka! 628570622xxxx PDAM RUSAK TROTOR RADEN PATAH - sampai kapan paving di trotoar di jln raden patah mulai depan RSI siti hajar s/d perti- gaan BCF dibiarkan sj berserakan? Hoi PDAM jgan seenaknya sendiri bikin galian lalu meninggalkan! 628385643xxxx MACET PARAH MEDAENG - unt mengurangi kemacetan Me- daeng utama sore hari, apak tidak sebaiknya TL dimatikan sj mengingat kalau TL diaktifkan kemacetan dr jalur Sby ke Mojoker- to malah mengular sampai pintu keluar tol waru. Trima kasih. 628233656xxxx LOBANG BRIGJEN KATAMSO WARU - jln Brigjen Katamso banyak yg berlobang terutama di sebelah kiri jalan sesudah pabrik paku Sidoarjo. 628311771xxxx GUMUKMAS RUSAK PARAH - unt dinas PU Bina Marga, tlong jl. Mayangan, kec. Gumukmas sgr diperbaiki krn sdh rusak sangat parah, dan kendaraan besar spt bis dan tronton yg jd penyebab rusaknya jalan harap dilarang lewat situ dong.. 628213208xxxx SAMBEN KULON GRESIK - unt Bupati Gresik, jalan Samben ku- lon rusak delok'en, uang rakyat tokne gae bngun, ojok di untal dewe ae fendy gaiend samben kulon wringin anom gresik. 628785379xxxx PDAM SURABAYA KEDINDING - unt Dirut PDAM Sby, hampir 2 minggu aliran air di daerah Kedinding dan sekitarnya lemah alias kecil, bahkan td malam jam 03.00 mati, tambah tekanannya dong, wong air gak bisa diminum ae bayarnya mahal. Agus P - Tanah Merah - 628123340xxxx PERON TERMINAL PELABUHAN KAMAL - yth kadinas termnal Bangkalan-Kamal Madura agar menertibkan stafnya yg mungut tarif peron trmnal - pelabuhan Kamal shrusnya Rp 200 dipungut Rp 500 s/d Rp 1000 hingga Rp 2000. Ini meresahkan pak! 628233709xxxx BALEREJO MUNENG MADIUN - mhn dinas PU & Bupati Ma- diun unt memerhatikan jln Balerejo-Muneng yg sdh 7 tahun rusak parah dan hanya ditambal sulam saja, kapan mulusnya pak? 62351767xxxx kapasari surabaya - pembagian BLSM di daerah Kapasari, Surabaya tidak tepat sasaran, yg kaya mendapat bantuan, sedangkan yg miskin yg seha- rusnya dapat namun tidak dapat. Mohon segera disurvey kembali dan dilihat ru- mah, keadaan dan pekerjaan si penerima BLSM yg sesunguhnya sehingga tidak salah sasaran. 628383045xxxx jabon sidoarjo - Pembagian BLSM di Desa Trompoasri, kecamatan Jabon Si- doarjo benar2 tidak tepat sasaran & semra- wut, banyak yg dapat tapi mereka adalah orang2 yg mampu, bahkan yg punya mo- bil pun dapat. Sedangkan yg miskin masih banyak yg gak dapat. 628383121xxxx jururejo ngawi - kemiskinan di Indonesia gak akan berkurang, tanpa adanya lapangan pekerjaan yg tetap. Percuma walau diberi BLSM masih banyak rakyat miskin yg seharusnya dapat bantuan tapi tidak tercantum dalam data penerima BLSM. Khusus- nya di desa kami Desa Jururejo, dukuh Jrubong, kecamatan Ngawi, kabupaten Ngawi, Jatim. 628564570xxxx kraksaan probolinggo - mohon ditinjau ulang pembagian BLSM untuk desa Sidopekso, Kecamatan Kraksaan, Ka- bupaten Probolinggo, Jatim, masih banyak janda tua yg tidak terima BLSM. 628123490xxxx (http://surabaya.tribunnews. com/2013/07/10/mari-awasi-blsm) Mari Awasi BLSM Punya masalah dengan layanan publik, dari gangguan telepon, listrik, air, pajak, parkir, dan layanan umum lainnya? Kirim ke Harian Surya, lengkapi identitas diri dan nomor kontak yang mudah dihubungi. Jl Rungkut Industri III No 68 & 70 Surabaya FAKSIMIL: 031-8414024 Surat : EMAIL : citizen reporter Liput dan tulis sendiri pengalaman atau acara Anda sepanjang 450 kata, lengkapi identitas diri, nomor kontak, dan pas foto diri terbaru. Email ke Uniknya Es Prasmanan SURYA/SUGIHARTO Ajang PROMOSI - Depan Gedung Negara Grahadi di Jalan Gubernur Suryo, Surabaya ini menjadi kawasan strategis pasangan cagub-cawagub berpormosi dan mencari popularitas. Foto diambil Senin (8/7/2013). Dyla Putry Rafitasary Mahasiswa Fakultas Ekonomi Universitas Negeri Malang SEMUA WARTAWAN SURYA DIBEKALI TANDA PENGENAL DAN TIDAK DIPERKENANKAN MENERIMA / MEMINTA APA PUN DARI NARASUMBER. Setiap artikel/tulisan/foto atau materi apa pun yang telah dimuat di Harian Surya dapat diumumkan/dialihwujudkan kembali dalam format digital maupun nondigital yang tetap merupakan bagian dari Harian Surya. HARIAN PAGI Staf Redaksi: Satwika Rumeksa, Tri Yulianto, D Wahjoe Harjanto, Trihatmaningsih, Tri Dayaning Reviati, Eko Supriyanto, Hariyanto, Tri Mulyono, Tutug Pamorkaton, Wahyudi Hari Widodo, Endah Imawati,Yuli Ahmada, M Rudy Hartono, Ahmad Pramudito, Anas Miftahudin, Joko Hari Nugroho, Wiwit Purwanto, Suyanto, Deddy Sukma, Habiburrohman, Adi Agus Santoso, Titis Jatipermata, Fatkhul Alami, Doso Priyanto, Dyan Rekohadi, Sri Handi Lestari, Marta Nurfaidah, Sugiharto, Musahadah, Mujib Anwar, Ahmad Zaimul Haq, Aji Bramastra, Nuraini Faiq, Adrianus Adhi Nugroho, Eko Darmoko, Haorrahman Dwi Saputra, Muhammad Miftah Faridl, Ahmad Amru Muis, Sudarma Adi; Ilustrator: Rendra Kurniawan, Akhmad Yusuf Marzuki; Perwajahan: Teguh Wahyudi, Edy Minto Prasaro, Agus Susanto, Haryoto, Njono, Anang Dwi H, Aloma Irjianto General Manager Business: Agus Nugroho; Wakil General Manager Busines: M Taufiq Zuhdi ; Manager Iklan: Shinta Indahayati; Manager Business Development: Prasetiyo; Biro/Perwakilan: Malang: Hesti Kristanti, Wahyu Nurdiyanto, Eko Nurcahyo, Sylvianita Widyawati, Iksan Fauzi Alamat: Jl Sultan Agung No. 4, Malang. Telepon: (0341) 360201 Fax: (0341) 360204. Iklan: fax (0341) 360204, Sirkulasi (0341) 360203, Kediri: Didik Mashudi, Madiun: Imam Hidayat, Jakarta: Ravianto, Alamat: Jl Palmerah Selatan 12 Tlp (021) 5483008, Fax: (021) 5495360 Kantor Pusat: Jl Rungkut Industri III No 68 & 70 Surabaya 60293 Telepon: (031) 8419000, Fax Redaksi: (031) 8414024 Alamat Surat: PO BOX 110 SBS 60400 Surabaya Penerbit: PT Antar Surya Jaya, Surat Izin Usaha Penerbitan Pers: SK Menpen No.202/ SK/MENPEN/ SIUPP/A.7/1986 Tanggal 28 Juni 1986. Percetakan: PT Antar Surya Jaya. Isi di luar tanggung jawab percetakan. Tarif Iklan: Iklan taktis 1 Karakter Rp 1.000 (minimal 2 baris); Iklan display/ umum (hitam putih) Rp 35.000/mmk, Iklan display/umum (warna) Rp 45.000/ mmk; Iklan duka cita Rp 4.000/mmk (hitam putih); Iklan mendesak/duka cita untuk dimuat besok dapat diterima sampai pukul 15.00 WIB. Bagian Iklan: Jl Rungkut Industri III No 68 & 70 Surabaya 60293, Telepon: (031) 841 9000, Fax: (031) 8470000 dan (031) 8470500. Perwakilan Iklan Jakarta: Gedung PT Indopersda Primamedia, Jl Palmerah Selatan No.3 Jakarta. Telepon (021) 5483863, 54895395, 5494999, 5301991 Fax : (021) 5495360. Bagian Sirkulasi (Langganan): Gedung Kompas Gramedia Jl. Jemur Sari No. 64 Surabaya, Telepon: (031) 8479555 (Pelanggan/Pengaduan), (031) 8483939, 8483500 (Bagian Sirkulasi) Fax: (031)8479595 - 8478753. Harga Langganan Rp 29.000/bulan, Rekening: BCA Cabang Darmo, Rek 088- 3990380; Bank BNI Cabang Pemuda, Rek. 0290-11969-3 (untuk iklan); Bank Mandiri Cabang Rungkut, Rek 141-00-1071877-3 (untuk sirkulasi) atas nama PT Antar Surya Media. Surya Online: E-Mail: Pemimpin Umum : H Herman Darmo Pemimpin Redaksi : Febby Mahendra Putra Wakil Pemimpin Redaksi : Farhan Effendy Sekretaris Redaksi : P Sujarwanto Manajer Produksi: Adi Sasono Manajer Liputan: Sigit Sugiharto Foto-foto Citizen Photos join follow @portalsurya
  • 17. HALAMAN 14 | | KAMIS, 11 JULI 2013 YouGen Mencari Solusi MasalahMasyarakat Universitas Katolik Widya Mandala Surabaya KRS Online Menuju Perubahan S ETIAP institusi pendidikan pasti ingin selalu bergerak maju mengikuti perkembangan zaman. Itu berla- ku baik dalam sisi manajemen maupun infrastruktur institusi pendidikan itu. Hal itulah yang dilakukan oleh Universitas Ka- tolik Widya Mandala Surabaya (UKWMS) untuk selalu menyediakan fasilitas yang memudahkan mahasiswa untuk menyu- sun mata kuliah yang diinginkannya secara online. Mulai Semester Gasal ini, Fakultas Bisnis UKWMS menerapkan sistem KRS online bagi mahasiswanya agar mereka da- pat melakukan penyusunan studi mereka di mana pun mahasiswa tersebut berada. Sistem penyusunan mata kuliah atau studi mahasiswa terdapat pada Sitter, dengan situs akademik milik UKWMS. Mahasiswa fakultas bisnis tinggal memasukkan nama dan NRP-nya lalu dapat masuk ke aktivitas KRS untuk mela- kukan penyusunan mata kuliah. Berbeda dengan sistem manual, pada sistem KRS online itu, mahasiswa dapat melihat dosen masing-masing mata kuliah, sehingga hal ini dapat menjadi acuan bagi sejumlah mahasiswa untuk memilih dosen yang diinginkannya. Kelebihan dari sistem ini juga adalah sistem yang tidak bisa “meng- kick” mahasiswa yang sudah mengambil mata kuliah tertentu apabila mata kuliah tersebut sudah penuh dan ingin dimasuki oleh mahasiswa lain. Mahasiswa Fakultas Bisnis UKWMS yang sudah melakukan KRS online mulai 4-8 Juli 2013 kemarin merasa puas dengan sistem KRS online yang saat ini di- jalankan. Bagi Nita, mahasiswa Akuntansi, cara itu memudahkan pengisian KRS. “Saat saya membuka Sitter di kereta api, saat perjalanan ke Jogjakarta, ternyata Sitter lancar saat dibuka. Sistem ini pasti akan sangat memudahkan mahasiswa UKWMS dalam menyusun mata kuliah yang diinginkannya dengan efisien dan efektif,” ujar Nita. Pengisian yang melintasi batas wilayah membuat praktis karena saat pengisian KRS tidak perlu datang ke kampus. Kekhawatiran akan lemot juga tidak terbukti karena ketika diakses, cepat dioperasikan. “Sitter-nya cepet kok dibu- kanya. Saya juga bisa memilih dosen yang sesuai dengan keinginan saya,” ungkap Dewi. Selain itu, apabila mahasiswa yang tidak mempunyai koneksi internet di rumah atau di kos, mahasiswa dapat datang ke lab komputer untuk menyusun KRS. Jadi, semua maha- siswa dapat melakukan pengisian KRS di mana saja. Kelas yang dibuka pun tidak sepenuhnya dibuka, namun bertahap. Hal tersebut dilakukan agar mahasiswa yang tidak bisa melakukan KRS pada tanggal tertentu dapat memilih kelas tersebut pada hari esoknya karena kelas dibuka bertahap mulai 4-8 Juli 2013. Jadi, mahasiswa tetap bisa mengambil mata kuliah dan dosen yang diinginkannya. Diakui oleh Dekan Fakultas Bisnis UKWMS, Dr Lodovicus Lasdi MM, pada hari kedua saja, mahasiswa Akuntansi yang sudah melakukan KRS online sebanyak 800 dari 1.000 mahasiswa. Mahasiswa Manajemen yang sudah melakukan KRS online sebanyak 600 mahasiswa. “Hal itu membuktikan bahwa KRS online ini sudah sukses dan memudahkan mahasiswa dalam mengambil mata kuliah mereka,” ujar Lodovicus Lasdi. Perubahan itu menjadi nilai plus karena kampus dengan cepat mewadahi kebu- tuhan mahasiswa. Teknologi disediakan untuk dimanfaatkan dan memudahkan aktivitas. Dengan melakukan pengisian KRS online, orang tua pun dapat meman- tau perkembangan akademik anaknya. (lisa b, regina r) yang saat ini di- apabila mahasiswa yang tidak mempunyai yang sudah melakukan MasalahMasyarakat M ENJADI mahasiswa berar- ti harus siap menjadi agen perubahan. Salah satu cara untuk mewujudkan hal itu adalah dengan lebih peka melihat lingkung- an. Lingkungan yang menjadi bagian dari keseharian mahasiswa seharus- nya dapat menjadi pangkal peneliti- an dan usaha perbaikannya. Salah satu cara untuk mendorong mahasiswaagarkepekaannyaterasah adalah dengan mengadakan Latihan Keterampilan Manajemen Mahasis- wa (LKMM). LKMM diadakan setiap tahun dengan tema berbeda-beda se- suai dengan situasi dan kebutuhan. Kegiatan itu merupakan kegiatan yang digagas oleh Dikti bekerja sama dengan Universitas Katolik Widya Mandala Surabaya (UKWMS). Tahun ini tema LKMM adalah mahasiswa sebagai agen perubah- an. Tema itu dapat diterjemahkan dalam berbagai cara dan bentuk. Sesuai dengan tema yang ada, para peserta LKMM diajak untuk meng- amati fenomena sosial tentang kehidupan para masyarakat kelas bawah. Para peserta diberi tugas untuk mengamati gejala sosial serta menen- tukan akar masalah dari kehidupan tukang becak, penjual baso, penjual jamu, penjual dan pencari barang be- kas, tukang tambal ban, dan tukang sampah. Profesi-profesi itu bukan hal baru bagi mahasiswa meski sering diabaikan dan tidak mendapat per- hatian. Mahasiswa harus mengamati kehidupan mereka dan mencatatnya dengan detail. Dari hasil pengamatan tersebut para peserta ditugaskan untuk menyusun proposal kegiatan yang tujuannya untuk membantu meme- cahkan permasalahan yang ada dari setiap profesi tersebut. Jika maha- siswa hanya mencatat situasi, tentu lebih mudah. Akan tetapi, sebagai agen perubahan, mahasiswa harus menemukan solusi yang paling tepat yang dapat dilakukan untuk meng- ubah keadaan. Di situ letak keunikan kegiatan LKMM. Mahasiswa tidak hanya mengetahui dan mendapat- kan data, tetapi juga memberikan alternatif agar situasi yang lebih baik dapat tercipta. Menurut Dra Ec Ninik Muljani, kegiatan seperti itu positif karena membuat mahasiswa peduli dengan lingkungannya. Dengan demikian, masyarakat juga dapat merasakan perubahan yang dilakukan oleh para mahasiswa. “Lewat kegiatan LKMM ini di- harapkan kedepannya para peserta dapat menjalankan nilai-nilai Peka (Peduli, Komit, dan Antusias) serta mampu menjadi agen perubahan di tengah masyarakat,” ujar Ninuk Muljani yang menjadi Ketua Panitia LKMM 2013, Selasa (9/7). Belajar Mencari Alternatif LKMMtahun2013inidibagidalam dua gelombang. Gelombang 1 diada- kan pada 21 Juni 2013 dan 6 Juli 2013. Gelombang 2 diadakan pada 22 Juni 2013 dan 5 Juli 2013. Dalam dua hari tersebut para peserta yang mayoritas mahasiswa Fakultas Bisnis Angkatan 2012 dibekali dengan materi-materi yang disampaikan oleh para dosen dari Fakultas Bisnis. Materi yang pada dasarnya man- tap dan cukup berat itu harus dike- mas menarik agar suasana latihan menjadi lebih semarak. Itu sebabnya, banyak keceriaan yang tersaji di LKMM tahun ini. Panitia acara ber- usaha menyusun konsep acara de- ngan menarik. Mereka mewajibkan para peserta untuk membuat atribut dan aksesori unik dan dikenakan selama LKMM berlangsung. Dari atribut yang dikenakan saja sudah menuntut kreativitas mahasiswa. Masing-masing berlomba mengena- kan aksesori paling unik. Para mahasiswa harus bekerja cepat karena waktu yang disediakan untuk pelatihan memang tidak pan- jang. Mereka juga dibiasakan untuk cepat menangkap masalah, cepat mencari alternatif pemecahan ma- salah, dan cepat pula mendapatkan solusi. Program-program kegiatan yang dimunculkan oleh para peserta lewat proposal. Mereka harus mempresen- tasikan proposal itu di hari kedua pelaksanaan LKMM. Ternyata se- tiap kali presentasi selalu mendapat tanggapan positif dari para dewan juri penilai. Itu membuat peserta tertantang untuk dapat menyajikan presentasi terbaik. Menurut Puruwita Wardhani SE MSi yang menjadi salah satu juri, proposal yang dipresentasikan peserta menarik. Mereka memiliki kepekaan cukup tinggi dan alternatif pemecahan masalah yang cukup variatif. ”Kami harapkan semoga kegiatan- kegiatan yang diusulkan oleh para peserta dapat benar-benar dilaksa- nakan sehingga tidak hanya menjadi angan-angan atau sekedar formalitas dalam menyelesaikan tugas yang di- berikan,” ucap Puruwita Wardhani. Wakil Ketua Panitia LKMM 2013 itu berharap agar ide-ide segar mahasis- wa benar-benar membuat kehidupan warga yang diteliti berubah menjadi lebih baik. Di akhir pelatihan, semua berha- rap agar proses yang sudah dilewati dalam dua gelombang itu dapat di- wujudkan. Mereka juga diharapkan dapat menggunakan seluruh proses yang telah dilewati untuk semakin memahami keadaan sosial masyara- kat sekitar dan mampu reaktif akan segala peristiwa yang terjadi saat ini. (yohanes mulyadi) FOTO-FOTO : DOKUMENTASI PRIBADI join follow @portalsurya
  • 18. Sidoarjo Region SIDOARJO, SURYA - Cita- cita Adi Prasetyo (17), menjadi pembalap motor andal sangat mulia. Namun, anak baru gede (ABG) asal Desa Pabean, Keca- matan Sedati ini justru meng- gelapkan motor temannya untuk dipakai di arena balap 'kuda besi liar'. Motor Suzuki Satria N 2829 OW milik M Manji (23), warga Dusun Pendeh, Desa Asem, Kecamatan Jengkrik, Sampang menjadi sasarannya. Motor korban yang dipinjam 3 bulan lalu dipreteli untuk sarana balapan. Tersangka bersama motor hasil kejatan diamankan petugas di By Pass Juanda un- tuk menunggu lawan balapan. Ketika diamankan, motor korban yang semula leng- kap tinggal setir, mesin dan kerangkanya. Perlengkapan kendaraan semuanya dijual tersangkaketemannya.Seperti speedometer,slebor,dekkanan kiri dan bagian lainnya dijual ke pasar loak dan temannya. "Rangka motor juga diganti dan aslinya dijual tersangka ke temannya Rp 1 juta," kata Kapolsek Sedati AKP Wiwit Adi, Rabu (10/7). Kendaraan itu sampai di ta- ngan tersangka karena sudah saling kenal korban. Korban percaya dengan tersangka Adi yang bekerja di sebuah beng- kel motor karena sudah sering ketemu baik saat melihat balapan liar di by pass. Akhirnya, tersangka mengajak bertemu kor- ban di depan depot nasi goreng Jl Raya Pabean dan motor dipinjam sebentar. "Tersangka waktu itu pinjam untuk nambal ban motornya yang bocor," jelas kapol- sek. ABGyangmasihpolos itu saat diperiksa penyi- dik mengaku pingin pu- nya motor sendiri untuk balapan di sekitar Juan- da. Selama ini, tersangka sering sebagai joki motor balap saja karena tidak memiliki motor pacu. "Motor ini yang saya pakai untuk balapan dan saya sebagai joki sejak 2009 dengan upah antara Rp 100 ribu-Rp 200 ribu," ujar Adi polos. Dalam mengarungi bala- pan liar, tersangka mengaku pernah kalah bertaruh motor. Motor yang dibelikan orang tuanya dipakai balapan dan ternyata kalah. "Sampai se- karang saya tidak punya mo- tor," terang tersangka. (mif) Ubek-ubek Warung Jual Minuman Keras SIDOARJO, SURYA - Setelah me-launching Gotong Royong Kamtibmas, Polres Sidoarjo dan polsek jajaran kian menggencar- kan operasi di jalanan selama Ramadan. Oeprasi akan dilaksa- nakan siang dan malam dengan sasaran utama roda dua. Polres Sidoarjo dan jajarannya juga akan mengubek-ubek warung dan toko yang menjual minum- an keras (miras). Langkah yang dilakukan pi- hak kepolisian itu semata-mata untuk memberi rasa aman dan nyaman kepada masyarakat. Untuk mengamankan Sidoarjo, masyarakat juga diajak berpar- tisipasi aktif menjaga kemanan dan ketertiban (kamtibmas) di lingkungan masing-masing. "Operasi di jalanan untuk men- cegah motor hasil curian yang dibawa lari. Semua jajaran sudah kami instruksikan untuk melaku- kannya terutama polsek di batas kota," tutur Kapolres Sidoarjo AKBP Marjuki, Rabu (10/7). Mantan Kapolres Jombang tersebut juga mengajak kepada semua aparat, elemen masyarakat agar selalu menjaga kekondusifan wilayah hukum Sidoarjo dengan cara sadar ketertiban lingkungan, keamanan lingkungan dan mem- bantu aparat kepolisian dalam memerangi kejahatan. "Tanpa dukungan masyarakat, kerja polisi tidak bisa maksimal untuk memerangi kejahatan. Mari kita bersama-sama menjaga keamanan wilayah Sidoarjo.Apa- lagi ini menjelang pemilu, mari bersama-sama mentaati aturan, bahu membahu menjaga ling- kungan agar kejahatan yang ada bisa diminimalisir," terangnya. Sementara itu, warung dan toko yang menjual miras PRETELI MOTOR - Tersangka Adi Prasetyo didampingi dua Polwan Polsek Sedati setelah ditangkap karena mem- bawa kabur motor Suzuki Satria N 2829 OW milik temannya, Rabu (10/7). Sudah Lama Ingin Jadi Pembalap Adi Prasetyo Embat Motor Teman■ Hari Pertama Puasa Tidak Ada PNS Bolos SIDOARJO, SURYA - Selama bulan puasa, jam kerja PNS di lingkungan Pemkab Sidoarjo dikurangi. Masuknya se- karang mulai pukul 08.00 WIB dan pulangnya dimajukan pukul 15.00 WIB. Sekretaris Komisi A DPRD Sidoarjo Adhi Samsetyo ber- harap, selama bulan puasa PNS tidak menurun kinerjanya karena mereka adalah abdi negara dan pelayan masyara- kat. "Jangan sampai layanan publik terganggu, seperti pe- layanan menyangkut perizinan dan administrasi lainnya serta rumah sakit," katanya. Politisi PAN tersebut menegaskan, untuk memantau PNS selama Ramadan, komisi A akan memantau secara langsung di layanan publik. Pasalnya, di layanan publik itu sangat kelihatan apakah ada staf yang mbalelo atau tidak. "Jika ada laporan atau ditemukan saat sidak di la- pangan, kami tidak segan-segan memanggil kepala instan- si terkait," tandasnya. Sementara itu, Kepala Badan Kepegawaian Daerah (BKD) Sidoarjo, Hj Sri Witarsih mengatakan, setiap bulan puasa ada pengurangan jam kerja. Hal ini lazim dilakukan karena PNS yang beragama Islam menjalankan ibadah puasa. Biasanya masuk kerja pukul 07.00 WIB dan pulang 16.00 WIB kini masuknya pukul 08.00 dan pulamg lebih awal 1 jam yakni pukul 15.00 WIB. "Pengurangan jam kerja tidak memengaruhi kinerja PNS dan tetap menjalankan tugasnya seperti biasa," katanya. Selama Ramadan, Sri Witarsih meminta agar PNS tidak ada yang bolos. Begitu pula saat Lebaran nanti agar tidak ada yang bolos. "Saat dicek ke lapangan sesuai absensi, hari perta- ma puasa tidak ada PNS yang bolos," paparnya.(mif) HALAMAN 16 | | KAMIS, 11 JULI 2013 SURYA/ANAS MIFTAKUDIN menjadi sasaran utama dalam operasi penyakit masyarakat (pekat). Pasalnya, miras adalah sumber malapetaka dari semua kejadian yang ada. Seperti, usai mengonsumsi miras langsung melakukan aksi kejahatan. Hal itu dilakukan karena akal sehat- nya sudah hilang akibat sudah terpengaruh alkohol. Tidak itu, saja korban kecelaka- an juga banyak yang diakibatkan miras. Begitu pula muda-muda melakukan perkosaan juga akibat usai menenggak miras. "Seluruh jajaran sudah kami perintahkan menggelar operasi miras karena banyak mudlorot- nya," tandasnya. (mif) Polisi Operasi Siang dan Malam■ Operasi di jalanan untuk mencegah motor hasil curian yang dibawa lari. Semua jajaran sudah kami instruksikan untuk melakukannya terutama polsek di batas kota. AKBP MARJUKI KAPOLRES SIDOARJO join follow @portalsurya
  • 19. Super Ball | HALAMAN 17 | | KAMIS, 11 JULI 2013 pevoli pantai jatim beraksi di kejuaraan dunia Jawa Timur (Jatim) selalu mencetak atlet bola voli pantai berprestasi internasional. Salah satunya adalah pasangan voli pantai putra, Rendy Ferdian Licardo/M Asfiyak yang bakal mengikuti kejuaraan dunia voli pantai U-19 di Portugal, pertengahan Juli 2013 nanti. baca halaman...23 SuperBallKAMIS, 11 JULI 2013 HALAMAN 17 ANTUSIASME berjumpa pemain- pemain Arsenal, Liverpool, dan Chelsea sewajarnya turut dirasakan para pemain tim nasional Indonesia. Namun dengan menjunjung tinggi profesionalisme, su- dah selayaknya mereka bermain untuk suatu kemajuan. Suatu fakta yang tidak bisa dipungkiri jika mendapatkan jersey pemain kelas dunia menjadi sisi lain para pemain Tim Garuda. Alhasil, setiap tim luar datang, “target” skuad Merah Putih hanya ber- buru jersey pemain bintang tim lawan. Tengok saja bagaimana Imanuel Wanggai memburu jersey pemain idolanya, Wesley Sneijder, ketika Indonesia menghadapi Belanda, Juni silam. Pemain-pemain seperti Raphael Maitimo, Sergio van Dijk, Andik Ver- mansyah, dan Ricardo Salampesy juga mengincar jersey Robin van Persie dan pemain Belanda lainnya. Kejadian menggelikan sempat disorot kamera usai laga Timnas Indonesia melawan Los Angeles Galaxy, setahun lalu. Pemain-pemain Garuda berebut “mengemis” jersey David Bcekham sebelum akhirnya diberikan kepada Andik Vermansyah. Mendapatkan jersey pemain bintang adalah hak mereka, namun jangan jadikan kesempatan melawan klub-klub raksasa Premier League sebatas ajang berburu jersey. Tim Indonesia, apapun namanya, setidaknya harus meraih hasil positif karena sepanjang 2013, tak satu pun kemenangan yang diraih Indonesia. Semakin ironis jika melihat fakta Indonesia hanya bisa mencetak satu gol dari empat laga internasional terakhir. Mengacu pada rentetan hasil tersebut, kesimpulannya yang harus ditarik cukup sederhana, Indonesia harus tampil semaksimal mungkin saat meng- hadapi Arsenal, Liverpool, dan Chelsea. Catatan harus tampil maksimal dipahami betul oleh Jacksen F. Tiago. Pelatih asal Brasil ini menjadikan tiga laga uji coba melawan klub elite Ing- gris itu sebagai persiapan menghadapi China pada kualikasi Piala Asia 2015, Oktober mendatang. “Saya akan berusaha mempersiapkan tim seperti saat melawan Belanda. Kami akan membentuk proses latihan supaya bisa melihat eksibilitas pemain yang dipanggil terhadap taktik,” ujar Jacksen. Publik pun harus menanamkan rang- kaian laga uji coba ini sebagai kesempa- tan untuk membentuk tim nasional yang bisa dibanggakan pada masa depan. “Timnas kita akan mendapatkan pembelajaran yang sangat berarti dalam hal pengalaman bermain untuk taraf internasional, kepercayaan diri pemain akan meningkat, kemampuan diri secara individu akan terukur, cara bermain tim akan bisa kita bandingkan,” papar eks pelatih tim nasional, Nilmaizar. Kiper Indonesia Kurnia Meiga akan me- manfaatkan laga melawan tim-tim dunia tersebut untuk menambah pengalaman. “Ini kesempatan berharga bagi saya untuk menambah jam terbang bermain,” ujar penggawa Arema Indonesia itu. Ya, sudah saatnya skuad Indonesia mengubah “misi” setelah mendapat banyak kesempatan melawan tim-tim besar. Mereka harus menjadikan laga langka ini sebagai ajang unjuk kuali- tas diri, bukan lagi sekadar memburu jersey.( ARSENAL mengoleksi 13 gelar Premier League. Liverpool lebih banyak lagi: 18 gelar. Sedang Chelsea baru memenangi kasta tertinggi sepakbola Inggris ini tiga kali. Itulah fakta yang membedakan kebesaran ketiga klub yang akan da- tang ke Indonesia tersebut. Namun, fakta tersebut berbanding terbalik saat membandingkannya dengan harga tiket pertandingan melawan Tim Indonesia. Tiket Chelsea tercatat sebagai ter- mahal. Harga tiket terendah The Blues adalah Rp 150 ribu (Kategori III) dan tertinggi mencapai Rp 3.5 juta (VVIP). Sementara harga tiket terendah Liver- pool adalah Rp 75 ribu (Kategori IV) dan tertinggi Rp 3 juta (VVIP). Harga tiket Arsenal tercatat paling murah. Kategori III yang menjadi harga termurah dilepas dengan banderol Rp 100 ribu. Bandingkan dengan Kategori III milik Liverpool Rp 160 ribu dan milik Chelsea Rp 150 ribu. Sedang tiket ter- mahal The Gunners “hanya” berharga Rp 750 ribu (VIP Barat).(*) Live on TV SRIWIJAYA FC VS PERSELA INDONESIA VS ARSENAL Kamis (11/7) pukul 21.00 WIB/ 22.00 WITA Minggu (14/7) pukul 20.30 WIB/ 21.30 WITA Bukan Sekadar Ajang Berburu Jersey ARSENAL Jumat. 12 Juli 2013 Minggu, 14 Juli 2013 pukul 20.30 WIB Indonesia Dream Team Stadion Gelora Bung Karno, Jakarta VIP Barat: Rp 750 ribu VIP Timur: Rp 500 ribu Kategori I: Rp 300 ribu Kategori II: Rp 200 ribu Kategori III: Rp 100 ribu Tiba: Tanding: Lawan: Tempat: Harga Tiket Tiga Tim Elite Datang LIVERPOOL Kamis, 18 Juli 2013 Sabtu, 20 Juli 2012 pukul 20.30 WIB Indonesia XI Stadion Gelora Bung Karno, Jakarta VVIP: Rp 3 juta VIP Barat: Rp 2 juta VIP Timur: Rp 1.5 juta Kategori I: Rp 1.250 ribu Kategori II: Rp 400 ribu Kategori III: Rp 160 ribu Kategori IV: Rp 75 ribu Tiba: Tanding: Lawan: Tempat: Harga Tiket CHELSEA Selasa, 23 Juli 2013 Kamis, 25 Juli 2013 pukul 20.30 WIB BNI-Indonesia All Star Stadion Gelora Bung Karno, Jakarta VVIP: Rp 3,5 juta VIP Barat: Rp 2 juta VIP Timur: Rp 1,5 juta Kategori I: Rp 750 ribu Kategori II: Rp 300 ribu Kategori III: Rp 150 ribu Tiba: Tanding: Lawan: Tempat: Harga Tiket Denah Tempat Duduk di Stadion Gelora Bung Karno Arsenal Termurah, Chelsea Termahal FOTO-FOTO: AFP PHOTO KAWAL ROB- BEN - Bek Timnas Indonesia, Ricardi Salampessy (kiri), mengawal winger Timnas Belanda, Arjen Robben, dalam laga persa- habatan di Stadion Utama Gelora Bung Karno, Ja- karta, Jumat (7/6). KOMPAS IMAGES/RODER- ICK ADRIAN MOZES Theo Walcott Steven Gerrard Frank Lampard TIDAK diragukan lagi jika Premier League Inggris mendapatkan tempat yang spesial di hati pencinta sepak- bola Indonesia. Begitu banyak contoh untuk menggambarkan fanatisme tersebut. Mulai dari berebut hak siar hingga menjamurnya komuni- tas penggemar klub-klub Premier League di seantero nusantara. Sayang, rasa cinta yang sudah mendarah daging tersebut terpisah jarak yang jauh. Pencinta Premier League hanya bisa melihat bintang- bintang pujaan mereka dari layar kaca. Pun jika melihat dari dekat, hanya bisa terwujud jika menyeberang ke negeri tetangga karena selama ini klub-klub Premier League hanya melakukan tur pramusim ke Malay- sia, Thailand, dan Singapura. Sekarang singkirkan rasa iri dan penasaran itu. Para penggila Premier League kini bisa menyaksikan pujaan mereka dari dekat. Sepanjang Juli ini, tiga klub papan atas Premier League, Arsenal, Liverpool, dan Chelsea dipastikan menggelar tur pramusim ke Indonesia. Meski sebatas di Jakarta, tetap saja kunjungan ketiga raksasa Ing- gris tersebut berhasil mengakhiri penantian panjang para penggemar. Apalagi mereka akan membawa skuad terbaik. Well, para bintang dunia seperti Theo Walcott, Lukas Podolski, Steven Gerrard, Frank Lam- pard, Petr Cech, Eden Hazard akan menyerbu Jakarta. Plus dua kesohor di balik layar, Arsene Wenger dan Jose Mourinho. Arsenal akan menjadi awal dari akhir penantian tersebut. Setelah terakhir kali mengunjungi Indonesia pada Juni 1983, klub berjulukan The Gunners ini akan menyapa pengge- mar mereka yang disapa Gooner. Rombongan Arsenal tiba di Jakarta pada Jumat (12/7) malam. Meski minus Thomas Vermaelen (cedera), serta dua pemain Timnas Spanyol, Santi Cazorla dan Nacho Monreal, Arsenal masih memiliki daya pikat tinggi. Mereka akan menjajal tim Indone- sia Dream Team di Stadion Gelora Bung Karno Jakarta, Minggu (14/7) malam. Secara psikologis, keda- tangan pemilik 13 gelar Premier League ini akan memberikan hiburan bagi para pencinta sepakbola. .“Masyarakat bisa langsung meli- hat tim idola dan pemain idolanya secara langsung bermain di Indonesia yang selama ini hanya mereka lihat dari televisi,” ujar mantan pelatih Timnas Indonesia, Nilmaizar, kepada Tribun, Rabu (10/7). Sambutan dari para penggemar pun dijamin akan sangat hangat. Mantan pemain Arsenal, Giovani van Bronckhorst, juga sudah memberi “ultimatum” terkait rencana kedata- ngan The Gunners ke Indonesia. “Mereka bisa merasakan sambutan yang sangat hangat. Indonesia adalah negara besar yang sangat menggilai sepakbola, terutama ketika tim-tim besar berdatangan dari Eropa. Selu- ruh penjuru negeri ingin menyak- sikan tim-tim tersebut,” ujar pria berdarah Maluku tersebut kepada Arsenal Player. Mantan bek asal Belanda itu juga mengatakan klub- klub Premier League seperti Arsenal, Manchester United, Chelsea, dan Liverpool san- gat terkenal di Indonesia. Gio menjamin skuad asu- han Arsene Wenger akan mendapati stadion yang penuh dan sangat berisik karena antusiasme yang luar biasa. Gio men- contohkan atmosfer yang terasa ketika tim nasional Belanda berkunjung ke Indo- nesia belum lama ini. “Stadion- nya penuh dan orang-orang mulai menggila. Saya rasa Arsenal bisa merasakan pertandingan dengan atmos- fer yang luar biasa,” ujar mantan pemain Barcelona tersebut. Setelah Arsenal, giliran Liverpool yang mendarat di Jakarta. The Reds dijadwalkan tiba pada Kamis (18/7). Pasukan Brendan Rodgers yang minus Luis Suarez dan Pepe Reina akan menghadapi tim Indonesia XI di GBK, Sabtu (20/7) malam. Berselang tiga hari kemu- dian, Selasa (23/7), rombongan Chelsea yang tiba di Tanah Air. Tim asuhan Jose Mourinho ditunggu tim BNI-Indonesia All Star di GBK, Kamis (25/7) malam. Ini menjadi tur pertama Li- verpool dan Chelsea ke Indone- sia. Tentunya ini akan menjadi moment bersejarah bagi para Liver- pudlian dan suporter The Blues yang jumlahnya ribuan di Tanah Air. Melalui kunjungan trio Premier League ini, masyarakat Indonesia bisa berbangga. Kesediaan mere- ka melakukan tur ke Indonesia merupakan indikator nyata jika Indonesia sangat kondusif. Maklum, masih membekas jelas penyebab batalnya Man- chester United melakukan tur ke Indonesia pada 2009 lalu. Saat itu bom meledak sehari sebelum skuad United tiba di Jakarta.“Kunjungan ini bagus karena artinya Indonesia aman,” kata selebriti Rico Ceper.(Tribun- join follow @portalsurya
  • 20. | KAMIS, 11 JULI 2013 |SoccerHotNews18 soccer hot news18 KAMIS 11 JULI 2013 El Clasico Perdana Neymar LIGA de Fútbol Profesional (LFP) telah mengumumkan jadwal pertandingan untuk kompetisi La Liga Spanyol musim 2013 2014. Laga paling ditunggu, El Clasico yang mempertemukan Real Madrid kontra Barcelona dijadwalkan per- tama kali digelar pada 27 Oktober 2013, di mana Blaugrana bertindak sebagai tuan rumah. Pada pertandingan mahadahsy- at tersebut, penyerang anyar Barca asal Brasil, Neymar da Silva Junior, diprediksi akan mencicipi El Clasico pertama dalam kariernya. Sosok wonderkid ini pun akan menjadi “ikon” baru El Clasico yang dalam beberapa tahun terakhir di- dominasi Lionel Messi dan Cris- tiano Ronaldo. Barca bulan lalu resmi mengon- trak Neymar selama lima tahun dengan mahar 57 juta Euro dari Santos FC. Azulgrana membeli pe- main asal Brasil itu untuk mengim- bangi ketajaman Messi. Pendukung Barca sudah tak sa- bar menunggu aksi duet Neymar- Messi di La Liga musim depan. Khususnya dalam duel El Clasico. “Bisakah Anda bayangkan bagaimana duet Messi dan Ney- mar,” kata mantan Manajer Man- chester City, Roberto Mancini, di- lansir Football Espana. “Saya sudah tak sabar menyaksikan- nya.” Barca akan memulai perjuangan untuk memertahankan gelar La Liga melawan Levante di Camp Nou pada laga perdana, 18 Agustus 2013, di Camp Nou. Sebelumnya, El Barca akan mela- koni laga pembuka kompetisi Spa- nyol yaitu ajang Supercopa de Es- pana melawan Atletico Madrid dan Barcelona. Leg pertama akan berlangsung pada 21 Agustus 2013 di Vicente Calderon, dan tujuh hari kemudi- an leg kedua dimainkan di Camp Nou. Ini akan menjadi debut resmi Neymar bersama Barca. Laga ini juga langsung memertemukan Da- vid Villa dengan Barca. Villa yang tersingkir oleh kedatangan Neymar di Camp Nou, sudah resmi hijrah ke Atletico Madrid. Neymar kemungkinan akan me- makai nomor punggung 7, yang merupakan peninggalan Villa. No- mor 7 merupakan favorit Neymar. Di Timnas Brasil, inilah nomor yang dipakainya sebelum nomor 10 di Piala Konfederasi 2013. Neymar pun sempat berucap nomor itu in- gin dipakainya di Barcelona. Tapi, ada satu nomor lagi yang masih dipikirkannya. Nomor itu adalah 11. Nomor 11 identik den- gan Romario kala membela Barce- lona. Ini pula nomor yang dipilih Neymar di Santos. Pemilik nomor 11 saat ini ada- lah Thiago Alcantara. Tapi, bintang Spanyol di Piala Eropa U 21 ini ke- mungkinan besar akan hengkang ke Manchester United. Hanya saja, juru bicara Barcelo- na, Toni Freixa menegaskan, Thia- go masih tetap bersama Barcelona. “Dia akan ikut pramusim bersama kami,” tegasnya. Maka itu, nomor yang paling mungkin dipilih Neymar adalah 7. Tapi, Neymar juga sepertinya akan dibebaskan jika ingin memakai no- mor 11 milik Thiago bila tetap ber- tahan di Barca. Langkah Baru Ancelotti Bila Neymar menjadi sorotan be- sar di kubu Barca, sebaliknya di kubu Madrid kehadiran Carlo An- celotti yang menyita perhatian pub- lik. Ancelotti akan memulai lang- kah baruzv musim depan bersma Madrid. Di laga perdana, Madrid yang berstatus runner up musim lalu, bakal mencoba kekuatan Real Be- tis di Santiago Bernabeu. Itu juga akan menjadi debut Ancelotti di kompetisi paling bergengsi di Spa- nyol itu. Setelah melakoni El Clasico per- dana di Camp Nou, 27 Oktober 2013, Madrid baru akan menjamu Barca di Santiago Bernabeu pada 23 Maret 2014. ( 27 Oktober 2013, Barca Jamu Real Madrid Pilih Nomor Punggung 7 atau 11 Barca Fasilitasi Kepindahan Villa DAVID Villa sangat antusias dengan prospeknya bersama Atletico Madrid pada musim depan. Dia pun berterima kasih kepada Barcelona, yang mem- bantunya menyeberang ke Vi- cente Calderon. Barca memberikan konr- masi perpindahan Villa pada Selasa (9/7). Mereka mele- pas mantan striker Valencia itu dengan harga 5,1 juta euro, dan kini Villa sudah lolos tes medis di Madrid pada Rabu (10/7). “Saya bahagia dan senang memulai fase baru ini, teru- tama atas semua perhatian Atletico Madrid yang telah diperlihatkan selama bebera- pa hari ini. Mereka telah ber- taruh kepada saya dan saya ingin sekali segera memulai petualangan baru ini,” ujar Villa dikutip, Rabu (10/7). Faktor kepercayaan Pelatih Diego Simeone menjadi ala- san Villa memilih berlabuh ek Atletico ketimbang Totten- ham Hotspur. Simeone akan menjadikan Villa striker utama menggantikan Radamel Falcao yang hengkang ke AS Monaco. “Saya harus mendapatkan tempat di tim. Mereka tim peme- nang yang telah meraih banyak prestasi dalam beberapa tahun ini. Saya datang ke sini untuk satu hal lagi, dari awal mencoba membantu kelompok ini men- jadi lebih kompetitif dan lebih baik. Semoga saya bisa melaku- kannya” Villa kesulitan menem- bus tim inti di Barcelona pada musim lalu, sehingga dia akh- irnya dijual. Meskipun demiki- an, striker tim nasional Spanyol ini memberikan apresiasi kepa- da tim kebanggaan publik Cat- alan tersebut. “Sejak hari pertama hingga terakhir mereka memperlihat- kan sebuah kemesraan yang spesial. Saya berterima kasih kepada mereka atas kesempa- tan untuk bermain selama tiga tahun di klub besar seperti Bar- ca dan semoga saya bisa baha- gia di sini,” ungkapnya. Bahkan Villa menyebut Bar- ca berperan besar atas kep- indahannya ke Vicente Cal- deron. “Saya tak mempunyai keluhan sejak awal hing- ga hari terakhir di Barcelo- na. Dari apa yang saya den- gar, karena saya tak terlibat dalam negosiasi, mereka tel- ah memfasilitasi kepergianku ke Atletico Madrid, karena mereka tahu saya ingin data- ng dan bermain di sini. Jadi, terima kasih.” Membela Barca sejak ta- hun 2010, Villa tampil 119 kali di semua kompetisi dan mele- sakkan 48 gol. Di musim per- tamanya, dia turut mengantar Los Cules memenangi La Liga dan Liga Champions.(*) Ambisi Schwarzer di Chelsea KIPER Mark Schwarzer me- negaskan ambisinya bersa- ma klub barunya, Chelsea. Schwarzer menyatakan tidak ingin sekadar menjadi pelapis bagi Petr Cech. Pria 40 tahun itu bersta- tus bebas transfer sejak men- inggalkan Fulham bulan lalu. Schwarzer pun direkrut oleh Chelsea dengan kontrak ber- durasi satu tahun. Dari usianya yang sudah menginjak 40 tahun dan kon- trak hanya setahun, Schwarzer sepertinya hanya akan menjadi pelapis Petr Cech. Selama sembilan musim di Stamford Bridge, Cech selalu menjadi pilihan utama dan po- sisinya hanya bisa digeser oleh Hilario dan Ross Turnbull jika berhalangan tampil. Namun demikian, Schwarzer tetap berambisi mendapatkan posisi utama di bawah mistar gawang Chelsea. Kiper asal Aus- tralia ini berambisi mendapat tempat untuk mengamankan po- sisinya di Piala Dunia 2014. “Petr kiper nomor satu. Bagi saya, hal yang penting adalah saya bisa datang ke klub sebe- sar Chelsea dan saya akan benar benar berusaha sebisa mung- kin. Ada banyak pertandingan sepanjang musim dan jika saya berusaha keras, maka saya akan mendapatkan kesempatan,” tu- turnya kepada Sky Sports, Rabu (10/7). ( Syarat Suarez LUIS Suarez memberi syarat akan meninggalkan Liverpool. Ia menyatakan belum ten- tu bertahan di Aneld musim depan. Ada tiga klub yang saat ini meminati dirinya. Masa depan Suarez di Liv- erpool semakin tidak menen- tu. Kecaman dari publik Ing- gris membuat Suarez tidak betah dan ingin hengkang. Suarez pun sudah mem- inta agennya, Pere Guardio- la, untuk menemui manajer Brendan Rodgers dan Direktur Klub, Ian Ayre, Senin lalu, un- tuk membahas kelanjutan ka- riernya bersama The Reds. Dikutip dari Daily Mail, Rabu (10/7), dalam suatu wawan- cara dengan sebuah stasiun radio di Uruguay, Suarez sem- pat mengatakan saat ini dirin- ya sedang ditaksir oleh tiga klub. Penyerang berjulukan El Pis- tolero itu pun tidak menampik jika dia akan pindah ke salah satu klub peminat. “Tidak han- ya satu klub, ada pilihan lain. Ada dua atau tiga kemungki- nan,” tuturnya. Suarez tetap memberi an- gin segar dengan menyatakan akan bergabung dengan Liver- pool yang melakukan tur pra- musim ke Australia. Namun demikian, dia tetap tidak bisa memastikan kelanjutan kari- ernya di Aneld. “Saya harus kembali ke Australia pada tanggal 21 dan kemudian bertanding di Aus- tralia. Sayangnya dalam sepa- kbola Anda tidak pernah tahu apa yang akan terjadi. Sebuah panggilan telepon bisa men- gubah semua rencana itu,” je- las eks Ajax Amsterdam itu. t“Saya sudah tiga atau em- pat kali berbicara dengan agen saya. Dia memberitahu situasinya. Saat ini semuan- ya baik baik saja, saya tetap tenang. Saya terkejut Arse- nal mengincar saya. Hal yang terpenting adalah tim tim itu terus menghargai saya atas apa yang telah saya lakukan pada pertandingan,” sam- bung pemain yang ditawar 30 juta Pounds oleh Arsenal itu. ( soccer short BONY - Swansea City dikabarkan segera merampungkan transfer pemain Pantai Gading, Wilfried Bony, dari Vitesse Arnhem. Menurut sang agen, kepindahan ke Pre- mier League ini bakal menjadi langkah baru dalam karier Bony. Biaya transfer Bony di- yakini melibatkan dana 12 juta pounds. Sang pemain merupakan top skor Eredivi- sie musim lalu, mencetak 31 gol dalam 30 pertandingan untuk Vitesse. JESE - Real Madrid akan segera memper- panjang kontrak Jese Rodriguez. Bintang muda jebolan akademi Los Blancos tersebut akan menjadi bagian skuad utama musim depan. Kontrak bintang Timnas Spanyol U-20 ini tingga satu ta- hun, dan ia menjadi incaran Tottenham Hotspur. BLANC - Debut Laurent Blanc se- bagai pelatih Par- is Saint Germain (PSG) diawali den- gan buruk. PSG, juara Ligue 1 musim lalu, kalah 1 3 dari Sturm Graz pada laga uji coba pramusim, Rabu (10/7), di Stadion UPC Arena, Graz. PSG akan melanjutkan pemanasannya untuk musim kompetisi baru dengan menghadapi Rapid Viena pada Jumat besok. DOS SANTOS - Giovani Dos Santos ber- ganti klub dari Mallorca ke Villarreal di bursa transfer musim panas ini. Tidak dijelaskan nilai transfer yang disepakati kedua klub un- tuk pemain Meksiko tersebut, tapi yang ber- sangkutan disebutkan telah menandatanga- ni kontrak empat musim bersama Villarreal, yang kembali promosi ke Primera La Liga. FALCAO - Radamel Falcao memasang tar- get besar bersama AS Monaco. Bukan han- ya ingin mempersembahkan gelar, Falcao juga bertekad menjadi topskorer di kompeti- si Ligue 1 musim 2013/2014. “Akan sangat menyenangkan bila bisa menjadi top skor,” kata Falcao dilansir Inside Futbol, Rabu (10/7). Falcao yang diboyong dari Atletico Madrid dengan nilai transfer sekitar 60 juta euro siap bersaing dengan bomber andalan Paris Saint Germain Zlatan Ibrahimovic. Rza Rac- er Kids ?@RzaR- acerKids @Tribun- SuperBall Semoga aja Ya di bulan puasa ini menguatkan Tim Barcelona stefanus_ar- dian ?@ste- fanus_ar- dia1 @TribunSu- perBall psis, bangkiylah, kalahkan se- mua musuhmu gar bisa lo- los ke isl Sicakepzzz 10 ?@Zefan- yacakeps @TribunSu- perBall. Wow barcelona akan lebih hebat jika ada straiker terbaik dunia ney- mar and messi fonna fahl- evi | ?@fon- na_fahlevi @tribun- super- ball bayern muenchen masih rajan- ya eropa Ofcial Yahya Ar ?@ yahya_arya @TribunSu- perBall Saya doakan In- donesia imbang lawan Ar- senal, syukur syukur kalau bisa menang. #Forza_In- donesia imran purba ?@imranpur- ba82 @TribunSu- perBall : Me- nanti dua “Sayap” He- bat menuju Old Trafford yaitu BALE dan CR7. Kalo itu terjadi, M.U akan men- jadi klub paling ditakuti yogie wibowo ?@yogie_ wibowo @Tribun- SuperBall walau hada- pi arsenal pokoknya tetep merah putih. Tito Hendra- ’pase... ?@ titohendra @Tribun- Super- Ball Pers- iba akn menjadi juara IPL 2013 seperti yang pernah dilakukan di DU Zidan Ari ?@ zidan_ari @TribunSu- perBall wel- come to in- donesia ARSENAL and your skuad in match INDONESIA vs ARSENAL and this score is 2 1 for INDONESIA win Angga kur- niawan ?@_ang- ga97 @Tribun- SuperBall GO,GO,GO Timnas Indonesia kamu pasti bisa mengalah- kan ARSENAL jika kamu berusaha kamu pasti bisaa”GDD” @nurfzn @Tribun- SuperBall: Akankah tim Indone- sia menang melawan tim Arsenal? Saksikan Ar- senal Asia Tour 2013, Min- ggu 14 Juli 2013 di SUGBK @MProEnt” AFP PHOTO / LLUIS GENE JEMPOL - Striker anyar Barcelona, Neymar, mengacungkan jempol saat tiba di Stadion Camp Nou, Barcelona, 3 Juni 2013. Neymar akan melakoni El Clasico perdana pada 27 Oktober 2013. inzet: Kostum pilihan untuk Neymar. AFP PHOTO / PATRIK STOLLARZ TIM DORTMUND - Skuad dan osial Borussia Dortmund berfoto bersama sebelum melakoni latihan di Dortmund, Jerman, Rabu (10/7), untuk menghadapi musim 2013/14. Dortmund musim lalu lolos ke nal Liga Champions. Belakang (ki-ka); Andreas Schlumberger, Andreas Beck, Florian Wangler, Sokratis, Lasse Sobiech, Neven Subotic, Mats Hummels, Marian Sarr, Sven Bender, Frank Graefen, Markus Braun, Teddy de Beer. Tengah (ki-ka): Peter Kuhnt, Thomas Zetzmann, Thorben Voeste, Kevin Grosskreutz, Julian Schieber, Marvin Duksch, Robert Lewandowski, Pierre Emerick Aubameyang, Marco Reus, Henrikh Mkhitaryan, Peter Krawietz, Zeljko Buvac, Juergen Klopp. Depan (ki-ka): Oliver Kirch, Marcel Schmelzer, Jakub Blaszczykowski, Nuri Sahin, Zlatan Alomerovic, Roman Weidenfeller, Mitch Langerak, Ilkay Guendogan, Koray Guenter, Jonas Hofmann, dan Sebastian Kehl. CHELSEA.COM Mark Schwarzer LUIS SUAREZ AFP PLUSFUTBOL.COM JEMPOL - David Villa bersiap menjalani tes medis bersama Atletico Madrid, Rabu (10/7). join follow @portalsurya
  • 21. | SUPERSPORT| KAMIS, 11 JULI 2013KAMIS, 11 JULI 2013 HALAMAN 19 Super sport BENVENUTI CALLEJON!Hari Ini Jalani Tes Medis di Napoli AKHIR pekan lalu, ko- ran olahraga Spanyol, Marca menulis ber- ita berjudul “Ar- rivederci Calle- jon” yang artinya “selamat tinggal Callejon”. Mereka sepertinya sudah mengendus penyerang Real Madrid bernama lengkap Jose Maria Callejon ini bakal dilego menuju klub Serie A Napoli. Kemarin, giliran sejumlah me- dia di Italia yang ramai menulis judul berita “Benvenuti Callejon!” atau “Selamat datang Callejon”. Penyerang serbisa berusia 26 tahun ini memang dikabarkan telah res- mi bergabung dengan Napoli. Man- tan penyerang Espanyol ini dijadwal- kan menjalani tes medis hari ini (11/7), sebelum menandatangani kontrak den- gan klub Italia tersebut. “Siang ini, Jose Mario Callejon su- dah mendarat di Naples. Besok, ia akan segera menjalani tes medis,” de- mikian pernyataan resmi dari kubu Napoli, kemarin. Napoli tak me- nyebutkan detail finansial soal transfer tersebut. Namun, pe- kan lalu dikabarkan klub berjuluk Partenopei ini membelinya dengan harga 10 juta euro (sekitar Rp 127 miliar). Nilai tersebut membuat Madrid nyaris untung dua kali lipat. Dua tahun lalu, saat Ma- drid membeli kembali Callejon dari Espa- nyol, harganya masih senilai 5,5 juta euro (Rp 70 miliar). Nilai pasar Callejon terus meningkat seiring penampilannya bersa- ma Madrid di bawah arahan pelatih sebe- lumnya, Jose Mourinho. Di tangan Mour- inho, Callejon total tampil 3.403 menit dengan torehan 20 gol. Callejon yang digaji 2,1 juta euro (Rp 26,7 miliar) per tahun selama membe- la Los Blancos, kabarnya akan diupah 3,5 juta euro (Rp 44,6 miliar) oleh Napoli. Callejon dikabarkan tertarik bergabung dengan Napoli karena sosok pelatih baru mereka, Rafael Benitez, yang sama-sama berasal dari Spanyol. Sebaliknya, Benitez menilai Callejon akan membuat Napo- li semakin tajam. Callejon mencetak 3 gol dalam 30 penampilannya bersama Ma- drid pada musim lalu. Callejon sendiri hengkang dari Bernabeu lantaran ia kesulitan mendapatkan tempat utama. Keberadaanya tertutup dalam bay- ang-bayang pemain top dunia seperti Cris- tiano Ronaldo, Angel Di Maria, Karim Ben- zema, dan Gonzalo Higuain. Kesempatan sepertinya akan semakin sempit untuknya setelah Madrid menda- tangkan penyerang bintang baru Spanyol, Isco dari Malaga. Kebetulan, keduanya berposisi sama yakni menjadi penyerang gantung, dan bisa juga ditempatkan seba- gai winger. Callejon sepertinya bisa mem- baca situasi bahwa ia akan kalah bersaing dengan pemain baru tersebut. Callejon sendiri menjadi rekrutan ked- ua Napoli musim ini. Sebelumnya, run- ner up Liga Italia musim lalu tersebut sukses mendatangkan winger PSV Eind- hoven, Dries Mertens. Kedatangan Calle- jon setidaknya menjadi pelipur lara bagi Napoli karena sebelumnya gagal menda- patkan striker Bayern Muenchen, Mario Gomez, yang memilih bergabung ke Fiorentina. Napoli memang gencar mem- buru striker anyar setelah bomber anda- lan mereka, Edinson Cavani merapat ke klub Prancis, Paris Saint Germain. Kehadiran Callejon di serie A akan me- nambah deretan pemain Spanyol yang mendarat ke Italia musim ini. Didikan akademi Madrid itu segera menyusul kompatriotnya yang telah resmi berga- bung dengan klub Italia lainnya seper- ti Borja Valero, Joaquin, Marcos Alonso (Fiorentina), Fernando Llorente (Juven- tus), dan Pedro Obiang (Sampdoria). (Tribunnews/den) Meroket 2 Kali Lipat - 2011 Dibeli Madrid dari Espanyol Rp 70 M - 2013 Dibeli Napoli dari Madrid Rp 127 M - 2011 Digaji Madrid Rp 26,7 M per tahun - 2013 Digaji Napoli Rp 44,6 M per tahun Loyalitas Bomber Veteran ANTONIO di Natale dipastikan saat ini sedang berbunga-bunga. Harapann- ya untuk kembali membela Udinese akhirnya tercapai setelah manajemen La Zabrete mengikatnya lagi sam- pai Juni 2015. Tidak hanya sampai di situ, Udinese bahkan menambah- kan opsi perpanjangan kontrak satu musim lagi kepada pemain berusia 35 tahun itu untuk musim berikutnya, 2015/2016. Penandatanganan kontrak baru itu diumumkan melalui situs dan akun Twitter resmi Udinese, kema- rin. Kepastian itu seklaigus men- gakhiri spekulasi transfer sang strik- er. “Udinese mengumumkan telah memperbarui kontrak dan kesepaka- tan ekonomi dengan Di Natale sam- pai 30 Juni 2013,” demikian perny- ataan resmi klub seperti dikutip dari, kemarin. Di situs resmi klub, mantan pe- main Empoli itu berfoto bersama Di- rektur Udinese Franco Collivano, sem- bari meneken kontrak barunya. Di Natale telah lama berharap menda- pat perpanjangan kontrak tersebut. Meski sebelumnya santer diberitakan bahwa AC Milan tertarik untuk mem- boyongnya, Di Natale mengabaikan berita tersebut dan tetap ingin berta- han di Friuli. Meski usianya sudah tak muda lagi, Di Natale masih mampu men- unjukkan kegarangannya di mulut gawang lawan. Pemain internasion- al Italia itu selalu membukukan lebih dari 20 gol dalam empat musim tera- khir. Pada tahun 2010 dan 2011, Di Natale keluar sebagai pencetak gol terbanyak Seri A. Musim lalu ia sukses mencetak 23 gol dari 33 penampilannya bersa- ma Udinese di kompetisi tertinggi Ita- lia tersebut. Total, sejak bergabung ke Udinese pada 2004, penyerang beru- sia 35 tahun itu sudah mengolek- si 158 gol dari 298 penampilan yang membuatnya jadi top skor klub sepan- jang masa. Loyalitas di Natale pada klub yang bermarkas di Udine ini memang su- dah teruji. Ia sebenarnya punya kes- empatan untuk bergabung dengan raksasa Seri-A Liga Italia, Juventus. Namun, dia menolak pinangan Juven- tus dengan alasan ingin jadi legenda Udinese. “Saya pikir apa yang telah saya lakukan dengan Udinese akan menja- di sejarah klub. Saya tidak melihatnya sebagai sesuatu yang tidak penting,” ujarnya saat diwawancara di FIFA. com, beberapa waktu lalu. Pada jendela transfer musim panas 2010, Juventus ingin mendatangkan Di Natale ke Juventus Stadium. Juven- tus membidik Di Natale karena bekas pemain Empoli itu menjadi pencetak gol terbanyak di musim 2009/2010. Namun, ketika dihubungi tim Nyon- ya Tua, Di Natale mengatakan tidak ingin meninggalkan Stadio Friuli. “Saya mengatakan kepada Presiden Juventus, Andrea Agnelli, bahwa saya ingin bertahan di sini,” ujar mesin gol yang akrab disapa Toto itu. Alasan lain yang membuat Di Na- tale bertahan adalah Kota Udine su- dah ia anggap seperti kampung hala- mannya sendiri. “Udine seperti rumah kedua buat saya,” ucap yang prak- tis belum pernah bergabung dengan klub elite di Serie A ini. Ada hal lain yang membuat pemi- lik caps 42 dengan 11 gol untuk tim- nas Italia ini betah di Udinese. Ia merasa tidak pernah merasakan te- kanan yang berlebihan dari pemilik atau para suporter klub. “Anda da- pat kalah dalam beberapa laga, tapi tetap bisa bekerja dengan tenang,” katanya. (Tribunnews/den) AKHIR pekan lalu, ko ran olahraga Spany Marca menulis ber ita berjudul “Ar- rivederci Calle- jon” yang artiny “selamat tinggal Mereka sepertiny mengendus penyer Madrid bernama le Maria Callejon ini menuju klub Serie A Kemarin, giliran sej dia di Italia yang rama judul berita “Benvenut atau “Selamat datang C Penyerang serbisa beru ini memang dikabarkan mi bergabung dengan Na tan penyerang Espanyol in kan menjalani tes medis ha sebelum menandatangani kon gan klub Italia tersebut. “Siang ini, Jose Mario Calle dah mendarat di Naples. Beso p g gakhiri spekulasi transfer sang strik- er. “Udinese mengumumkan telah memperbarui kontrak dan kesepaka- tan ekonomi dengan Di Natale sam- pai 30 Juni 2013,” demikian perny- ataan resmi klub seperti dikutip dari j g g y gawang lawan. Pemain internasion- al Italia itu selalu membukukan lebih dari 20 gol dalam empat musim tera- khir. Pada tahun 2010 dan 2011, Di Natale keluar sebagai pencetak gol terbanyak Seri A. , tus dengan Udinese. “Saya pi lakukan de di sejarah sebagai se AFP PHOTO ATRAKSI - Pelatih anyar Napoli, Rafael Benitez memamerkan kemampuannya mengolah bola di depan siswa akademi sepak bola Napoli. lite di Serie A ini. hal lain yang membuat pemimi- ps 42 dengan 11 gol untuk timm-- alia ini betah di Udinese. Ia sa tidak pernah merasakan tee- yang berlebihan dari pemilikk para suporter klub. “Anda da-- alah dalam beberapa laga, taapi bisa bekerja dengan tenangg,” ya. (Tribunnews/den) DataDiri Nama lengkap: Antonio Di Na- tale Tanggal lahir: 13 Oktober 1977 (35 tahun) Tempat la- hir: Naples, Italia Tinggi: 1.70 m Klub: Udinese Posisi: Striker Nomor: 10 Main: 298 Gol: 158 Moratti: Thohir? Tidak Sekarang! PRESIDEN Inter Milan, Massi- mo Moratti blak-blakan. Berbi- cara kepada reporter di Pirelli Store di Milan kemarin, ia meny- inggung soal kemungkinan di- rinya menjual semua saham In- ter Milan. Namun taipan minyak asal Italia tersebut memastikan akuisisi Inter tidak akan terjadi dalam waktu dekat. Spekulasi yang berkembang, Moratti diisukan bakal men- jual sebagian saham Inter — sekitar 40%-75% — ke pengusa- ha asal Indonesia, Erick Thohir. Moratti mengiyakan negosia- si memang sedang berlangsung tapi ia menegaskan tidak ada kepastian waktu kapan nego- siasi itu akan selesai. “Thohir di Inter? Mungkin suatu hari. Tapi tidak sekarang. Banyak orang sedang menunggu penjualan saham tersebut. Tapi itu tidak terjadi. Orang-orang se- lalu menetapkan tenggat wak- tu untuk hal-hal itu, tapi peristi- wa menggantikan mereka,” kata Moratti dikutip dari Gazzetta dello Sport, kemarin. Terkait negoisasi dengan inves- tor dari Cina tahun lalu yang juga berusaha membeli saham mayor- itas di Inter, Moratti mengatakan pihaknya selalu terbuka akan ber- bagai kerja-sama. Ujung-ujungn- ya, kerja sama itu terwujud dalam bentuk sponsorship. Mungkinkah hal serupa akan terulang dengan Thohir kali ini? Moratti hanya memberikan jawa- ban diplomatis, “Thohir, aku tahu dia orang yang yang terpandang. Dia datang dari keluarga yang sangat terhormat dari seorang in- dustrialis. Tapi, secara pribadi, aku tidak tahu banyak tentang di- rinya,” katanya. “Sudah ada banyak pembic- araan, dan jika kita tidak pada tahap pertama dari negosiasi, kita berada di tahap kedua. Tu- juannya adalah untuk menego- siasikan dan mencoba mencari tahu apakah ada kesepahaman antara kami,” ujar Moratti yang saat ini menguasai 90 persen sa- ham Inter Milan. Terkait dengan transfer pemain di musim panas ini, Moratti opti- mistis bisa mendatangkan pemain yang berkualitas. Kali ini yang menjadi target pembelian selan- jutnya adalah gelandang Juventus asal Cile, Mauricio Isla dan juga gelandang Cagliari berdarah In- donesia, Radja Nainggolan. “Kami telah mendatangkan be- berapa pemain bagus, namun se- mua tergantung dari bagaimana Mazzarri (Pelatih Walter Mazzari, Red) menilai kekuatan klub di sesi latihan pramusim. Biasanya hal-hal menarik justru terjadi di akhir bursa transfer,” ungkapnya. “Isla? Hubungan kami den- gan Juventus cukup baik, kami berusaha mendapatkannya. Se- lain itu muncul banyak spekula- si mengenai Nainggolan, namun sejauh ini perkembangan negio- siasi masih cukup lambat.” Bursa transfer musim panas ini adalah periode yang cukup sibuk bagi Nerazzurri. Sejauh ini mere- ka telah mendatangkan sejumlah nama yang diharapkan bersinar musim depan seperti Ishak Bel- fodil, Mauro Icardi, Hugo Cam- pagnaro, dan juga Diego Laxalt. (Tribunnews/den) ISTIMEWA Massimo Moratti (kiri), dan Erik Thohir Berkualitas, dan Menghibur RAFAEL Benitez bertekad meng- hadirkan Napoli sebagai klub yang tak hanya berkualitas, tapi juga bisa menghibur para penonton. Dua hal itu, katanya, menjadi rahasia salah satu klub asuhannya, Liverpool, hingga bisa menjadi klub legendaris di Inggris. Dalam wawancara dengan Minu- to 116, Benitez mengatakan, salah salah alasan dirinya menerima pinangan Napoli di antaranya juga kerena klub tersebut memang mengingatkannya pada The Reds. Kedatangan Benitez ke Napo- li saat ini merupakan kali kedua bagi dirinya melatih klub asal Italia. Sebe- lumnya, ia pernah berada di Serie A untuk melatih Internazionale yang saat itu hanya bertahan enam bulan. Kini bersama Napoli, mantan pelatih Chelsea tersebut mengaku sangat antusias. Apa yang dira- sakan tersebut, baginya mampu membawa kembali kenangannya saat bersama Liverpool. “Saya menerima tawaran Napoli sebab ada antusiasme dan gairah di dalamnya. Saya ingin memba- las kepercayaan tersebut dengan performa tim di lapangan. Tim ini memiliki kualitas dan selalu haus akan kemenangan. Itulah yang mengingatkan saya kepada Liver- pool,” imbuh Benitez. Untuk menggapai ambisi men- jadikan klub yang berkualitas, dan menghibur itulah, Benitez gencar mendatangkan sejum- lah pemain anyar. Setelah ber- hasil mendatangkan Jose Maria Callejon dari Madrid, dan winger PSV Eindhoven, Dries Mertens, ia sekarang tengah membidik tanda tangan kiper Queens Park Rang- ers, Julio Cesar. Kiper Brasil itu diplot menggantikan Morgan de Sanctis yang dibidik AS Roma. (Tribunnews/den) Nomor 9 untuk Icardi PENYERANG anyar Inter Milan Mau- ro Icardi merasa sangat tersanjung di- beri nomor keramat, 9. Pemakai no- mor ini sebelumnya adalah Tommaso Rocchi. Mantan penyerang Sampdoria berusia 20 tahun ini pun berjanji tak- kan menyia-nyiakan kepercayaan dari pelatih Walter Mazzarri itu. “Mazzarri berjanji saya akan men- jadi bagian penting di Inter. Semoga saya tidak mengecewakannya. Men- genakan nomor punggung 9 merupa- kan tantangan besar di klub seperti In- ter. Namun, saya tidak takut. Saya ingin mencetak gol sebanyak mungkin dan berjuang merebut Scudetto,” kata Icar- di kepada FC Inter News. Bomber muda asal Argentina ini me- mang bisa sesumbar dengan percaya diri karena ia bakal dibimbing oleh para kompatriotnya. Tak tanggung-tanggung, di klub Inter saat ini terdapat delapan pemain asal negaranya yai- tu, Javier Zanetti, Esteban Cambias- so, Diego Milito, Rodrigo Palacio, Walter Samuel, Juan Pablo Carrizo, Ricky Alva- rez, dan Hugo Campagnaro. (Tribun- news/*) Jose Maria Callejon AFPPHOTO join follow @portalsurya
  • 22. KAMIS, 11 JULI 2013 SURABAYA MOBIL DIJUAL SHOWROOM DIJUAL DYNARINO125LtDUMP’2006130jt Ng, Mitsubishi CANTER’2007 110 Ps 165jtNG. AVANZA G Hitam’2010 140jt Ng (krdt) GENIO’92 Nopol-AD Hitam 55jtNg %0821 39965559/031-34347222/031-70130282 975885 BMW BMW 320i Th’94 (L) 49Jt Istimewa Ori Bs TT, Ngagel 127A Pojok Jembatan 975990 CHEVROLET CHEV TROPER 4x4 Dbl Gardan’85 Abu2Met AcTpVr(35Jt)Ng %77178889-085745355592 975747 DAIHATSU BARU. PU Dp.11jt, Xenia Dp.17jt, Luxio Dp.19jt Hub: 71616154/0821 4386 1369 973539 DAIHATSUPROMOHRGPASTITRMURAHDis- conTrbesar%Daniel72178177-085648487996 974175 DAIHATSU SAMBUT MUDIK.!TDP Xenia D 24jt,M 25jt,R 29jt;Terios 30jt;Luxio 23jt.Ang Ringan.READY%72026520 974190 “PROMOLEBARAN“XeniaDp27@2,7.PUDp 13@2,3.GmaxDp24.TeriosDp30%71433990 974207 MUDIK pake XENIA NewAIRBAG bunga Rn- ganmlai@1,8jtn/paketASIKJULI%34441001 974526 2013NewXniaLuxioTeriosSirionGmax.DIS- CONOK.Resya%34936665/081333060404 974535 Espas PickUp’96 S.Pakai N-Probolinggo 30jtJl.Abdul KarimRungkut 57%81421092 975767 XENIALi’05Ac/Tp/Vr/Ps/Pw/Cl%71328337 / 77519675 penjaringan timur 12B 975776 Xenia’2011 silver over kredit Dp35jtNg 27x3,8jt(w-sda)Ass all risk%70058089 975803 TAFT ROCKY’89 Hitam Istimewa 53Jt Nego Medayu Utara 30/99 %78200001 975789 ESPASS’06 Pick Up H.44JtNego Hub: %081515453051 / 031-77165316 975785 ZEBRA 1.0 Tropeer’90 Merah H.Nego Hub:%031-91943389/085645001589 975788 CLASSY’91 Orsinil Cat Ry Tenggilis Mejoyo KB-14 %72153329 975786 ZEBRA PU 92SIAP PAKAI23Jt(L)Sukodo- no Telp;70404186 . 975715 CHARADE BAKPAO’89 Ac/Tp/Vr Surat Baru Hub:031-72390819 / 085648952075 975811 HIJETPUBOX‘86PmkAC/RT/VRAn.Sendiri Istw Pajak+Kir Baru %60422472 (TP) 975806 TAFT GT ‘86 AG 4x4 Pwr Lgkp 45Jt Special Off Road Bagus Ngagel 127A Pjk Jbt 975707 XENIA Li DLX PLUS’11 AC/TP/VR/PS/PW 115jtng.BSKREDIT.Ry.Kundi38A%71697325 975671 Pkt Mudik Astra Xenia:Dp26Jt PU:Dp10Jt Terios:Dp29Jt Sirion:Dp27Jt 81945588 975685 GRAN MAX PICK UP Th’2008 ESPASS Pi- kUp ‘2004 HUb:%8536737 -081234372255 975813 ESPASSZL’2001SILVER100%OrsCatSuper Istw AC Tp Var%031-71149385/31374649 975886 Taft hiline 4x2Long’90 mesin catBgs,60Ng Abdurachman179juanda%087853345553 975895 *** CHARADE th ‘89 Merah.Ac/Tape*** Rp27Jt Nego. Hubungi : 03178090393 . 975912 ESPASS 1.6’96 (W) AC dbl/TP/VR Hijau Met 41jt H:031-72484734/0857 8109 2369 975930 TAFT HILINE ‘86 (B) Long 36Jt Istimewa Bs TT Ngagel 127A Pojok Jembatan 975988 XENIA Li’05 Fulvar(85Jt)+Panther Hi- Grade’03(115Jt) Jl.Sidotopo Wetan 20A 975969 *TAFTINDEPENDENT’96GREY4X4AKTIF Bdi Klg ban 31(L)istw H:082.131.650.999 975979 Zebra Pmk’92 PdjoyoHbAcDbl Blwer Tp Wd l/d KlgOri21jt%28841909/085732889485 976069 XENIA LiVVTi’08Silver,N(Mlng)99,5jtHub: Deltasari %31225637 / 8552980 976029 CLASSY’92 Saloon Ac/Tp/Vr/Pw/Ps W- grsk s.pake 35jt % 70279049 976138 ZEBRA Mdl Troper Bd’92 Ac/Tp/Vr STN’88 SptBr Tubanan Baru /23 18Jt%71964850 976134 CHARADE’86,HIJET 1000 STW’86; Simogu- nung Kramat Barat 5/11 %031-78652101 976146 ESPAS Picup 3Way 03 AcTp Hitam Pajak Baru.41Jt.Mnyar Krtaadi 7/22.%92347907 976152 LUXIO D ‘2010HitamOrsCatBagus100jtNg DukuhKupangTimur12/52%087854789400 976140 XENIA 1.3 Xi’10 Hitam Ori Istw PjkBaru 112jt Perum YKP RL 5K/9%081331100600 976151 BARU XENIA DP 22Jt,PUP DP 13Jt,M.Bus DP 23Jt. Hub: 70820530 - 081335365001. 976316 PROMO LEBARAN,Xenia Angsuran Mulai 1jutaan,Buruan!!!%72976664/082126827211 976303 Terios 08,Pmk Htm Spt Baru Harga 125,5 juta Nego Hub%7386035,0811351148. 976348 KRD Mrh PU Gmax UM9,8/2,4jt New Xenia UM21/3,3jt Terios UM30/4,6jt%77580538 976225 ZEBRA’93Ac/Tp/VrL-SbyBrgBagusBambe Driyo Indrokilo 22 %72675540 976363 XENIAXi1.3’09HitamMetalikSemolowaru Tengah I/12 %5961443-71282367 976361 FEROSA 95 AcTpPsVr.OrsTtl.Gaul NoFavorit 58Jt.Karangpoh4/11 Tandes%70643077 976335 CLASSY ‘95 Ori AC Dingin Elektrik Normal 41,5Jt Ng %77148076-081233404075 976355 XENIAXiPLUSDELUXE’2010 Hub:71167742 - 081331130015 976344 FEROZA’95Ac/Vr/Rt/Cd/Audio/PsHijauMet 50Jt;Manukan Tengah 8-G/1%71250777 976369 JUAL MURAH XENIA Xi Deluxe’11 120Jt;Luxio M ABS’09 105Jt;Zebra body- tech’94 30Jt Semua Kond brg Istw&Siap Mudik,Harga Nego Hub:03188265530 976237 XENIA Li DELUX PLUS 2009 Spt Baru Bs Kredit s/d 4th %081259582030/71391838 976259 D.ZEBRA ‘91 Lyn Porong/Jabon Siap Pakai 15Jt Hub : Sidoarjo %081330570379 976246 D.CHARADE 1.6 ‘93 Blue Back Siap Luar Kota 40jt Hub:70399898/0812.316.9898 976226 XENIA Xi’2005 Hitam (L-Sby) Orisinil 101,5jt Hub:031-70798201/83093156 Sda 976223 Espass ’96 Silver AC/TP/VR L A/N Sdri %081331822601 / 72197285 / 70596858 976204 FIAT FIAT 124S ‘75 AC TP (12Jt) Bumi Suko Indah FF-21 Sda %031-71195415 976250 FORD FORDESCAPE2.04x2XLT’04M/THtmTgn1 DrBru Spr Istw STNK Bru%08883213878 976312 FORD GIA’91 Abu2 AcPwPsAudio Msn Halus Trwt istw Djmin Puas 33jtNg%70078606 976145 HONDA EXCELENPMK‘81AC/TP/VRDLMORSPUTIH JAZZBGSPUOL14,5JT%081233104235BU 975791 JAZZ07MANUALVtec(TopGrade)SgtMulus SutorejoSel1/4%70228877/081330228877 975720 PRESTIGE ‘86 L Pas 26Jt Pajak Baru & Is- timewa Bs TT Ngagel 127A Pojok Jmbtn 975718 WONDER th’88 Ac/Tp/Vr/Pw W-Sda Sngt Istimewa=35JtNG.SukodonoSda.%71833349 975674 GrandCivic’91Tg1 AnSdr DrBr Cat Bd+ Int 100%OrsKm125rb70901558/081331235999 975744 CIELOA/Tth‘94AudioTvDp26JtAngs.1,6Jt Krng 23x.Istw.Hub:081235081238. 975909 JAZZ RSA/T’10+08Km65rbDP16JtTT/KRD,Ry MstrpKedurusDkh14%7664215/31033561 975925 GENIO ‘94/93 (L) AC/CD/MP3/PW/PS/Vr16 LuarDlm Bgs PjkBaru 63jt%72485404 SDA 976031 JAZZ’04 Manual Biru Sgt Trwt Jual Cpt Msh Ori (L) 114jt Nett BU%08123138340 975938 JAZZ’06 M/T Htm (L) Ors,Mulus,Sgt Bagus bs TT/Krdt %72447948/0816 1543 8382 975940 Maestro ‘93Abu2S.PakaiPjkBaru54jt/Spd Supra X’06 (7,5) %0821 4259 6559 976067 HONDA CITY’96 Mulus Biru Tua.Taman In- dah Regency CD-10 Taman Sepanjang 976129 HONDA CITY ‘97 W-Sidoarjo, hitam milik pribadi 65jt %0857 3082 3209 976123 STREAM A/T’2002 Silver OrsCat Istimw 113jt Dukuh Kupang Timur 12/3%71206540 976141 Stream 2.0 ‘2004 A/T hitam OrsCat ban- Baru 140jt RySepanjangTani 22%70090066 976175 PRESTIGE ‘87 (L)ACDingin/TP/PS/PW/VR/ ORI Mulus=27Jt Nego. 081333247989 . 976310 CIELO’97BiruMalam(W-SDA)IstimewaSemo- lowaruTengahI/12%5961443-71282367 976362 MAESTRO’90 Putih Manual Ac/Tp/Vr/Rmt Pjk Baru (38Jt) Hub:%71987171-5469615 976364 HONDA CIVIC’76 Full Modif Vr Jual Murah 6,5Jt Bisa TT Spd Motor%08175011673 976205 HONDAMAESTRO‘90HitamOriPWPSLeng kap Siap Lebaran 40jt %0819016162230 976248 STREAM’02 Manual SilverMet DP 45Jt angs 3Jt’an.Pondok Mutiara N-19 Sidoarjo 976256 ALL NEW CRV 2.0 Th’2007 Surat Br Jok Ku- lit Hitam Istimewa %71530900/8914174 976238 Accord prestis ‘86vraudiopwpsac23,5jt sidokare asri A-5 sda%72712840 976324 HYUNDAI JUAL SUKU CADANG Mobil Korea “53 Mo- tor” Tlp:(031) 34558853,77706153,5314270 973238 ATOZ GLS 1.1CC Th.2007 hitam tgn1 pjk+ban Ok bgs skali % 082139443636 975772 HYUNDAI EXCEL II ‘2004 B 45Jt Bukan Ex Taxi Tgn1 Dr Baru Ngagel 127A PjkJbt 975709 ATOZ GLS Automatic’00(L)Biru Pjk Baru Kond Betul2 Bgs&Terawat %087852796805 975961 HYUNDAI ACCENT ‘00+06 Silver Ori Total Asli Pakai Pribadi RL 5K/9 %70788900 976154 ISUZU PANTHERPUMsnTurbo2009fullAC,full Music. TOKO TAMYIS Raya Tenggilis 129 975725 PNTHER’96AC/TP/VROrsinil62jtngKRDIT OK.Perum sedati asri GG/15%71696056 975653 PANTHER PPL’91 Wrn Abu2 Metalic Ac Do- bel Blower,Vr,Ps Hub:081357347576 975717 Dijual MB 14set Isuzu New Elf Euro 2 Th’09 Full.Ac/Audio 185Jt 081249149319 976038 PANTHER GOLDEN’93 Ac/Dbl/Cl/Pw/Ps Siap Pakai Pajak Baru Hub:%081703300742 976293 ISUZU PANTHER’92 AC/TP Simogunung Kramat Barat 5/11 %031-78652101 976143 PANTHERLS’2002M/TBiruMtlkPajakBaru AE-MadiunSangatBagus%031-72341737 976160 PANTHER LV ‘2002 VR AC Alarem +PAN- THER PPL’95 Harga=47jt %031-3461 4575 976166 PANTHERPPL’95HijauAcDblPjkBaruSemo- lowaruTengahI/12%5961443-71282367 976366 PANTHER PICK UP’10 Turbo Hitam Ac,Cd Mulus Jl.Pandigiling318 III%0811330734 976191 PANTHERSMARTTURBO2010 Hitam Hub:8662324/08165407900 976264 PANTHER Deluxe’00 Merah Met Istw DP Ringan bisa krdt.Pondok Mutiara N19 Sda 976253 NEW HIGRADE’00 Ors Coklat Md Met Bgs a/n Pembeli 94,5jt Nego H:085730322229 976222 KIA CARNIVAL BENSIN AT ‘00 HitamMet Ba- gus Mewah Nopol Pilihan 60jt 03170712900 975932 MAZDA MAZDA CRONOS’98 Semuanya Baru Minat Hub:%031-70087007 975900 MAZDA E2000’1997 Ac/Tp/Vr Ors Cat Is- timewa 48jt Nego %71555913 / 70058012 976341 MERCEDEZ Dijual Mercy C180 Th’96 Warna Hijau Botol Mtlk Hrg:77,5Jt Hub.081249149319. 976015 MERCY BOXER 300E th ‘91 Coklat Metalik. Ac/Tape/VR. Hubungi : 083849633359. 976269 MERCY 300E TH’89 Coklat Kondisi Bagus (Plat-L) H=36Jt Hub:71334989 976267 MITSUBISHI GALANT V6 Silver Th’95 (S-Mojokerto) Ba- rang Bagus Terawat%085851283338 975698 T120SS New Armada’96(L)Tg1 F.Var Biru 100% BrgBagus!! 38,5JtNg%081252306669 975705 LANCEREVO3‘94Hrg50JtNego %0817319396 / 70887623 975697 L-300PICKUPTH’2002Th’2000 %8536737 -0812 3437 2255 975804 PAJEROSPORTExceed’2011/2012AT/Matic H340Jt Hub:%08121764537 975883 MITS DANGAN ‘90 DOHC Putih Ori Luar DalamPajakbaru38jtNego%085853137339 976034 LANCER EVO 3 ‘96 (GLXI) Silver Bgus Luar/ Dlm 57jt Ng 085646124849/70635899 975936 ETERNADOHC‘92(Matic)OrsLuar/DlmSgt Bgs Pnggemar 40jt Ng %081938086393 975950 L300 Pick Up Solar’01 (70Jt)+L300 PU’92 Bensin (52Jt)Jl.Sidotopo Wetan 20A 975971 LANCER EVO3 GLXi’97(L) Abu2 Betul2 Ori- sinil & Sgt Istimewa Sekali %70760824 975967 T120TH79PickUpBrgS.PakaiPjkMati16Jt Ng %77576721-081357756577 Waru 975972 MITS.L.3000BOXALUMINIUM’85 Hub:081553350400 976127 JUAL MITSUBISHI T 120 SS Th’97, Merah, AC/Tape, 5 Ban Radial Baru, STNK Baru’14, 35Jt Nego Hub:%70993042 / 08123593022, Taman Pd Jati 976285 KUDA DIESEL GLS’2000 Silver Pajak Baru Trawat istw 73jt Nego%0812 1703 6789 976148 LANCER SL’82(L) AC/TP/VR Body Kenceng Siap Pakai/Istimewa 28Jt %08885216800 976371 COLTTSS’2001NewArmadaSptBaru47jtNg RktMnggl Jl.Ky Satari 4/47 %71317865 976320 T120SS Th’97 Karoseri Armada Troper %081235246963 / 031-81821732 976266 NISSAN Xtrail’2006 OverKredit HitamMls Dp20jt s42x4,5jt(L)Ass all risk BU%70058089 975773 LivinaXV1.5 AT07 KM80Rb Tg1 DP6,7JtTT/ KrdRyMstrpKdrsDkh14%7664215/31033561 975929 TERRANO GrandRoad XTR’02 Tg1 DP6Jt TT / KrdRyMstrpKdrsDkh14%7664215/31033561 975934 NISSAN JUKE’11 Fulvar(190Jt)+GrandLivin a’07 Fulvar(125Jt)Sidotopo Wetan 20A 975966 * NISSAN LAUREL th 89 Warna Putih Ori* Ac/Tape/Ps/Pw. Hubungi:083849633359. 976190 OPEL VECTRA’95 Biru Msn Hls Ac/Tv/Dvd/Ps/ Pw/VR (W) Bs TT Mtr %081234390650 975797 PEUGEOT Peugeot Th’90 Hitam (S) Mjkrto 22Jt Bs Ansur H:71275735 & 082141286729 976060 PEUGEOT 206 Sporty’03 A/T Sensor Atret JokKulit VrPwCl Komplit%081332224069 976158 SUZUKI SUZUKIREADYERTIGA42jt,SPLASH26jt,PU 12jtBonus+DiscBsTT%031-83070053 972871 BURUAN READY STOCK ERTIGA DP.42JT/ Angs.2,5JT,PUDP.13JT/Angs.1,9JT.BungaRingan +Bnus+Var%03177898660-081938136660 973189 SUZUKI ERTIGA MT&AT R.Stock All Colors Bnyk Bonusny SiapKirim 085232081811 973445 PU 13jt Ready ERTIGA&SPLASH L.Krm Plng MrhDiscBsr%031-31415400-083831689488 974220 PU 13jtan,SPLASH 20jtan,Ertiga,APV SX4 Krd-6th Pasti ACC Bs.TT DiscByk Ready Bns Byk%031-71134115-081703911488 974202 SPLASH 20jtan,Ertiga 40jtan,Swift 40jtan,PU10jtanProsesCptTanpaTolakBisa TT%031-83009560 -0812 31419958 974389 APM SUZUKI JAWA TIMUR.MauMudik call kami,anda tlp unit kirim siap d pake leba- ran%03188000928-081325063234 975474 JIMNY Tahun’1987 Long Ac/Tp 29,5Jt Hub: 70244092/082141221097 Bangkingan-Sby 975723 FUTURA PU’95 BRG 2005 (N)35jtng Bs KREDIT.Ry.kundi38A(Tmrpsrwdg)71697325 975703 SWIFTST’2008MANUALHitamSgtMulus. Sutorejo Sel 1/4%70228877/081330228877 975716 CARRY PU’85 6Speed W-Sda Brg Bagus Ke- bonsari 2/33 %70957090-081331203044 975755 APV ARENA ‘2008 GX 107Jt Pas 99% Cat Ori Total Istimewa Ngagel 127A Pjk Jbt 975724 CarySTW’86BdExtraLmpuKotakAbu2Met 15,5jt BsAnsur 71275735&082141286729 975734 FUTURA PICK UP ‘2004WarnabiruTASIII M4/7 Sidoarjo %0813 1957 4458 975884 *CARRY PICK-UP’87 VELG RACING RALY Banbagus15JTH:03171412284Darmokali20 975918 APV’2008ARENAGX(W-SDA)ManualMerah Burgundi Ors Mobil Istw 112jt%83898988 976073 GRAND VITARA’08 JLX A/T SILVER Pajak baru kondisi oris istw:085.722.650.999 975996 SIDEKICK ‘98 Pajak Baru Terawat 77Jt Nego Hub:Anang %0815 5447 9120 BU 976050 SUZUKI ESTEEM’96 UnguMetalik a/n.sdri, Rkt Mapan Barat 5/AE-01%082142765300 976163 FUTURA‘01AC/TP/VRA/n.SdriHtmMtlkJam banganIA/7%081331217849/70070444 976289 CARY Artomoro 91.CaryBoxAntikarya’95. Cary Pup 93..Mob2 Istimewa.%92347907 976155 J.Carry 1.0 Pick Up’95(L) 36Jt,Jl.Anjasmoro 4, Bp. Usman Telp.%085733554858 976169 CARETTA’02 Silver W-SDA Ac/Tp/Vr Brg Bgs Bambe Driyo Indrokilo 22 %72675540 976352 KATANA BLITZ’91 Ors/Int Istw Putih Tgn2 Pajak Baru Bagus Hub:%70704906 976359 FUTURA REALVAN DRV’09 (75Jt) Kenjeran 207 %60254170-08175102651 976358 PROMO SUZUKI Splash Diskon Besar,Ready R3,Pick Up Hub:78187299/081216216253 976186 KATANA’94AkhirVr/Ps/AcAudioBodyOke Hrg:47,5Jt%031-72030002/08817041886 976202 APV SGX’08 Burgundy (W-Sda)DP Ringan Bisa Kredit.Pondok Mutiara N-19 Sda 976284 KATANA GX Th’97 (N-Malang) Hitam Cat Masih Orisinil Hub:081.850.8121 976228 SUZUKIKATANAGX’2003MerahMetW-Sda 73jtNegoAC/CD/VRHub:081330437340 976219 CARRYPU1.0‘96(L)PjkKirBaruS.PakaiDo- nokerto14/18%88224497-081230493412 976322 KATANA’92+CARRY’89Adiputro %031-83051151 /77120622 976372 Karimun Estillo ’08 Biru RPM/AC/TP/VRL A/N Sdri %0816518944 / 70596858 976210 TOYOTA AVANZATypeGth.2011Tgn1Km35rbkon- disi istimewa Hub:70205388 / 8792332 975782 AVANZAG.13HITAM’2010PJKBARUTGN1 ISTW135jtPAS%78349990-082141551990 975795 SOLUNAGLi’03PajakBaruAc/Tp/VrOrsinil Cat Hub:%031-77729864 975787 TOYOTAVIOSTH2004H.60JT Full Variasi Hub:%70422521 975759 INNOVA G Th’2005 Silver Harga:145jt Nego.Jl kebonsari Tirto 4 %031-83919334 975808 Avanza G 1.3 2010 Hitam, 128jt nego BU, hub. 085330958395 . 975743 Jual Cpt AVANZA G’04 BiruMet(W)SDA Mbl Bagus Tgl Pakai 109jtNg%03172366829 975761 CORONA ‘90 A/T + CRESIDA ‘86 Ors = 33Jt Ngagel 127A Pjk Jembtan %72457573 975704 LGX’03PMKORISINILNILHitamBsKREDIT. Ry.kundi 38A(Tmr pasar)087852471155 975648 KJG KAPSUL LSX DSL’2002 (L)AcTpVr Pw PsCLOrsCatBratangBinangun9/20%5041454 975737 BU Tyt Hiace PickUp th’82 diesel W-Sda pajak hidup 17.9jt %081330756525 Sda 975897 COROLLAGREATSEG’93(L)SilverOrsPjkBr Istw Sby/Mlg!081230146700/77467049 975901 KRISTA Diesel th ‘99 (L) Biru Met/Abu2 Ac Dbl/Tp/Vr/Pw 100Jt NG.03170336956 975898 INNOVA V DIESEL’05 M/T PAJAK BARU(L) ISTIMEWAHUB:08123258100J.CPTBthUang 975914 KJG SUPER G’96 PMK LONG PjkBaru Bdy klg(N-MLG KOTA)71.5jtng:72314464 Juanda 975916 AVANZAG’10HtmPjkBrTg1DP13JtBsTT/Krd RyMstrpKdrsDkh14%7664215/31033561 975933 KJG G.Extr’95AcDbl,Pw1.5ccDP18JtTT/Krd RyMstrpKdrsDkh14%7664215/31033561 975920 INNOVAG’06HtmOprKrd55JtAngs3,9Jtx15 RyMstrpKdrsDkh14%7664215/31033561 975939 AVANZA G’2010 Silver Met istimewa Siap pakai 134jtNg Bs Kredit%081231671355 975984 New LGX’03 Slver FulVar TV/DVD/MP3 Pjk Br an Sdri %082131005700/08884057708 975928 AVANZA E PLUS’07 Ac/Tv/Vr Fullvar Hitam (110Jt) H:031-36005169/083852717666 975953 ********** INNOVA TH’2008 **** Ba- gus Istimewa Hub:085.722.650.999 . 975989 Kijang Super Nusa 93 Sangat Bagus 51jt Ngagel Rejo 1/9 Hub:77656096 . 975992 *LGX’04 M/T SOLAR ORISINIL Luar/dlm istimewa pajak baru Hub:082.131.650.999 975999 Toyota Kijang Pick Up’2004 Tgn1 Bensin Hitam Velg Racing Hub:081330098969 976066 LGX‘2001BiruGelap(Tua)Manual.Solar (L-Sby) Pjk 4/2014 BU %081330754898 976070 AVANZAG’04SILVER(W)109,5JT Hub:Deltasari %08123614861 976049 Innova G 2010 tgn1 bs krdt 4th.70909872 simpang darmo p sel XI/14 976059 Soluna 2000bskrdt4h.70909872simpang darmo p sel XI/14 976056 KJGLSXSOLAR’97HtmACDbl,SrtBr80jtNg, Kemuning Asri BX-8Wistrop%70782275 976147 KIJANG LGX ‘01 Dsl Biru Met AC Dbl 115Jt Krtjy II/50A %031-5018572/77795790 976325 CORONA ‘80OrsVRMesinHlsS.Pakai12.5Jt - CORONA ‘90 A/T 15Jt %71346825 976291 TYT BARU READY AVANZA INNOVA FOR- TUNER 031-71708810-087855118649- 081230289288 976128 TYT CUCI GUDANG Disc Besar Angs 2jtan Ready Avanza,Innova,Fortuner%70078606 976144 KIJANG KRISTA DSL ‘2001 (L) ASLI Orsinil 113jt %0858 5930 1353 -77672965 976174 AVANZA TYPE G’2011 Tgn1 Hitam 95% BARU Km.40rb hub.031.70760988/081357 867099 976287 READY INNOVA BSN AllType,Rush,Yaris,F ort’12+’13,Nav G,Allnew AVANZA.Siap Leba- ran.Proses krdt super CPT%70209998 976326 AVANSA ‘2010 G 1300cc.Silver Manual. Pjk 6/2014 Km32rb.BU %081216081336 976280 BUCPTKIJANG’876SpeedAbu2 metBdUtuh Mulus AcTpVr Fulvar 37jt%081939166609 976314 AVANZA G’2010 (M) Hitam Manual Pajak Baru 129,5Jt Hub:%77761599 976360 KJG GRAND EXTRA’96 SHORT(N)Mlg,Mbl Kaleng Ori Accesoris H72,5Jt%03170248179 976345 KIJANG PICK UP’94 Biru Bagus Siap Pakai (48Jt) Hub:081217670027 976193 KIJANG PICK-UP’81/’82 Surat KIR+Cat Baru VR 20Jt Bisa TT Hub:0853 3654 9035 976208 KJG GRAND EXTRA’95 Long 1.8 HijauMet Mulus Jl.Pandigiling318 III%0811330734 976217 Kijang super 90 hijau ac dingin vr tp %081330911666 Ry tenggelis 130 sby 976367 KJG SUPER’87 Short6Sped DblBlw RtVr S- MjktAbu2 37.5Ng%71533112/082142870777 976327 TIMOR TIMOR’97 DOHC (W-Gresik)Merah Ferrari Sgt istw Ors L/D 48,5Jt %081330520937 975815 MOBIL LAIN-LAIN Pembiayaan Khusus Truck,PU,Heavy truck mulai th 98 bsKrdt s/d4th H:70080011 976072 KREDIT MOBIL CARI SENDIRI? thn 91- 99 kredit s/d 3th.thn 2000 keatas kredit s/d 4th,Hub:031-70080050 / 70080011 976142 KREDITMOBILBEKASBSCARISENDIRI.Hub: %71195447/081333008287/08165436792 976275 TRUCK OPRKRD3UnitDumpTruckISUZUNKR71Th 2011 Sdh Angs 26Bln @60Jt %08121764537 975947 TOYOTADYNASAURUS125Th’2002Dobel, Body Istw, Bak Kayu Hub:%081232647195 976309 DIJUAL ELF’95 NKR58 Ban Dobel+Box Al- munium Hub:70921404-081554000540 976274 MOBIL DICARI CARI MOBIL Sgl Kondisi,Merk&Thn Berani Hrg Tinggi%031-71491443/081231330234 976043 DICARI MOBIL Segala Merk&Tahun Berani Dengan Harga Tinggi Hub:031-70005661 976027 VARIASI/SALON MOBIL PIONEER SONY Alpine Kenwood TV/DVD HID Xenon Audio 1,5jt Accoustic%77061225 975741 MOBIL DISEWAKAN AVANZA & SUPIR DLM/LUAR KOTA harian/ carter/juanda/Drop Telp%72819411 973466 100RbMURAH Kjg,APV,Xna,Lxio+Spr,Jl Tik- et n Tour24Jam HALIM%5013744/70102636 973909 DISEWAKANAVANZA’2013+DRIVER Paling Murah Hub: 085755162847 974418 PASTIMURArntcarsiapLbarandgNewAvan- sa, xenia dll 081357602588-087854108444 975913 MOTOR DIJUAL HONDA HOT PROMO HONDA BEAT BARU AN PEMBELI +PAJAK’13 Rp.6JT/Unit Ruko Me- tropolis JL.Raya Tenggilis 127 t.71022519/ 082333808629 975681 NEW MEGA PRO CW’2010/2011 Hitam Ter- awat15,5JtNegoHub:8663749/0818318890 975702 HONDA SUPRA X 125 TR ‘2009 Dble Disc Beli Dari Baru =9.5jt %0812 1696 9272 975749 REVO FIT’2011 Akhr (7,5Jt) Kond Baik Ter- awat Merah-Htm Velq Stndrt%71241201 975696 JUAL REVO ABSOLUTE CW’2012 (8,5Jt) Tgn1BiruHitamKondisi99%Ors%71431850 975694 MEGAPRO‘07Biru(L)12JtNego.KAlibutuh Barat VI/75C Hub:%081357060177 975684 JUALSPDMTRHondaFitSTh’06HitamHrg 4,5Jt Bs Nego Hub: %03170626258 976164 Kredit Motor HONDA baru,cash back 2jt,promo bln ramadhan, trbtas T:77556797 976298 FIT S’06=4,5 BEAT Cakram CW’05=5,6 Grand’01/’99=4,8/4,6.Ist Smua. %70712999 976286 Pro94 Max91 Grnd97 Crptn97 Bravo96 Sig- ma97 Alfa94Scup82 Karah4/54 %70908555 976290 SUPRA X’2010(10JT);SUPRA X’2008(7,9JT) BABATAN INDAH A4/16 %085646184546 976343 KAWASAKI DIJUAL CEPAT KAZE’2001 3,4JtNego Jl.Karangrejo sawah 6/2-B %71304897 975754 SUZUKI SPIN ‘10 HITAM TGN-1 AN SENDIRI 6,5jt Jl.Krukah Selatan 13A NO.5 t.5038083. 975973 SATRIA FU150 th’11 bln8 Abu2Hitam a/n Sndiri hrg.15.5jt bsNEGO.031.81227367 976295 YAMAHA Yamaha Jupiter-Z’2005 Silver (L) 6,200jt nego 03170854560 / 081216365308 976058 JUAL MIO’11 8,7Jt MIO’09 7,8Jt CW Hub: Tambang Boyo 88 %085850006464 976299 MOTOR DICARI ANDA JUAL SEPEDA MOTOR? Jl.Gembong Sawah Barat 63 Sby %70526617/3715147 971403 SIFA MTOR terima sepeda mtor segala mer- ek T%031.78627106/087852608291 971604 DICARI SEGALA MERK SEPEDA MOTOR. HARGA O.K.E. Hubungi: (031) 72009479 . 976321 MALANG MOBIL DIJUAL BMW BMW 730 iL 1996 VR19 OEM Audio SQ Normal Cruize Control%082 3355 71 999 976032 DAIHATSU EXTRA PROMO XENIA DP20Jt,GMax BM DP 15Jt,Terios 20Jy Proses Cpt%0341-9572750 975561 PAKET LEBARANXENIAAngsuran1,8Jtan. Terios 2,2Jtan.PU Uang Muka 12Jtan.Luxio 24Jtan.Sirion 32Jtan%(0341)2384414 975554 HOT! XENIAAngs.1,6jtan/DP18jtan.TeriosSiri- on,LuxioG.Max%0341-9071090/081333766689 975677 DIJUAL NEW Xenia Deluxe Thn 12 Silver Cuma 50jt Cpt Bu %0341-7675888 975826 TAFTHUNTER83 Hrg 37,5Jt %03417051250/0811367207 975963 ZEBRA 94 TROPER RPM6speed/TP/VRPjk Ban CoverJok,AkiBaru SiapMudik%7556575 975981 XENIAXi2005R15AudioFull Biru Hrg 104Jt %(0341)9988599 975983 XENIA Li VVTi 2008 Hitam(N)Tgn1 Istw+ NINJA20078FulVarNEGO%7568898TdkSMS 975995 PROMO LEBARAN XENIA DP20Jtan/ANGS 1.8Jtan, PU DP13Jtan TERIOS DP30Jtan %0341-8612990 976044 PROMO DAIHATSU GMax DP8Jtan XENIA DP 19Jtan READY STOCK%081233060025/ 7033544 976045 ZEBRA 1.0 Thn 87 N-Kab 18,5jt Nego Hub:03419672714 976017 ESPASS ZSX 1.5 ACDBL TP VR ORS ISTW 05. H: JL. Masjid 115 Psr Singosari BU. 976319 LUXIO TIPE M Silver Th 2012 N-Kota Rp137,5jt Nego %5386893/081233264575 976168 PRMO XENIA 18Jt/1.8Jt,Trios 20Jt/2.2,PU 9Jt/2.4 MgguIni%7808070/08123390846 976263 EXTRA PROMO XENIA DP19Jt,GMax BM DP15Jt,TERIOS20JtProsesCpt%0341-9572750 976247 DAIHATSUCharade’93PutihPs/Pw/Ac/Cen- tral Lock %082338858794/03419188925 976305 DIJUAL XENIA2010TypeLiSilverHrg:110jt Nego Hub:03412353156/081319406581 976318 NEWTERIOSTx’12SilverIstimewaKm4000 180jt Nego Hub:03412200023 976337 FORD FORDRANGERXLTDblCabinPW,PS,EM,Air- bagVR22ASLI-NTgn1Istw%082335571999 976035 HONDA HONDA CIELO’96 Vtec Hijau Met Istmw N- Kota 75jt Nego Hub:087859953119 975228 JAZZ IDSI 2005BiruMtlk Manual (N-ASLI) OriLuarDlm Buka127JtNgo%0341-7779027 975690 JAZZRS2010Bln2Plat(L) Grey Mulus Istimwa%081334993993 975670 H.NEW ACCORD VTIL AT”00 (N) Slver Ist 95Jt:RyJantiBrt7%4433911/081945551422 975660 JAZZ IDSI Th06 M/T Slvr Bagus Audio STNK Tgn1 Baru 124Jt Nego %081333491956 975959 CIVIC VTI 03 Manual Audio TV Hitam Orsnl Cat Sgt Istm %7729518/085336511109 975968 HONDA FREED PSD 2012 (N-Kota) Ori Istw Putih Mutiara FullVar %0341-6510 223 976002 ALL NEW CRV 08 Akhir M/T Hitam(M) Jok Kulit 225jt %03419011011/081334799495 976093 GENIOTh’92N-KotaMERAHPajakBaruPS/ PW/AC/VCD-USB/VR/EMHub:0341-8111817 976323 GENIO 92 BIRU MET Mulus Istw N-KT AC/ TP/VR 62JtNego %473194 / 081334779097 976252 GENIOTH93(N-KT)Asli-NOrsAC/TP/VR16/ PS/PW/EM 4Ban Baru 69,5JtNg%9392448 976249 HYUNDAI HYUNDAI ARYA’97 Hijau Full Variasi Audio Hub:3786447 975825 SANTAFE2001(ASLI-N) Tangan1 VR19 Istw %082335571999 976033 GETZ’04 Pmk N-Kota Tv Dvd Usb Pjk Baru Hijau 89Ng D.Tondano F5D12 %7645556 976234 ISUZU PANTHER HIGRADE 2.3(L) 96 Mrh Istw 72,5Jt:RyJantiBrt7%4433911/081945551422 975659 PANTHERHI-SPORTY97N-KTTg1Abu2Ors L/DACDb/PW76,5Jt%498363/085855911295 976245 PANTHER TYPE Lv 2001 Hrg110jt Nego Biru Hub:081319406581/03412353156 976331 KIA KIA VISTO ZIPDRIVE 03(N) Ist Komplit 73Jt:RyJantiBrt 7%4433911/081945551422 975664 MAZDA MAZDA HB323’85 ACDgn/RT/VR L/D Bgs 20,5JTNG Pakis Aji%081259280133 975790 MERCEDES DJL MERCY A140’2000 N Kt,Merah Maron, Mulus Dan L300’82 Kuning %081331717508 976167 MITSUBISHI COLT DIESEL HD2011 Kilomoter 55Rb Hub%081 334 349 253 / 0343-6260 888 975384 MITSH.LANCER Dangan SOHC’90 N Putih an.sdri 33jt H: D.Sentani Timur I H1D5 975316 T120SS Th95 (L) Silver Tp/Vr Brg Bagus/Pjk Pjg! 35jt Ng %03415470070 975608 MITS KUDA Bnsn SprExeed Mrh Maroon’99 Akhr,N-kt Br Ex Dkter 87jt%0818380301 975687 APVMITS.MAVENGLS07IstwKomplit102Jt: RayaJanti Brt7 %4433911/ 081945551422 975666 MITS.SL 82 Kondisi Siap Pakai Full Kaleng AC/TP/VR 23JtNg%081252804007 Batu 976001 KUDAGLSDIESEL99Abu2(W-SDA)PjkBln5 75JtNego%0341-8454540/085755899922 976211 NISSAN NISSANHUJANDISCReadyG.Livina,March, Juke SIAP BuatLbaranAnda%081334350700 975652 NISSANTERANOSGX95Hitam(N)Istw82Jt: RyJantiBrat 7%4433911/081945551422 975661 50JTAN BAWA PULANG AllNew G.Livina PlusVchrAccsrsSnilai500Rb%085230001372 975650 READYSTOCKLEBARANAllType&AllNew Grand Livina DiskonPrdana%081234838157 976023 SUZUKI KATANA’93N-Kt/ACDingin/RT/IntOri/Body Kaleng/Msn Kering 49,5Jt Ng%5159119 975544 KATANA ‘O3 / APV ARENA ‘O8 (N) Kota ORS Istw Tgn I H:%7729467 Singosari BU 975564 ESTEEM 1300’93 Abu2 Met PW PS AC Tape Ori N-kta Msin OK 48jt Ng%082141983628 975649 PROMO LEBARAN Ertiga@2,1Jtan SPLASH DP23JtPICKUP17Jt%9568253/082141959999 975658 S.AMENITYSport91;D.Winner93AC/VR(N- Kota)Hrg @45Jt Nego %0341-8123759 975854 CARRYVRCakram6SpeedPjkPanjangSiap Luar Kota 25Jt Ng %085815528280 975954 CARRY CARETA 93 Adiputro Abu2 Met N Kt 44Jt Nego Bs TT%081803860572/2958257 975965 BELIMBLBARUSuzukiSplash/Ertiga/APV/ PickUp 1.5 Angs78Rb/hari Koi%7300957 975991 CARRY ADIPUTRO 2003 Istimewa,KATANA 96+JIMNY884x4%7038081/082335529919 976051 CARRY ADI Putro Jumbo Th99 Akhir Leng- kap Bagus Sekali%5464576/081235472587 976020 KATANA BLITZ Istmw Ac/Tp Body Klg Mu- lus Tdk Kropos %9416343/08884978935 976022 SWIFT GL M/T 2006 Silver(n)Airbags/ABS %(0341)7009900/085 3333 100 88 976184 FORSA GLX’88 Biru N Ac,Dvd,Audio,Vr,Pwr Window 33jt Ng %03417703417/9447495 976201 CARRY STW Th97 Hijau Met Body Alxnder N-Pasuruan Siap Pkai 35jt Ng %9333726 976231 TOYOTA STARLET 1.3 Se’90 Jl.Kedawung 22 Mlg %0341487161/Hp:085855337001 975236 TOYOTA MRK II 81 Ori Body Klg 23,5jt BU %0341-7755282 975256 STARLET 1.3 SE 94 Bagus GAUL VR15”/8” MerahMet BodyKaleng 65Jt%081 738 8280 975376 Avanza G 2010htmoritgn1pjkbaruNkota istw 137jt %473606-081935011717 975568 KIJANG GRAND EXTRA LONG 94/95 ABU2 MET (S-MJKT)Tg2 SEHAT S.PAKAI %0341-9311007 975695 KIJANGPUTH82Asli(N) 19,5Jt Hub%(0341)7036113 975689 LGXDIESEL2001(L)Tg1SilverOrsCat+AVAN- ZAG2008Hitam(L)Tgn1%081252884918 975678 COROLLA TH75 AC/TP/VR/PW Mesin Enak Body Kenceng 13,5JtNEGO BsTT %2811 499 975673 AVANZA VVTi 06 Hitam (ASLI-N) Ist 124Jt: RayaJantiBrt 7%4433911/081945551422 975665 LEBARAN BERSAMA Toyota.10 jta Bawa Pulang Avanza/Velos.Free Asuransi All Risk %082335239883/7717204 975682 LSX’03Efi 120JNg AcDblClPwPsEm VrB- bRtCd N-Kota PjBr Biru Irit%085234326775 975831 AVANZA07 GVvti 125JNg AcDbl PwPsClEm- RcRtCd VrBb Hitam Irit Pol%085234326775 975834 AVANZA G’06 Vvt-i Akhr (N-Kt)Hitam Km- 49rb, FullVar sgt Istmwa,audio %4444825 975905 NEWLGXDIESEL04Silver(W)Tgn1Orisinil Luar Dlm Sgt Bagus %081803865500 976011 GRNDEXTRALONG94Abu2MetOriL/DPjk+ BanBaruBgsTrwt%7610450/082333511945 976026 AVANZA G 2007 VTi BagusMesinEnak AC ,TV,VRPjkBaruN-KOTAIstw125Jt%3133131 976041 AVANZAG2008HitamPjkPjg KM40Rban (N-BATU)%085233456002 976048 AVANZA Th06 Akhir Bln12 Silver Istimewa TgnI Harga 125jt Nego %08123320647 976079 AVANZARush,Yaris,InnovaReadyUtkLeba- ran %085258968828/03418148308 976165 KRISTA’01 Akhr Gold Mtlk 115jtNg Msh Mls Jrg Pkai%081225066135/081805128134 976156 GREAT COROLLA 94 Abu2TuaMtlk ASLI-N- KT PjkBr Orgnl L/D SgtIstw%085784661224 976260 KJG LGX DIESEL 2001 Pmk(N) FullVar TV BanTbl MlsTrwt SiapPakai%0341-9736240 976258 KIJANG G TH94 ACDbl,VR L/D Ori Tgn1 Abu2 (L-SBY) 62Jt NEGO %0341-7020900 976220 AVANZA VELOZ Mt 2012 Silver Km 9000 N Istimewa Hrg Ng %9734208/081233160618 976178 INNOVA 2.0 G Manual 2010 Silver N-Kota TngI dari Baru %08125277702 976180 AVANZA G’09 Silver N-Kota Tgn I 134jt Hub:081235009568 976242 AVANZA G’09 Tgn I dr Baru Msh Mulus Sep- erti Br Mrh Maron %7644495/472974 Tp 976340 TIMOR TIMOR’97 AC/CD/VR/PW/PS/CL N-Kab/Ori L/D Pjk & No.Pjg 46,5Jt Hub: 9602008 975313 MOBIL LAIN-LAIN DJL MIKROLET LDG Suzuki 2009 Kondisi Bagus Murah Hub%081.232.475.24 976007 MOBIL DICARI CARI MOBIL Segala Kondisi/Merk/Thn Hub: 0341-9989019 976207 MOBIL DISEWAKAN EAGLE:Avanz 225rb,Inov 325Rb,Travel Mlg- Juanda Sby PP 60Rb %556600/7308111 975856 MOTOR DIJUAL HONDA PAKETKREDITBaruHonda,BeatF1DP.800, Revo DP500%087759903888,KTP Mlg,Batu 975251 HONDA GL Pro Th92(4,7Jt);GL Max Th85 (2,9Jt) %0341-2814477 975888 HONDAWINTH2005(N)Tgn-1 Hitam 6JtNego%081 615 845 418 975997 SUPRA X125”08 DblDisk 9,7Jt,KarismaX04 6,2Jt;Mio”10=9Jt,ZR 9=9,7Jt%7676072 976025 YAMAHA JUAL VIXION Hitam Th 2010 Jembawan I/4M-11 %7039471 976117 SHOWROOM HIDAYAH DP400Rb FitNew=263x36 REVO10=360x36,Spin10=355x36SmashTi- tan11=360x36,JupiterMX07=368x36,Spacy 11 =430x36 Thunder08=343x36 hub %(0341)8669766 975569 MUSTIKA MOTOR SPORT!! CBR 250cc’13 Rem ABS(35,8);CBR 150cc’12 Repsol(32);CB 150R’13 Pth(21,9);Verza Cw’13(16,9);Mega Pro CW’11(16,4);Ninja 4 Tak’10(45);Ninja RR Cw’12 Hju(25,4);KLX 12 Hju(22);Ninja KRR SE’11 Hju(32,3);Ninja KRR’05(22,4);Byson’11( 17,7);Vixion’10(18,6);FU 11 Pth(16,6);Bajaj 12 (10,7)%7718827/2844041/331830/334846 975970 MUSTIKA PROMO Gila!! Diperpanjang Sampai 18 Juli 2013 Mio Cw 10 UM 500Rb Ang.299Rb Garansi 1Th Mustika Mokas %77 18827/2844041/331830/334846 976177 KEDIRI KIJANG NEW SUPER 94 AC Dobel VR Ban- Baru Tg1 W BebasDepul Istw 085257070703 975802 CHEVTROPER4x4Disel85LongACDingin VR Ban31 Putih L Istw 085257070804 975700 Mitsubishi Fe 71 4 roda,Bak kayu Th’08 Hub 085791187775 975719 SURABAYA MOBIL DIJUAL DAEWOO SAHABAT MUDIK DAIHATSU . . . . . . . . . . 1X25 . . ........ . . . .. 976098 DAIHATSU RAMADHAN DAIHATSU . . . . . . . . . . . . . .1X25 . . . . . . . . .. 975651 PROMO RAMADHAN DAIHATSU . . . . . . . . . . . .1X25 . . . .. . . . .. 975858 PUSAT DAIHATSU . . . .. . . . . . . .. . . .1X25 . . . . . . ... . . 975864 DAIHATSU PROMO LEBARAN . . . . . . . .. . . . .. .1X25 975867 BOOM RAMADHAN . . . . . . . . . . . . . . . . 1X25 975874 DAIHATSU ANITA . . . . . . . . . . . . .. . .1X25 . . . . . . . .. 976096 BOOM DAIHATSU . . . . . . . . . . . . ..1X25 . . . . . . . . . .. 976097 PUSAT DAIHATSU JATIM. . . . . . . . . . . . .1X25 . . . . . . .. 976102 PAKET LEBARAN ASTRA . . . . . . .. . . . . . 1X25 . . . . . . . .. . . 976109 DAIHATSU PROMO . . . . . . . . . . . . .1X25 . . . . . . . . . . .. 976111 TOYOTA HOT PROMO DJOEN MOTORS . . . . . . . . . . .1X25 . . . . . . . . . . 976103 20 DAPATKAN Mobil Baru, Berkwalitas + Garansi HARGA KHUSUS pembukaan showroom A.Yani dan Jemursari Sempatkan dan terbatas BISA BAWA PULANG MOBIL BARU HANYA DENGAN 5 Rp JT
  • 23. KAMIS, 11 JULI 2013 21 SURABAYA AGEN MauPASANGIKLAN? %031-7877390, 70771654 SBY/SDA 973415 “KENZIE Adv”MauPasangIklan Hub Pe- temonBarat22%70235999/08563070541 DcrAgen 975532 PASANGIKLANSURYA+KOMPAS Telp %031-71601424 / 72858886 975943 AC/KULKAS CENTRAAC%081217713273 Cuci30 freon50 psang100 GARANSI 973695 MASTER AC/KULKAS78405999 Svc30 Freon 50 B/P100 SDA92155595 C.LAND 08785 4389666TTACBks/GantiKompresor/in-outdoor 976135 CV.TOP Svc AC,KULKAS,M.CUCI. Cuci30, Freon 50, Bkr/Psg100,JB AC Bks%71777784- 72040303 976304 FOTOCOPI/LICHTDURK J Canon IR2000=6.5Jt 6570,5075, 5/6000 MURAH Kdg Sari73 %72824008/ 085232333797 971612 CANON NP6551 iR4570 iR6570 iR5000/ 6000iR6020:JagirSidomuktiIX/39%70077444 972716 J.MSN F.COPY Rekondisi Canon ExLuar H.Sumarindo Jl.Dkh Kupang I/123%5666934 975902 KOMPUTER Dcari Laptop/Komputer Normal/Rusak/ MatiOkDiambil082333678969/03177995558 971790 DCRLAPTOP/KOMPUTER-Baru/Bekas/Rusak dibeli tunai%71386663 -0812 3038 5768 973309 DJL P4 Lkp 800rb;LGA Lkp 1,3Jt,Core2Duo Lkp 2,5Jt %081321550005/03170418967 975339 TerimaHarga Tinggi!Laptop-iPadBGJUNC- TIONL2/C42-43%81658899/082139378000 976370 P4.2.4/512/40 Rp500,D Core 950,Core2D 1.1jt.Lcd 400 H: %70209920 976342 ELEKTRONIK DICARI ANUGRAH Cari TV,PS,Dll Harga Tinggi %031-31455060,083831290655,0822302 50898 974402 TRTINGGICrTvLCDPS2&3DVDL.Es,FrzrBox ,AC,Mcuci,cokies dll5025407-72619096 976350 *DICARI LAPTOP NORMAL/RUSAK Harga TinggiDiambil*Tunai*%70004240-8298145 976196 VIDEO VIDEO EDITING, Transfer Hi8/miniDV/ memory. Telp: 031- 34827888/ 77681077 . 976307 BIRO JASA *CENTRAL* PT,CV,UD,NPWP,SIUP, Paspor, TDP,MerkAPIHO%082131007336-77336336 973894 BORSMRMSN/MANUALDgTNGAhliDibn- tu Alat Placak Smbr Dpt Air Bgs%70087551 975275 * SMILE * PT CV UD,PKP,NPWP,Paspor,SIU P,TDP,Kitas%031.81690050/085730442822 975735 PT CvUD SiupTdpHo TDI,API IUJK,JPT GAP- ENSI IMB TunggalJaya%5619667/70610028 975765 SEDOT WC SEDOTWCSURYAJAYA Rngkt%8686405 ; Krtjya%71279025 971749 PUTRABEBASMampetAhliSaluranAir/WC Dll Tanpa Bongkar,Atasi WC Cpt Penuh Tanpa Kuras%70429763/71407713 Garansi 973465 CV.MITRASEDOTWC%8791356/8712042 24jam Hari Minggu/Besar Buka/ada Diskon 973564 BRATANG SEDOT WC Sda-Waru-Tenggilis- Rungkut-Kertajaya %81825354 - 77004199 973983 ANUGRAAtasiSluranMampet,WCSaptitank Cpt Penuh Dll%79400119-085732569130 975580 “RAJAMAMPET”AtasiSlrnAIR,WC,KM,Dll yg tersumbat dg CEPATT%70971181/58206 777/08123123421/40015661 975745 JAYA KARANG EMPAT %88621795 Penjar- ingan Sari %8782440 Tenggilis %5922404 975882 JITUAHLISALURANAIRWCMampet&Sedot WCTnpBongkar-Kimia%71628003-71777759 976313 SERVICE/REPARASI HALIM SERVICE %5673655 - 71968559 AHLI TV Sgl Merk Kerja diTempat Garansi 973276 SHINTAsrvc1jamDtg%5311524-70760066 Ac Kulkas,Mcuci,P.Air,TV,Frzr,W.Hiter 973917 SURYA SERVICE%3712078/70279288 Ahli Ac/Kulkas,M.Cuci, W.Hiter,Fax,Tv,P. Air,Dispnser,P.Bola Krjkan DitmptGaransi 974188 SERVICETOSHIBA,MERKLAIN TV Kulkas MsnCuci 8793809 / 40279034 975766 SERVIS24JM GRS1TH%71481062=08123 0604259 KLKS AC P.AIR M.CCI W.HTR K.LPG TVDLL 976311 ARSITEK GAYA PLAFON SPSIALIS ACP SEVEN.Aluclad &kusenAlmini.Bongkar rngka atp Kayu Gnti dgRngkGlvalum%77606975-081615842009 975166 P-T TRUSS Melayani Atap Galvalum,Plafon Renov & Bangun Rumah H:081233378477 975278 PSGATAPGALVALUM,PSGPlapongipsummu- rahbergaransi%88275250-081946015972 975801 BANK DANA SEGAR JAMIN BPKB SERTIFIKAT %71000729 /7885046. BPR. INTAN KITA, Ketegan.7 971387 BUTUH DANA CEPAT Jaminkan Sertifikat Rumah&BPKB Mtr/Mobil BisaTakeover Pasti- ACC Sda-Sby-Grsk %087855310600 MU6/59 971517 DANACASHTNP/JAMINBPKB(mblspd)Giant DpngoroLt2CC11%70046889/087853412822 971931 DANA CPT BPKB MBL/MTR ML’86, SHM Bng 1%nan Rungkt59.PrssCpt%72522520/ 70730664 973987 BTHDANACPT2-100JtJmnBPKB,SHM/HGB Kedungdoro 167-B %70257328/70915868 975175 *LANGGENG SEJAHTERA*DANA LSG CAIR (BPKB) 70161759/0818372724 Mgnti Krmat 64wyg 975560 DANA CEPAT 1-150Jt JmnBPKB Mtr/Mbl SHM;Demak370%3520087-70029528- 0816504458 975887 DANATUNAI1-250JtLgsCairJmn.BPKBMo- bil/Truk Sms:08993880099/Tlp:71329117 975977 Bth DanaCpt ProsesCpt H:Ningrum. Simo KK1/23Hny:KTP03172810339/081554622112 976009 GADAI BPKB,STNK&SHM Bunga-+1% Bs TakeOver PucangAnomTmr42C%5019368- 70415325 976061 BUTUH DANA CEPATTanpaJaminan.Blau- ran 7 BG Junction. Tlp:03188252158 . 976229 HEWAN PIARAAN CloudyGroomingSalon Layani mandi An- jing&KucingpanggilankeRmh031-91649807 976209 INVESTASI NEW SISTEM Aman Mdl.500jt Ng Bs Laba 20%%081332732727Pin.322334A2Tp2Lt5 975906 KERJASAMA HNY 300RB DPT USHA PTG GABUS (Sty- rofoam) mdh& psti untung.MdoknSwh202 %71747385 974513 PluangUsaha DiRmhKupas2Plastik&KertasHasilPasti&Unt ung%085257169969BukitBambeAN-16Gsk 975092 “ PELUANG USAHA Hub:031-28882296 “ Modal; part time; mentoring sampai brhasil; omzet puluhan jt/bln; krj keras 976068 OPENFRANCHISEIncm100rb/HrAtau20Jt/ Bln Info%03181542698 Pin BB:30747EC4 976273 KURSUS INTENSIF MASUK PTN & FK PTS Favorit 99% di Terima.ADI %031-30253929 975805 LBB SPP Privat TK-SMA/K, Akunt, Komp, Gmbr, Msik, Modelling dll T:70404320 976240 MAKANAN-MINUMAN J.Tahu,Bkso,Siomaydrikantuna:GriyaAsri Kalitengah1K/19TnggulanginSDA8922724 976349 MESIN/ALAT BERAT Msn ctk KmoriLitron226&40 Sprint25 Olvr6 &66-Ryobi3200PFA-480NA-480K-500N- Hamada602-770cd-RolndPratika-lipatSthal K66-Bnding1&5&8mata 081703600062 975158 GENSET25KVASILENTADARODA Siap Pake%70511540-08123125085 976192 Jual: Mesin Cetak Ryobi 500N/500N-NP. Tel.%031.5341532-0811340245. 976176 DjlCptPktMsnCtkTOKO810&MsnHanpres Norator 10bj, Kond Bgs (30Jt Ng) Kedurus Swh Gede IV/14 %03171888857 976354 DIJUAL COOLROOM Tipe 4 Mesin Bigser Fa- foriter Greenhut%5031450/087851115222 976244 MUSIK JL -BL -TT Alat Musik Kybod - Drum - Efek - Gitar Dll Hub:031-60331923 975792 PAKAIAN/SEPATU SALEBatikLasem/Lawas satbatiklasem %087855333338/27F2F521 975732 PEMBERITAHUAN LAPORAN KEHILANGAN.SERTIPIKAT RU MAH Jalan Keputran No.31 Sbya No.271.HGB 975781 HILANGSTNKMotorL-6361-ZAn.Subiyan- toro Yang Menemukan Hub:%031-70973434 975814 HILANG SIM-C a/n Trisnawati,STNK Supra X125 Th12 a/n Napik S-5794-LK Yg Menemu- kan%085856317181/Ke SPBU Demak 152 975923 LIHAT HAL 22 SURABAYA AGEN SEMINARKEBERUNTUNGAN............1X25 . . . . . . . . . . . 975868 BIRO JASA BINTANG PATENT . . . . . . . . . . . . .1X25 . . . . . . . . . .. 975623 ANTAR JEMPUT . . . . . . . . . . . . . . . . .1X25 . .. . . . . . 976107 BANK KSP CITRA ABADI . . . . . . . . . . . . . . . . .1X25 . . . . . . . 971638 KSP CITRA ABADI . . . . . . . . . . . . . . . .1X25 . . . . . . . 971642 GERAI DANA. . . . . . .. . . . . . . . . . . .1X25 . . . . . . . . . 974752 BUTUH DANA JAMINAN BPKB . . . . . . . . . .1X25 . . . . . . . . . . . 975622 DANA PINJAMAN . . . . . . . . . . . . . . . .1X25 . . . . . . . 975632 DANA PINJAMAN . . . . .. . . . . . . . . . .1X25 . . . . . . 975635 BANK MEGA . . . . . . . . . .. ... .. . . 1X25 . . . . .. . ... . 975855 TAGIHAN . . . . . . . . . . . . . . . . . . 1X25 . . . . . . . . 976085 SPESIFIKASI IKLAN RUPA-RUPA WARALABA MAKANAN . . . . . . . . . . . . .1X25 . . . . . . . . . . . 975862 DEPO AIS TRANS PERKASA . . . . . . .. . . .1X25 .. . . . . . . .. 976105 HOTEL/PENGINAPAN HOTEL MURAH TENGAH KOTA . . . . . . . . . . . . 1X25 975873 MALANG AGEN PERJALANAN TIKETNONOTONSEPAKBOLA........ ...1X25 . . . . . . . . . . 975627 SURABAYA PUSAT KANTOR DIKONTRAKKAN DSEWAKN R.KANTOR Andhika Plz Lt1, Simpang Dukuh 38-40.Ada SmokingRoom %5314017-19 976005 SURABAYA TIMUR APARTEMEN DSEWAKN Gunawangsa 2 BR Nego Dekat KampusSTIESIA%031.70700731/08123140364 975994 KOST KOST Pria Baik2 Jl.RayaManyarRejo28Ka- mar Mandi Dalam H%34533678/5946572 976281 RUMAH DIJUAL J.RMH SidotopoWetanMulia GgI/26 Uk5x20 2tkt5KT2KM F.Lkp950jtNg Grsi72005693 976062 JL Rmh kalijudan 10/68 SHM Uk.6x16 2Kt Dpr PDAM Pln1300 380Jt %031-72455475 976300 DJLRMH690M2 NgantongSHM3MNegoPacar Kembang H:031-78644420/085730640196 976197 RUMAH DIKONTRAKKAN RMHBARU100/122,5PLN4Kt2Km25Jt/th. Wonorejo Permai Sel I/10%085852866300 975727 RUKO DIJUAL DIJUAL RUKO JL KEDUNG COWEK NO.9 SHM Hub.MARTONO%0811341970/031-3815077TP 976137 SURABAYA SELATAN RUMAH DIJUAL RMHSHM6X17Lt105FulBgnPam,TlpRaya. Taman Tengah 2/23 375jtng%81737545 975739 PERUM TULANGAN Sda UM 12jt Angs 800 rb-anFreeBPHTRHub:31042242/88154513 975796 J.RMH GADING FAJAR I B5-38 Ful Bgn 2Lt Lt84m2 3Kt 2Km 450JtNg %082139965000 975710 J.RMH GADING KIRANA F-09 Lt112m2 3Kt +1Kp SHM 550JtNego Hub:081234546478 975708 JUALRMH5,5x9m85jtkamar2fullkeramik SHM Sambibulu rt2 rw1%031-77342898 976179 Dijual Rmh 2Lt,8Kt,4Km,2 Garasi,Lt/Lb 200/260,1,875 M Nego%081330719343 Sby 976283 GREEN PARK RESIDENCE hanya 2 mnt dr ry Gedangan One Gate System,T41&49 Hrg Mulai 250jt-an UM 6x PLN,PDAM,Kusen Almini,Galvalum%77507250,88288669 976214 TANAH DIJUAL J.TNH 5,5x12=35jt 7,5x22=75jtNg SHM Ds. WonokasihanSDA 77557436-085331239041 976131 TANAH KAVLING GEDANGAN UM Ringan Angs Tanpa Bunga%88151528-71584144- 72733276 976133 TNHKAVLINGB.S.ASHM4Type,UmBsDi- angsur. Hub: 03181376871/085730116151 976332 TNHKAVLINGB.S.ASHM4Type,UmBsDi- angsur. Hub: 03181376871/085730116151 976292 RUKO DIKONTRAKKAN DISEWAKANRUKO2LtPuriSuryaJayaGeda ngan-Sda Smpg New Era %085230821878 976353 SURABAYA BARAT APARTEMEN WATERPLACE Tower B, full furnish, good interior hub: 08155221989 976351 RUMAH DIKONTRAKKAN DikontRMHkandanganGngdharma2/5(dkt PrmangkLaut)%34042910/081331705130 976042 TANAH DIJUAL MRHTNH±7,8x16=124m2 (SPJB)-SHM6,7jt/ m2 ROYAL Residence B9-27%082333664767 976195 SURABAYA UTARA GUDANG DISEWAKAN GUDANG di.Kalianak 55 Uk.700M2 Siap Pakai Hub:%031-70581598 975780 MALANG KOST KOSTPUTRA/iSblhPOLTEKSmanggiBrt16A &Sigura2PoharinD168B1%081233575828 975556 KOST KARYWN/Mhsiswa Bru 300/Bln Lng- kp +Wifi Drh Skarno Hatta %085815568332 975617 WWW.GRIYAMENTARI.COM KOS FasHtl Air PnsTvAc Mswi Grup03417678666/0341 7840999 975764 RUMAH DIJUAL RMH BRU Siap Huni Prospek Bgs S.tegis Pln Pdam Shm Kota Mlg %08113604926 975227 J.RMHT.40/73PerumGreenViewTasikmadu Renv Hrg Nego%081334415665/7355345 975241 PANDANWANGI ROYAL Park A.40* Be- lakang Ruko Persis,Ls.143m, SHM, Genteng Keramik Glasur, Plafon Tinggi 3,8m, Kitchen Set, Dapur ada 2 Ruang, Bersih & Kotor, Full Wallpaper, Listrik 2200, PDAM (Pagar Depan + Kanopi Mobil + Taman Depan+1 Unit AC=35juta), Hadap Utara, bisa KPR Bank.575jt % 0878.595.11.888 975245 JUAL RMH 2Lt Lt134 Lb200 9Kt 3Km Shm Ldsari Mlg 800jt Nego Hub:087859769450 975254 PERUM ALAM SUBURSyrtMudah Hrg- MURAH BnsPagarKliling.Kluweh BmAyu %03412850531 975563 JUAL RMH di Sukun Mlg Lb/Lt5x6m Hgb Hub:0341498339/082131046829 975606 RMJl.Monginsidi8Lt500Lb3005KtPv2Km Ccku/Kos%081944823433/087859755848 975613 J.CPT RMH Shm Lb150 Lt300 Lok.Bullawng Dkt Pg Krebet 225jtNego%085646774838 975621 J.RMH Tingkat,Jodipan Gg I,L900wt,Sanyo Tlp.0341-8602 150 / 0812 167 07 579 975672 RUMAHLT.3030 LB.700SHM Jl.Raya Terusan Sulfat%9153155 975657 LT3200m2 LB2800m2 (ADAGUDANG)2000m2 SHMJl.RayaMadyopuro%9153133TDKSMS 975654 RMHLB315BukitHijauC431,2M&RmhLb170 BarengRayaII/450 500jt%081232778958 975849 BULAN PROMO Rumah Baru Tipe 40 Tidar Kota Dekat Kampus Dan Mall Di Malang %0341-7676456/081333810022 975876 DIJUAL CPT Puri Cempaka Putih Blok AR No.36 LT/LB 115 S.Pakai %081333463000 975960 BOROBUDUR INDAH B/5-D SHM 3Kt,2Km Tingkat %081938807880/03170901325 975974 GRIYAMOJOWANGIBATU,200JtanDis.Khusus BlnPuasa%081937943008/085755188719 975993 OMABATUResidenHnianPrstsiusTnghKta Ssa12Unt%085258328617/082142604334 976004 J.RMH T47/81 RENOV 2KT,1KM Jl.Teluk Pacitan Pondok Intan Estate SHM%7670285 976012 ** SENGKALING RESIDENCE ** T.36/72 TUNAI T.47/97 180Jt KPR% 081.233.649.255 976014 RMH+TNH SHM PUSKOPAD B12 Ardimulyo- SGS2LtLT279,500Jt%8462995/082142176551 976016 RUMAH MURAH Dekat Kantor Perijinan BANGUNAN BAGUS %0341-3149 000 976040 JUAL MURAH RMH BARU T36/75 Jl.Ketela Bumiayu 30m dr Jl Ry BisaKPR%77 8888 9 976024 SONGSONG REGENCY Blkg Perum Bumi Ardimulya 45/78 SHM 145jt KPR%7588777/ 9733449 976094 NIRWANA PANDANWANGI Lok Tgh Kota (KwsnSulfat)T.36/40/50Hrg215Jt%9606096 976183 RMH DIJUAL 2Lt Dkt Jln Raya Dpn Kampus Itn Mlg L.Tnh:L6/P11%8293415/5493793 976162 KARANGPLOSO VIEWUM6Jtan(BsBAPER- TARUM ASABRI JAMSOSTEK)AngsKPR 500 RbnFLAT%0341-7363685/08563566880/0 81359100671 976262 DJL RMH Perum Griya Permata Asri Blok X6 Pakis%082.331.856.545/0341-8474227 976233 RUMAH DIKONTRAKKAN JL.GAMALAMA 28 Tidar Rumah Baru 3KT Dapur Luas 21 Juta Min.2Th%082337700657 976173 TANAH DIJUAL JUAL TANAH 100m2 Mulyorejo/Kodya. Harga 40Jt %081 2522 3836 975243 DJL TNH Simp.D.Yamur Swj Lt182(10x18) 100m dr Kernci Brpondasi%081334773455 975252 TNH+GUDANG Oli Jl.Raya Utama Kepanjen Ls.1633 m SHM Lbr Dpn 30m%08113644227 975545 TNH SHM 220m2 dkt Bandara Rgncy 550rb/ m Hub: 081 233 52 52 42 975667 J TNH KAV Dkt JlnRyKaranglo UM10Jt Angs. 750Rbx36bl%085791112039/08113030559 975683 TNH LS3100 Dkt Prm.Bru di Bunton Sidora- hayu 150rb/m Cck Inves %081334587687 975851 KAV SIAP BANGUN Di Sukun Bisa KPR HUb%(0341) 8385678 / 085646732186 976028 TANAH Jl.LAHOR SHM LT.282m Strategis Tengah Kota 500JtNego %0341-700 5859 976239 RUKO DIJUAL J.RUKO 2Lt 4x15 Jl.Tumapel Singosari Eks. Rmh Mkn + Perabotan %081333553345 975247 RUKAN CANDI TLAGAWANGI 2Lt+ Ground LT.4,5x22LB.4,5x13%9796509/082338046699 975386 J RUKO Jl.Krebet Bululawang 260Jt&Ruko Jl.Arif Hakim Ng %081230910090 975611 DJL CPT Ruko 4x22 SHM Bs KPR Jln.Kedoyo/ Ters Wisnuwardana-Swjjr %772 40 00 976118 RUKO DIKONTRAKKAN DIKONTRAKKAN RUKO Jl.JA.Suprapto Gg.1 No.2 2KT 30Jt 2Th Nego %359743/368746 976091 TOKO DIJUAL DJL TOKO LOSSLuasCckU/Showroom9x10 Di Pusat Kota Kepanjen %081233992994 975380 STAND DIJUAL RAYWHITEDIENG%557878FREDY%08883 456063MatosLS6No3&5StrategisDpnPujasera 976036 TEMPAT USAHA LAIN BELIATAUDICARIAPOTIKKondisiApapun Termasuk Obat/Peralatan%085933036888 976047 SIDOARJO RUMAH DIJUAL DJL RMH Lt.167m 2Kt Grs Tmn Pinang Indah Blok G-6/1 SDA %031-71679030 975915 GRAHACEMANDITahap3,DP:6jtPLN:1300w PDAMHub:70804553/082230528276 975926 JCPTRMHBksQ29PanjunanSukodonoT54 LT204M2.Hub:03171858493-0818574173 976194 JUAL RUMAH Buagus Citra Padova Sidoarjo Kota Aman Nyaman,bisa KPR %72599707 976216 TANAH DIJUAL Citra Padova tanah 400m & 1000m djl hrg dibwh pasaran 081335775308/71175643 975778 JL.TANAH18x14m2 BringinKulonRT2/RW3 TamanSda%081332909073/081331857491 976241 MOJOKERTO PURI ASRI Um 3+4jt Angs 18rb/hr, 2kmr, Bersubsidi %0321390963-6280179 975547 JUAL TANAH 2Ha di Mojokerto 55Rb/m2 Hub:%08121764537 975951 TNH INDUSTRI Ds Perning Kec Jetis Mjrto Dr Jln Ry Msk 200m Stlh Wringin Anom Grsk Luas4050m2 (P142xL28.5)BrdiriGdgTrbuka 1425m(P50xL28,5)2,2MlyrNego(SHM)Ada Rcn Toll %085204719577 975957 BLITAR JUALCEPATTanahKavling(6x12m)Kanigoro Blitar @Rp.25jt Tlp.0812 6212 4998 973543 LAWANG RMH TYPE50/112 Perum Otsuka Lawang Bgnn Baru 175jt %081334955944 976212 SURABAYA SELATAN RUMAH DIJUAL T30-70 PERUM MPI . . . . . . . . . . . . . .1X40 . . . ..... ... 975618 SURABAYA BARAT RUMAH DIJUAL SETYO . . . . . . . .. . . . .. . . . . . . . 1X25 . . . ....... 975872 SURABAYA BARAT RUMAH DIJUAL HARGA PROMO PRMHN THE QUEEN . . . . . .. . ..1X40... ...... 976112 MALANG RUPA-RUPA OMA INDAH MENGANTI . . . . . . . . . .. . . . 1X40 .... ... ... 975841 T30-70 Perum MPI Menganti,CNR wonoayu, PMR bs diatur & bs diangsur 085790763772, 031-28810541, 70130618, 70634724 KAWASAN MANDIRI GOLDEN BERRY RE- GENCY Menganti,Fas:Kolam Koi,Telaga Angsa, Taman Bermain,Air bersih,PLN.Hub: 085731127448 / 70069899 / 5616141 HARGA PROMO Perum The Quen Res T.36 UM 9Jtan Angs.470Rb Flat,Stok Trbts H: 71538744, 34659268, 71612920, 70370595 OMA INDAH MENGANTI, Launching T.24 Kreatif, Angs Murah Bersubsidi, Jringn List&PDAM Hub: 031-5669555 , 77675659, 70894008, 34194942, 71378802
  • 24. SURABAYA MARKETING-SALES MRKTING p/w 20 org,Gp 1,2jt(TnpTarget)+t ransp+bns bsr Dtg+cv=kedungCowek 12 975491 RAGAM LOWONGAN KRJ ENAK LIPATKRTAS TEH,1Ktk/200Lb 70rb,dtgke HDN CabSby,Mlg,Kdiri&MADIUN diRUKO PGM SerayuTmr 1A/16-17Taman- Madiun.Hub:MUTIARA%085731379960 971597 BTH TNG PRODUKSI PABRIK 570.Secu- rity 580.Area SDA,Sby,Grsk Min.SMP Bu Sri: 087702782744 Bungurasih Blok E/21 SDA 971527 SALES, Pglmn Min2Thn, Sim+Motor, Bid KayuBangunan.Wiyung403%081217303382 971516 BUTUHPENGEMUDI,SIMA/B.JL.Darmokali 2-6 Sby. %085649734734/ 087754141144 972338 DICARI SOPIR TRAILER SIM B2 UMUM Pen- galaman Lamaran Jl.Kalianak 51-Y 972966 **KRYWNTOKO-GAJIMENARIK** Wnt,SMA,Single Max24th,Penam Menarik Toko Aksesoris Petra Jl.Kapasan 153 Sby 972745 DBTHKN PRT&Bby Sitter u/Dlm&L.Pulau. Bngurasih%087702866703/082140274223 972592 Cari Sopir Utk Rental Mobil Datang Lang- sung Dukuh Kupang XIV/28-30 Surabaya 972789 DCR Kryti u/ Stan Mknan Rgn diRoyal,Sutos ,JMP%8477518-8271612 Royal G-A1/45 973619 KRYWTIU/DepotJjrAmh,TJwbBrjlbb,Mx25Th Mkn+TdrDlm%081703049500KebraonM20 973962 DCRTNGKRJCuciMobil.DtgLsgke:MAXIMA Jl.Ry Kupang Jaya 110%031-31323288 973857 DCR STAFF Admin&Telemrktg CV Lgs in- tervwUpDebie,Baratajy16%081233779779 974041 BTHPRTWNTTDRDLMGj.1,5Jt H:Iwan%081333331978 Wiyung 5 974084 ## ITALIAN CAFE/RESTO GM-GC-DELTA ## BTH:Waiterss-Cook Helper-BAR-Waiter, Penampilan Mnarik Jujur Disiplin max22Th. krm BENETO Plaza Sby(Delta Plaza)Lt4 974614 CARI SOPIR Truck Trailer Utk Dalam Kota & Pelabuhan Hub:Perak Timur 402 Sby 975101 ButuhByk”pengupasplstik&krtasDiRmh” Hasil 350rb/100kg bhn kerja Grtis&Layan Antar Ambil Grtis 7674988/085257169969 Bukit Bambe AN16 Gsk 975210 Gratis Bth Tng Sawit klmntn.fslts paling kmplit.jl.imogiri226. %08980893455 974894 “Krj DiRmh Kupas2/Pilah2 Plstik&Krtas”Hsil Jutaan/ Bln%7674988/085257169969 PerumBukit Bambe AN-16 Driyorejo-GSK 975422 Dcr Byk”Pemisah Plastik&Kertas Di Rmh ”Hsl Jutaan/Bln%7674988/ 0852 57169969 Bukit Bambe AN16 Gsk 975525 CR SOPIR PGLMN BsMatic U/RmhTangga SIM B1 Ke:Darmahusada IndahBarat 3/A-205 975807 ANDA Amd management/akutansi Pglmn PERBANKAN menguasai Ms office, berkepribadian baik,komunikatif,GampangB ergaul, dpt memimpin,kend.sendiri,Lsng bw Lam:Jl Taman Apsari 11 sby(Joko Dolog) 975800 BUTUH SOPIR SIM B1 Usia max.35th Lam Lsg:Permata Alam permai AA1/2 GDGN SDA 975757 DIBUTUHKAN Marketing,Min.SMA, La- maran Langsung Ke: THR Mall Lt.1C 39 Sby 975783 HELPER/KERNET Srbtn Pglmn SMA Sdrjt Gaji&Jamsostek, Rambutan Tengah 2/E586 PCI %085755920543 Tidak Trm SMS 975771 Sopir B1 Pglmn,SLTP Gj 2,2jt,Jamsostek. Rambutan Tengah 2/E586 PCI max40th %085755920543 Tidak Terima SMS 975769 DCR PRIA U/TOKO Sparepart Spd Mtr Hub: Raya Wadungasri 98 Pondok Candra Waru 975763 Butuh Cepat Laki2 Max 30th Bag. Penagi- han, jl. Simo Gunung Barat 2/2 Sby 975692 DCR OPERATOR WARNET Bisa Komputer. Lamke:RyBaratajayaNo.9.%03170166088 975712 Cari Sopir + Serabutan(P) & Admin(W). Lam ke: Raya Wiguna Timur 59 Rungkut. 975726 TNGKRJWNTsebnyk2nyau/bag.Packaging max33th.087775077751 RukoSegi8 C-829 975729 Wnt Pglm U/Krj diButik,Rjn,Jjr,Sopan,25- 30,MinSMA H:Bu Lina;Kutei67%5676689 975762 DCR SALESMAN L/D Kota Pglm Alat2 Spd Mtr+Kasir+Srabutan Krm CV Jl.Tidar 204 975775 SOPIRB1,Accounting,Kasir,Admin,KurirSim C;Plaza Segi8 Blok C-862 Dpn SCTV 975784 DCR SOPIR,KERNET,Karyawan Gudang Lam:Karang Asem 12A No.7 975779 DBUTUHKANPRTu/L.PulauGaji1,5jt.Bun- gurasih%0878 5179 1897/0821 4027 4223 975699 SECURITY P/W SMP/SMA Max35th Gaji UMKLgsngKrjWilSby&SktrnyLam:Jl.Ngagel Tirto 4/15 Sby 92308349/085730060266 975799 DRIVERPRIBADISMAMax45ThPglmnMbl Matic Lmr Ke Jl.kalimas Barat No.1 Sby 975758 Dcr Guru Kls,Mandarin,Musik,S1/Sertifika- siSD, Itv Tgl 10-12 Juli pk 15.00-16.00,Ben- dul Merisi Besr Tmr95A%71011082/ 72773262(Kndraan Sndri) 975639 DIBTHKAN SGR!!Llsan Th’2010-2013 Min. SMA/K U/Pss:ADM,Recept,Gdg,OB,Dll.Lam Lgs Ke:PT.CAJ Jl.Margorejo Indah Ruko Je- mursari Raya Blok C-20 Smpng Polsek Wono- colo%81265495 BonusTHR(MessGratis) 975714 DCR TNG Angkat Barang Max30Th Lam:Mu- tiara Margomulyo Indah DC18 Sby%7492310 975728 DCR TUKANG DEMPUL Halusan Hub:Jl.Upa Jiwa III/35 %031-70102506 (Tdk SMS) 975816 CRTngSERABUTANU/Laundry.Wnt.Min- SMP. %031-77716210/085645412314. Pndk Maritim Indah Clst Bugenvil Y29/8 Sby 975738 CR KURIR, Rajin,Punya Motor&SIM C, Gj+Kms, Lam:Klampis Semolo Timur 1 AB 86 975736 DICARI KURIR Wilayah Surabaya. Kirim Ke Jl.Rempelas No.8 Surabaya 975730 Dcr CREW COUNTER Minuman Tebu 28Th info:08175078888 TP-3 Lt.5 (Dpn Stinger) 975663 CARI SALES SEMEN/Pegawai Wanita Rajin Jujur Hub: Jl.Lebaksari 38 %8181 8386 975740 Srbtan Depot,Wnt,Tdr Dlm,Rajin,Jujur.Smo- loElok B8. %91280280 - 032131602280 975742 Koki&Pelayan.Depot ayam bkr.GjTgi& ter- jamin.Sms nama ke:085646098966 Jemur6 975721 BTH SGR Cleaning Service, Bw Lmrn Lsg Simpang Darmo Permai Selatan 1/41 Sby 975688 Lowongan SPG Pasta GIGI U/di Mall Lu- lus SMA/K,Max 28Th Pengalaman Tdk Diutamakan Penampilan Menarik PT TAC Jl Rungkut Industri I/19 031-288851555 / 081330314071 975706 DCR SOPIR/KERNET Utk Knvs Air Mneral Min.SMP SIM A/B1 Lmr Dupak Rukun 108 975881 DCR ADM Stock Utk Margomulyo+Tk Kaca Lmr Dtg Ruko Mutiara Dupak 65 Blok C-5 975891 DCR Tukang Las Berpglmn+Tukang Bubut Pglm Lam:%7430139 Jl.Buntaran A8-9 Sby 975893 DCR: KRYWN/KRYWTI u/Fc Galaxy Mall&Ciputra World.Krm Jl.Margorejo Indah A-522 Sby %081554238999 975896 CRTELEMRKTNGGP+Kms+Jamsostek%8140 6575/085258958899P.SutiyanUpajiwa17C 975904 BTH:20Sls Promosi,4SPV Sales,5Surveyor. Krm Ruko Tmn Pondok Indah A22 Wiyung 975908 CR DRIVER P/W Gaji S/d 3jt.Fas:Tnjgn BBM, Mess,Dokter,Bonus,Dll Dtg Bw Lamaran+Tes Jl.PLATUK DONOMULYO 15/2 SURABAYA Telp:031-91440679/0821 3113 2233 975890 DCRKRYWTIu/STAFACCOUNTING,bskomp, SMK,wilKr.Pilang.GriyaKebraonSelFA-31 975889 SALON:DICARI Beberapa Capster Wanita Berpengalaman Delta Ry4 Waru %855 6688 975899 DCR SGR Bagian Penagihan”KSP”Krm Lam Ke Jl.Jeruk 2 No.11B Geluran Taman Sda 975921 CLEANING SERVIS P/W Hub:Jl.Gembili I/51 Sby %081938887878-77388878 975924 BTH CPT Staf Admin P/W Max38Th Lmr An- tar PSJ G9-3 Gedangan Sda%085230821878 975927 DCR KARYAWAN Jaga Malam u/ Rumah Kost.Lmrn Datang Lsg:Jl.Baratajaya 48 Sby 975945 SERABUTANPria&ACCOUNTINGWntu/Kon veksiHub:VSMEJl.Demak171H%08995950134 975937 DCR KARYAWATI Utk Stand Makanan Drh Waru&DukuhKupangGj+UM+Bns%71910768 975942 DCRADMIN/MARKETING(P/W)Max.27Th Sim.C Lam: Klampis Jaya 27F Sby 975944 DCR APOTEKER, AA u/ Daerah Buduran. Lam:Rungkut Asri Barat 10 No.8 Sby 975948 CR GURU Pendamping u/ Anak Autis, Pglm. Krm Jl.San Diego M10/70 Pkuwon City 975982 DCR SALES Utk Js Kurir, Mtr Sendiri, Koala Regency B23 Sby %92094832 975986 CRSOPIRB1&SerabutanPria Lam Lsg:Jl.Bongkaran No.55 Sby 975987 URGENTWORKToSingapureOperatorMsn, Teknisi,Sopir Pny Paspor%081232636788 975998 DCR SOPIR B1 Max35Th,Tng Serabutan Lls SMP/SMA Max25Th Hub:Undaan Wetan 28C 976000 DCR PENJAHIT & Tukang Sablon Sebanyak Mungkin,Jl.Ploso Baru 57-A%70907017 975955 TOKO TAS Import ITC/PGS Dicari Krywati (Pglmn Kerja)%70367789 Tdk Terima SMS 975964 DCR Sgr Stylish U/Salon DrhPlosoBaru Su- torejoTgh 5/11%081914497695/72646585 976071 Waiters Cewek+Tkg CuciPiring Cowok,18- 27 krm:ShichidonResto galaxy mal lt 2 976046 DCRCPTTukangMeubelMultiplekPglm,Gu- nung Anyar Tambak 134 %70984123 976013 CR Teknisi AC & Helper gaji 2jt Rungkut Menanggal Hrpn P/19 %085731169516 976053 Cr Karyawan pembantu mekanik u/beng- kel mobil,Rungkut Asri Utr 13/5%71458890 976057 SUPERVISOR, 3D Designer+autocad, free- lanceMktngKlmpInd2/D19%085920701302 976064 DICARI BEBERAPA Tukang Jahit Sofa Halu- san Hub: SDPS XIV/38 %031-70182917 976368 DCR SOPIR Berpengalaman Hub:0857 31652362 wiguna selatan 13/48 sby 976130 DCRKAPSTERWNTBisaSPA,Gj+Transport 1jt+Kms,Salon Hogi,Jl.DeltaRaya 3 No.4 Del- tasari Waru%08123614861/31225637 976150 DCR 1 SOPIR Utk Toko Pengalaman Umur Max30Th. Lamrn Dtg Lsg:Kertajaya No.75 976317 DCR WNT Bag ADM Gdg(SMK) Lk2 Bag Se- rabutan Lam Ke:Kedungdoro 20 Korea Motor 976306 DCRKARYAWATISMAMax23ThBsKomput- erLamLsgKe:UDTOPJl.Bunguran27Sby 976296 CrCUSTSERVICEWnt,Max24Th,SMU/SMK, Deltasari Indah AG11, %081703740900 976261 BTH CPT OB(SMP/Max30th),ADMIN(SMA/ Max25th) Pria/Wanita Jl.Simokalangan 218K 976126 SECURITY,SMU 20-33Th,Pria Min.168/60. Wnt min.156/46,Lmr:JAGARAGA Jl.Opak 33 Sby Dtg Lgs:Senin-Jumat 08.00-10.00 976136 BTH SPG/KASIR u/Butik MinSMA BsComp, Srbtn MinSMP Lam.Jl.Tmn Bintoro 3-5 Sby 976139 LOWPROGRAMERSyarat:PHPJQUERYAJAX JSON B.Ktm167 976149 DCR ARSITEK,Qc,QS,Pelaksana Min.D3/S1 Lgs krm:Jl.Kinibalu 57-59 Kav.O Sby 976159 DCR Apoteker PunyaSIK,Pglmn tdk Utama, Bsfreelance:TamanAloha H8/19 Wage SDA 976122 CR TNGSRABUTAN SD/SMPmax25thSeri- usKerja Catering:PanjangJiwo Permai 3/40 976171 LGS KERJA Wnt/Pria ADMIN Srabutan Mar- keting%70364899 SiwlnKrtoPermai V/J-33 976172 DCR Adm Wnta SMK/SMA Sdrjt Krm Lam k Krtjaya Indah Tmr P.335 H.087853697020 976198 Dcr Krywti Srbtn,bs Lmbur slma puasa. Jl.karang asem 14 No.72.H:081335007420 976203 PENJAHIT PRIA untuk Plastik/Terpal yg Rapi.%03160471390 Sidosermo PDK I/295 976236 CRTKGCTKMsnToko820.DatangLangsung: PetemonSidomulyo 4A/36A%03170006888 976251 DICARISOPIRPengalamanLuarKota.krm Lamaran: Jln.Teratai 39 (Tambaksari). 976199 DCRADMWNTbisaInternet,SMA.max.30Th Ke VILA TAMAN GAPURA F1/18 Citraland 976297 DCR SOPIR Trailer SimB2 Lam: Jl.Mayjen Sungkono 14/1 Gresik %70315558. 976181 KRYWAN BAG.PENGIRIMAN kndrn sndiri gaji1jt.dtg lsg:raya mulyosari 42B/PDD39 976288 CR SOPIR YG BERPENGALAMAN hub :08123047978 klmps smolo tmr 16 976330 LIPAT KERTASTEH.Shari dpt 5box upah 350rb(50box=3,5jt)+uangBlnan.Bu2tn22G. sms.ROSA%081934165416 976347 Kurir & Penjaga Otlet Max30th Pend Min- SMP Lsg Intvw 031-77377338 Gogor20Wyg 976221 CARI Tkg Cuci Mobil. Tkg Poles Pglmn. Raya Jemursari 1A. Tlp.0816 2000 99 976276 CL Prod,Krj Scptnya SPG/B,Mkt,Sales. WalkIntv:Bhaskara Selatan D-22 Up.Novi 976272 CrTngTrapis/GrAutisWnt.SMA/S1Manyar Tirtoasri 12/11 %5939437/081330150125 976301 MEKANIK UNTUK AHASS SBY Pen- galamn Ry.Bangkingan99%031-81888439- 081230641555 976308 CR SECURITYSMP/SMA,Mx35thLsgKrjWilSBY/ PndaanRukoRktMegahRaya N26 %8714757 976157 KURIR:WilSda,Mjk,adabensin,BonusLamr ke Perm Makarya Binangun XE/14,Waru 976161 DCR Tk.Las Utk SS Srbt Jl.Simogunung Baru 18 %77492600 / 081234135909 976346 DCRSOPIRSIMB1 Lmr: Babatan Pantai Barat 1/71 976339 DCR STAFF MinSMA Gj UMK Plus,5 Hr Krj. Walk in Ke Hotel Bumi Sby Prm-15 BasRah 106-128 Up:Haris 976230 DCR WNT MinSMP Utk Jaga Counter Kue/ Roti Lam Villa Kalijudan Ind VIII/F-18 976334 DIBTHKAN HOUSEKEEPING Gaji Total 1,5Jt+Bns Diutmkn Wnt Umur 17-30Th Krm Lam Nginden Intan Barat C1/63 %60308888 976338 PERUSH EXPEDISI Butuh Sopir B1-Umum Jl.Tambak Sawah Industri 5A%031-8672161 976271 DCR SOPIR Sim.B1 Jujur,Disiplin.LamLgs:Ry Kalirungkut No.15(Dpn Khong Huan) 976224 DIBTHKAN:1TERAPISLaki2&WntMax.35Th BerpglmnH:RayaManyar53%08967143337 976187 DCR OPERATOR Mesin Plong Kertas Ber- pengalaman Lam:Lebak Indah Utr No.58 Sby 976200 DICARI SOPIR Sim A Bisa Metic Daerah Gal- axy (A Raya) Hub:085230418141 976277 DICARI PENJAHIT Wanita Lulusan SMK daerah kutisari%70077731/ 976232 TNG FINISHING DUCO Halusan U/Mebel Harian/Borongan Lam Krm:Lebak Timur 2/4 976255 SALES B.BANGUNAN Pglmn minSMA,max 30thKrmPergud.MeikoAbadi1/C-50GdgnSda 976235 Sopir Pglmn 5th Tahu Jatim U/ Rmh Tang- gaMax.35 %8411836-70701733 Kensa A-15 976333 WNT MinSMA Menguasai Ms.Office Kend Sdr Rmh Sktr Lam:Klampis Anom VI/6 F101 976270 BABY SITTER PRT & SUSTER TANPA POTONGAN GAJI IBU WATI. Jl ketintangBaru 16 no 21 Sby. T;70044405-081331100355-085730098057 973197 SIDOARJO RAGAM LOWONGAN DCR TUKANG LAS Pglmn Canopy+Pagar DiutDrhKrian%71508858-081331726400 krian1 975746 BTH COLEKTOR &Marketing Utk Perusahaan Direcseling Puri Indah Blok Z-25 SDA 975753 MALANG RAGAM LOWONGAN DBTHKNWNTMuslimahPemijatPglm%0813 34603999NonSmsJl.Sigura2RkMega5 974011 DICARI SUPERVISOR Min S1/D3 Wanita & Pramuniaga Min Sma/k P/w Kirim Cv ke Pasaroti Jl.Tumenggung Suryo 108 Mlg 975226 BTH TNG Kerja Sgr Adm-Hrd-Spv-Bm Pddk Smu/ k/D1/ D2/D3/S1/Pensn Krm Lmrn ke :PT. MugJl.S.P.SudarmoNo45B%Hari08123577778 975229 Dcr KASIR Wanita,Tekun,Ulet,Jujur&Tuka ng Jilid Rapi Bisa Jilid Hardcover&Softcover Hub:326364,Jl.BS.Riadi 68 Mlg 975240 PURI NIRWANA Cr Marktg Property,Tehnik Sipil,SlsCounter,S1Akunting,AdaGajiPokok+ Bonus.KrmLmrnke:POBOX2525ML65101 975257 *SANGATMENDESAK* PT Artha Graha Sukma membutuhkan Kary- awan/Karyawati Pendidikan:Min SMA/SMK/ Diploma Dan S1 Untuk Staf Kantor cabang Max 35Th Bawa Segera surat Lamaran Anda Ke JL.J.A.Suprapto No.68D Malang 10.30- 14.30 Terbatas 975528 **TKWSERBAPASTI** BthPASTI200TKW(Twn,Hkg,Spore,Mly)PAS TIBerangkatCptResmi,PASTI dptUangSaku,P ASTIbsTUNGGU RUMAH.Pondok Intan Estate Arjosari/GadangRegency%0811363481 975557 DCR ADMIN Wnt Min Sma Jjr Majesty Florist,Lembah Dieng A2/10 %08123310626 975607 CR PEGAWAI Keliling SariRoti Wil.Batu Mtr Sdr Sulfat Agung 3/33%08179654241 975644 CR DRIVER Paham Jln Mlg-Sby Lam Krm: Jl.Kalimantan36 Tirtajaya Travel%366148 975642 Bth Cpt Tkng Giling Borongan Produksi &Srbtan,Jl.Tenaga Baru 2/6%0341-495439 975662 DcrKrywanLlsanSMKMesin DomisiliSeki- tar Malang Raya.Lam:Jl.Supriadi 25 975655 Dicari SOPIR SIM B1 Umum & Kuli Angkut Pancaragam Anyar,Jl.S.Parman 20 Mlg 975669 KERJA DIRMH NEMPEL TALITEH,1ktk/ 200lbr 70rb+tnj blnan.HDN Ruko WOW A10 Sawojjr.Hub UMMY%085736238052 975793 DCR CPT GURU TK Islam Pglmn Lam Lsg Ke: Taman Raden Intan Kav.705 %087859577727 975693 CR KRYAWATI,Min SMP/A/K,17-23Th Gaji .800Rb-1,5Jt%085736367229Sumbersari82 975691 BTH OPERATOR OUTLETKEBAB TURKI: P/W, Max 25Th,Muslim,Kendaraan Sendiri, UangMkn,Transpot,Gaji.LamaranLang- sung Ke:Bendungan Sigura-gura 38 Mlg %085743402295 975675 DBTHKNWNT.u/Kafe&RestoDimalay/Sga- pre GJ.25jt. pisang101mlg. %087756848180 975645 TAMBHN PGHSILN Bisnis DrRMH Tnp TiggalkanProvesi%08165414679 JaksaSu- prapto1 975770 DEPOT KUPANG Bth Pramusaji u/ di Mall Mlg Jl.Dr.Cipto Kios 12 %083834764222 975844 BTH GURU TK+Admin Min.SMA Max.25Th Pglmn Tdk Utama Jl.Perak 21 Mlg 975857 DCR KRYWAN/Ti Toko,Jujur,Pekerja Keras Lmrn:Hokky Motor Jl.Raya Bandulan 32 975956 Dcr Cpt Kary Part/FultimeINCOMEsd5jt. Lgsg Kerja.Info: 081334405858 ZArfn53 975976 CRP/WKASIR,WaiterU/Malang,Batu,Kediri Bw Lam.PBI K6/1(Perum Araya,Malng) 976006 DICARI KARYAWAN Cuci/Salon Mobil Hub%0341-2177487 / 0822 6401 0007 SPI 976030 CR SOPIR,KULI BGN,KRYWTI Max35 Min SMP TK.SUMBERLANCAR Jl.S.Hatta 318 %486311 976037 CRP/Wu/DesignInterior+Markting,Ulet,Bkj Krs,Kend.Sdr, Jl.Sumba 16 976092 DBTH SGR Sales Produk Trknl Pria/ Wanita,Min SMA,Mtr Sndiri.Gj Pokok,Komisi Lam:Puncak Buring Indah B4 No.39 Mlng 976116 DCRI KERNET / KULI SERABUTAN Gudang SemenJL.BANDULAN8-b/21Mlg0341560588 976278 DBTHKAN 1 Wanita Marketing Iklan/Ad- ministrasi Bs Ms.Offive,Min SMA,SimC Insen- tif Besar Lam:Arjuno 23 Mlg,Kode GM 976170 DCR TUKANG LAS & Finishing Jl.Karya Timur PKL 1 %5366663 / 081 334 546 867 976254 CARI SOPIR SIM B Lam Ke Jl.Gatot Subroto 7A %081 944 800 599 976257 DCR MAHASISWA Usia 18Th, Wkt Flexibel 4Jam/hr Income.1-8Jt/bl %087777708206 976215 CR IBU RT/Pnsiunan/Krywn U/Part Time 4Jam/hrBkrjdrRmhIncm.2-8Jt%08563568525 976213 KAMIS, 11 JULI 2013 SURABAYA RAGAM LOWONGAN PT HADENA IBU KENDEDES . . . .. . . . . . . . 1X25 . . . . . . . . . . 971640 DICARI SALES . . . . . . . . . . . . 1X25 . . . . . . . . .. . . 975620 LOW GRATIS TKW . . . . . . . . . . . . . . . . .1X25 . . . . . . . . 975646 PERUSAHAAN BAHAN BANGUNAN . . . . .. . .. . . . 1X25 . .... . .. . ... 975866 MANGGA DUA . . . . . . . . . .. .. . . .1X25 . . . . . . . . . .. 975871 SEMERBAK CITRA . . . . . .. . . . . . . . . 1X25 . . . ..... . . . 976086 DIBUTUHKAN SEGERA. . . . . . . . .. . . . .1X25 . . . . . . . .. . 976095 INTERVIEW LGS KERJA . . . . . . . . . . . . . 1X25 . . . . . . . 976100 LOWONGAN DICARI . . . . . . . . . . . . . . .1X25 . . . . . . . . 976101 LOW KERJA BAPAK RAY . . . . . . . . . . . . . .1X25 .. . . .. . . .. 976104 DICARI SGR KOORDINATOR CLEANING SERV . . . . 1X25 .. . . . . . .. 976108 LOW KERJA BUTUH CEPAT . . . . . . . . .. . . . 1X25 . . . . . . . . .. 976110 TUKANG AC . . . . . . . . . . . . . . . . . . . . .1X25 . . . . . . 976113 PERUSAHAAN AMERIKA . . . . . . . . . . . . . . 1X25 . . . . . . 976114 DIBUTUHKAN BBRP SOPIR . . . . . . . . . . . .1X25 . . . . . . . . 976115 BABY SITTER IBU MAYA APRIL . . . . . . . . . . . .. . 1X25 975244 SIDOARJO RAGAM LOWONGAN LOW IBU ANITA . . . . . . . . . . . . . .1X25 . . . . . . . . . . 975641 MALANG RAGAM LOWONGAN PT BUNGA PROPERTY . . . . . . . . . . . . . . .1X25 . . . . . . . . . 975628 LOW MASAKKU. . . . . . . . . . . . . . . . .1x25. . . . . . . . . . . 976106 22 SPESIFIKASI IKLAN UFO Graha Family E8 031-7380114 HLG STNK HONDA No L-2943-FV An Ali Mustofa,Almt Medokan 2/22 Surabaya 976075 Hlg STNK Mtr Honda’03 L-4982-SF an Malig,Karang Pilang Barat 33 Sby 976076 HLG STNK No L-6154-WI An Lukman Hakim,Almt Putat Jaya Lebar A/40 Surabaya 976084 Hilang STNK Yamaha L-4532-NW Th.2011 a/n.Yudiono, Sidotopo Sekolahan 10/20 976119 KEHILANGAN STNK Jupiter ‘2011 Nopol L- 5278-NB a/n.Soetris Harsono. Nomor Yg Bisa Dihubungi %083830870008 976302 Hlg Stnk Motor Nopol L3940NV an MatHa- lis Hub.Kpg Panjaan 4/38d 081938070410 976206 HLG BPKB HONDA KARISMA, an. NUGRAH HARIYANTI Hub: %082143764585 976365 HILANG STNK Legenda’2003 L-2716-MM a/n.Agoes Soerarso Hub:Indra %8710838 976315 HLG STNK T.Corolla’81 L-1664-QE An.Soe karsih; Asem Jajar Gg.V/20 Sby%5311391 976189 Hilang STNK Honda CS1 L-6623-AZ a/ n.Winata A.S Hub:031-71998400 976336 PENJERNIH AIR FRESHCOLDprakitndepoAirMinumIsiUlang Murah &brgrnsi 91548933 /085739537649 971594 H2oSpcROAMDKDepoAirMnm+Tandon12,5Jt 081230103910/72191635/085707060704 975668 JUAL TANDON 5300Lt/2,18Jt Prkt Isi Ulang 7JtAn%70224111 976008 TKS GROUP Peralatan Air Minum Isi Ulang &AMDK Hub:ITC Lt.LG50-51 %71701280 976357 RUPA-RUPA MELAYANIBOR:SUMUR,Stros,Arde,Tandon, BusbetonAGUS%81232107/082131132269 973558 DICARI PERABOT JATI Bekas,Lemari,KRS Roda,Etalase%03170738448/081703955668 973901 JUAL OLI Mesin Bensin 43.000/Ltr Tiap 16.000km,Oli Mesin Diesel 42.000/Ltr Tiap 15.000km.PenetratingOil45.000/480ml,Hrg Surabaya Continue%081259104174 973870 Cara Cpt Bd Daya Smut/Kroto Drmh Tnp Po- honLhn1M2 %085607571386/081232354172 973971 Jual Pakan Lele Apung Dan UdangDicari Agen. 085655107146 /081231072598 973816 JASA PELITUR Milamin,CatDuco u/Pagar,Pi ntu,Harmonica,Sgl Mcm Mebel%70500161 974206 DCR Mebel Bekas, Lemari Jati, Bufet, Meja, Bed Set,Dll Hub:70598304/5462619 975777 Jual Dmr Kopal 5,5ton Kwlts Bagus.Hrg 17.500 %0853 1111 1020; 0819 678 250. 975751 SGR LAUNCHING MLM FENOMENAL 3Bln Cetak Puluhan Org Income >100jt/bln Dcr 100Leader Posisi awal BB 2AFD21DB / 08179333813 / 087853099777 975656 Apkh Anda Mncrigai Suami/Istri Srng Kluar Kota,Pny Psngn Lain,Kmi Bs Mmbntu Utk Mndptkn Data/Infony.081 999915419 Jl.Joyoboyo.27.sby 975894 JUAL PINTU PANEL,Pgr Besi 175rb& Mni- malis300rb,Closet,S.Bed+Dipan%72706898 975949 usaha plastik tanpa mesin, ringan , 1,8jut/ bln,garansi,hub:%087854153499 975978 ISTANA CAKE N BAKERY BlackFor- est Terenak Didunia Hanya 100Rb-an Free Antar N Gratis Banana Cake N Gratis Donuts Cake 6Biji Beli Di www.roripon. com Free Chating,Exim,Buy-Sell,Voucher Deals,Voucher Deals Welcome All Bisnis 976153 MEDICALCHECKUP185rb=30mcmBy1Get1 Free Akurasi Alt 90%%70224111/8410290 976265 Promo Permen Chupa Chups Beli Min .10dos(225rb/dosisi50x20)%031-77632789 976279 Stiker Anti Radiasi HP/LAPTOP/DLL (20rb/pcs beli min.10pcs) 081333247989 . 976282 AGEN PERJALANAN DISEWAKANTOYOTAHIACE‘2013,AVANZA ‘2013Hub:%031-3892288/081231180888 976227 MTravel Sby -Malang -Wajak -Kepanjen - Dampit Hub:031-70043627, 081938140579 976294 SIDOARJO SEDOT WC PT.LANCARSIDOARJOSEDOTWC Tinja Hub:031-8921874 /8964978 975586 MALANG AC/KULKAS BERKAH JAYA Srvice&JlBeli ACMbl/Rmh, KlkasM.CuciDRYER%0341-5334555/5430345 976243 RUPA-RUPA ELEKTRONIK JUAL BELI/TkrTambah TV,Kulkas,Msn Cuci Dll.Beli TV Rsk%8104567/081233774567 975980 ARSITEK ARCHITECTURE DESIGN&BUILD RMH Ruko Cafe Resto Hotel,Vila,Kantor,Pabrik&In trior Furniture%0341-405091 976039 BANK TERIMAGESTUNKK Hub: Galunggung 56 Mlg %7740161 975522 BPKB LSG CAIR,Sertifikat, KSU DANA PRA TAMA A.Yani 161 Blimbing%0341-409 111 975686 PRS CPT Jaminan Bpkb&Shm Bs TakeOver %03417641032 Jl.Raya Tlogomas 14 Mlg 976268 MAKANAN-MINUMAN TRIMA PESAN/Antar Air Mnm Isi Ulang u/ Kywn Pbrik Grts Pnjm Galon Br%9999195 975624 J.KUE BANGKET Lebaran isi 6Top MURAH Bs Utk JualLg H:LA.Sucipto 194%2119687 976010 JUALKUEKERINGSPESIALRoombutterEnak 40-50Rb/Toples%9490383/082230904922 976218 MESIN/ALAT BERAT PERSEWAANSTAMPERMurahHub:0341- 7067768/5388889/0811361509 976019 PEMBERITAHUAN HILANG STNK VEGA 2005 N-5139-AG An. P.Sutrisno Cengger Ayam %085 736 558 159 976052 HLG STNK Daihatsu Grand Max N-388-UA an.WisnuWicaksonoSE,BukuKIRAsli,Trayek Asli,SIUP Asli%085335448899 976182 HLG BPKB Mtr Yamaha’09 N4637BL F5875552J An Ayu L,Jl Kripton 11 Blimbing 976188 RUPA-RUPA EXTRA INCOME Parttime 2-7jt/bln Pria/ Wnt Usia min18th Serius!!%081233592807 975250 KUNO MEBEL Serumah 12Bj&15 Pintu Jati Rumah Kuno Kolonial 50jt%081252681984 975850 CARI BEKAS MEBEL+elektronk:Mj +Krsi Lmari SbedEtalaseTvPs2PspKlkas Mcci Ac L ptopComHp Pindahn Dll 081805120277/ 03417377832 975907 SPA,REFLEXY Kursus 2Mgg Sdh Bs Kerja Dpt Srtfkt, 976077 MURAHBKSTkTutupMejaLesehanHanger Rak Display Pkaian Wnt%081231690066 976185 AGEN PERJALANAN BACKPACKERSToBali16-19Agsts’13375Rb H:WisataWisata%7376468/081803825948 975877 PASURUAN KERJA PART/FUL TIME USA Corp income 3-10jt/bln, wr.supratman11.SMS:nama usia domisili.%087750927304 975903 MOJOKERTO SUMBERHIDUPSEDOTWCTINJA %0321-324494 /324495 MOJOKERTO 975584
  • 25. | FUTSALMANIA| KAMIS, 11 JULI 2013 SURABAYA, SURYA - Tiga pemain HFS Spar- ta Gresik yang berlaga di Divisi II LFA Jatim IV dipastikan merapat ke Laros FC, kontestan Divisi I. Tiga pemain ini adalah Agus Mauludin, Moch Miftahul Rozi, dan Ryant Hidayatullah. Mereka memang sudah lama diincar Laros dan akan mengenakan jersey Laros pada putaran kedua nanti. Ketiga pemain ini, selain pilar Sparta, juga merupakan punggawa Tim Futsal Kabupaten Gresik di Porprov IV/2013 Madiun lalu. Baik bersama Sparta dan Gresik, ketiga pe- main ini adalah tulang punggung di timnya. Tak heran jika tim pelatih dan manajemen La- ros kepincut dengan mereka. “Mereka bertiga sudah dilepas Sparta. An- tara Sparta dan Laros sudah ada kesepakatan. Putaran kedua mendatang mereka sudah bisa membela Laros di Divisi I,” tegas Boby Mulya, pemilik Laros, Rabu (10/7). Dijelaskan Boby, ia sengaja meminang tiga pemain ini untuk menambah amunisi di putar- an kedua, serta untuk memperkuat tim. Laros yang menduduki posisi ketiga di akhir putaran pertama, tampaknya belum bisa memuaskan hati Boby dan pihak manajemen. Makanya, untuk mendongkrak prestasi di putaran kedua perlu menambah pemain lagi. “Semoga dengan masuknya ketiga pemain ini, prestasi Laros menjadi lebih baik lagi di pu- taran kedua. Tak hanya tiga pemain ini, kami juga masih mencari pemain lagi untuk ditam- bahkan di putaran kedua nanti,” kata Boby. Menghuni peringkat ketiga di klasemen se- mentara Divisi I, Laros mengumpulkan 26 poin. Poin ini sama dengan yang dicapai Barkla FC di posisi runner-up. Di puncak klasemen ada Dyvy FC dengan raihan 31 poin. Dari 13 pertandingan, Laros menang delapan kali, seri dua kali, dan kalah tiga kali. Sementara pelatih Sparta, Chusnul Iman mengungkapkan, terkait pinangan Laros terha- dap tiga pemainnya, ia tidak menghalangi. Sebaliknya, Iman justru mendukung para pemainnya agar bisa meraih prestasi tinggi di Sparta maupun di luar Sparta. “Yang jelas, jika itu untuk kebaikan masa depan pemain, maka saya akan mendukung- nya. Lagi pula umur ketiga pemain ini masih muda, karier mereka masih panjang. Saya harap mereka bisa mencipta- kan prestasi ba- gus bersama Laros,” tandas Iman. (edr) SURABAYA, SURYA - Sukses besar di- raih Tim SAR di orbit Divisi II LFA Jatim IV. Betapa tidak, meski berpredikat seba- gai debutan di kancah futsal Jatim, Tim SAR mampu membuktikan diri dengan bertengger di puncak klasemen Divisi II hingga putaran pertama berakhir. Gelar juara paruh musim ini dicapai Tim SAR secara mulus. Dari 14 kali per- tandingan, Tim SAR hanya sekali mene- lan kekalahan dan 13 kali menang. Kini Tim SAR mengumpulkan 39 poin dan hanya terpaut tiga poin dengan peng- huni runner-up, AK FC. Meski memetik hasil yang luar biasa untuk ukuran tim pendatang, Tim SAR belum berpuas diri. Tim SAR masih memendam ambisi lain, yakni memperbaiki kualitas tim dengan melakukan pembenahan agar permainan makin bagus di putaran kedua nanti. Pelatih Tim SAR, Aris Mardianto, mengungkapkan, secara hasil Tim SAR memang sudah menjadi yang terbaik di putaran Divisi II ini. Namun, dalam segi permainan, Tim SAR masih banyak kekurangan. Ini be- lum bisa memuaskan pelatih. “Pemain masih sering kehilangan fo- kus ketika di lapangan pertandingan. Dari sinilah lawan bisa memanfaatkan- nya untuk mencetak gol," kata Aris, Rabu (10/7). "Di laga terakhir saat lawan Meta mi- salnya, Meta berhasil mencetak tiga gol ke gawang kami, meskipun akhirnya laga kami menangi dengan skor 6-3,” ia menambahkan. Tim SAR memang berpredikat sebagai debutan, namun tidak untuk para pema- innya. Sebagian besar pemain Tim SAR adalah pemain yang sudah memiliki jam terbang lumayan tinggi. Pasalnya, mereka adalah berasal dari SFC Bulldozer, raksasa Divisi I musim lalu, yang kini mengundurkan diri dari LFA Jatim. Hal inilah yang membuat Cahyo Bas- koro dkk menjelma menjadi tim tangguh di Divisi II musim ini. “Yang perlu dibenahi lagi dari Tim SAR adalah perihal finishing. Sebab kami sering membuang peluang emas. Selain itu, Tim SAR jangan meremehkan siapa pun lawan yang akan dihadapi,” pung- kas Aris. (edr) Kejuaraan di Portugal cukup penting untuk menguji kemampuan dan menambah pengalaman. BAMBANG EKO SUHARTAWAN PELATIH VOLI PANTAI JATIM Tim SAR jadi Debutan Tersukses■ TERUS BER- GERAK - Meski memuncaki kla- semen, Feri Budi dkk tidak berhenti mengejar hasil terbaik di Divisi II. Koordinasi Permainan Olympic Masih Buruk SURABAYA, SURYA - Meski pu- taran pertama Divisi II LFA Jatim IV sudah berakhir, namun Olympic Sport FC masih menyisakan satu laga tunda melawan Eagle Malang. Olympic dan Eagle baru melakoni 13 laga, sedangkan kontestan lain- nya sudah 14 laga. Rencananya laga Olympic vs Eag- le akan digelar usai bulan puasa atau sebelum putaran kedua dimulai. Kini di klasemen sementara Divisi II, Olympic sukses menduduki posi- si lima besar dengan raihan 27 poin. Puncak klasemen dihuni Tim SAR (39 poin), runner-up dihuni AK FC (36 poin), posisi tiga dan empat masing- masing dihuni Eagle Malang dan HFS Sparta Gresik dengan poin 34. Berdasarkan catatan di atas, hasil apa pun yang terjadi saat Olympic meladeni Eagle, tidak akan meng- ubah posisi Olympic di lima be- sar. Sebaliknya, jika Eagle menang, maka Eagle akan mengkudeta AK FC dari posisi runner-up. Nah, meski laga lawan Eagle masih lama dan belum diketahui jadwalnya, Olympic sudah sibuk mengasah diri. "Masih banyak kekurangan di Olympic sebelum kami bertanding melawan Eagle. Kekurangan-keku- rangan ini harus segera diasah agar menjadi baik. Salah satunya adalah koordinasi antarlini yang masih bu- ruk," kata Simon Suprapto, pelatih Olympic, Rabu (10/7). Buruknya koordinasi antar lini ini, ungkap Simon, terlihat saat Olympic membungkam Great Wall 7-3 dalam laga Divisi II pekan lalu. Saat itu koordinasi pemain Olym- pic tidak berjalan lancar. Banyak skema serangan yang gagal dijalan- kan akibat koordinasi yang jelek. "Pemain masih kurang tanggap dalam melakukan koordinasi. Aki- batnya, serangan-serangan yang sudah dirancang tidak berjalan lan- car. Malahan sering kandas direbut lawan dan lawan bisa mencuri gol," kata Simon. Dari 13 pertandingan yang sudah dilakoni di paruh musim ini, Olym- pic sudah memetik sembilan kali ke- menangan dan empat kali kekalah- an. (edr) ISSI Jatim Agendakan Musprovlub SURABAYA, SURYA - Setelah melakukan sosialisasi dan per- temuan dengan Pengcab Ikatan Sepeda Sport Indonesia (ISSI) se- Jawa Timur, para pengurus orga- nisasibalapsepedamengagenda- kan Musyawarah Provinsi Luar Biasa (Musprovlub) yang akan digelar pada bulan Ramadan ini. Pelaksana tugas (Plt) ISSI Ja- tim,Armuji menuturkan, pihak- nya secepatnya akan menggelar Musprovlub guna memilih ke- tua baru secara definitif. "Kami rencanakan, Musprov- lub bisa dilaksanakan pada pua- sa ini. Kalau setelah Lebaran, sepertinya terlalu lama," sebut Armudji, Rabu (9/7). Armuji mengaku, Pengcab ISSI se Jatim dan klub sudah mendapat sosialisasi. Dirinya juga telah meminta masukan dari Pengcab ISSI, klub, pecinta balap sepeda dan para atlet soal ISSI Jatim kedepan. "Kami ingin ISSI Jatim ke de- pan lebih baik. Siapapun nanti pengurusnya, harus fokus dan total memajukan balap sepeda di Jatim. Pembinaan juga harus dilakukan serius demi kejayaan balap sepeda Jatim," jelas ang- gota DPRD Surabaya ini. Saat ini, sudah ada kandidat yang menyatakan kesediaannya menjadi Ketua ISSI Jatim empat tahun kedepan. Dua kandidat itu adalah Guntur dan Arman Van Kempen. Guntur merupakan Ketua Umum Pengcab ISSI Banyuwa- ngi. Sedangkan Arman adalah pembina sekaligus pemilik klub Jasalindo Sport Surabaya. "Saya kira, duet Pak Guntur dan Arman sangat layak dan dibutuhkan balap sepeda Jatim saat ini. Keduanya memiliki ko- mitmen dalam pembinaan ba- lap sepeda," terang Armuji. Seperti diketahui, kepengu- rusan Pengprov ISSI Jatim telah dibekukan PB ISSI sejak empat bulan lalu. ISSI Jatim dibeku- kan, karena diduga menjadi ini- siator digelarnya Musyawarah Nasional Luar Biasa (Munas- lub) PB ISSI di Sidoarjo. (fat) SURYA/ERFAN HAZRANSYAH TENAGA BARU - Agus Mauludin (depan) menjadi salah satu dari tiga pemain HFS Sparta yang ditampung Laros FC. Pevoli Pantai Jatim Ikuti Kejuaraan Dunia SIDOARJO, SURYA - Jatim selalu mencetak atlet bola voli pantai berprestasi interna- sional. Salah satunya adalah pasangan voli pantai putra, Rendy Ferdian Licardo/M Asfiyak yang bakal mengikuti kejuaraan dunia U-19 di Portu- gal, pertengahan Juli 2013. Pelatih voli pantai Jatim, Bambang Eko Suhartawan menjelaskan, Rendy Ferdian/ M Asfiyak merupakan pevo- li pantai yang punya kualitas bagus. Mereka sering tampil pada kejuaraan-kejuaraan bola voli internasional. Seperti kejuara- an dunia junior, Asia-Pasific junior, Indonesia Open dan ke- juaraan besar lainnya. Rendy Ferdian/M Asfiyak baru sukses merebut juara pada Asia Pasific U-21 di India, pada Mei 2013. Di final, kedua- nya mengalahkan pasangan Kazaktan 2-1. Bambang Eko Suhartwan berharap, dua atlet didikannya yang masih menimba ilmu di SMANOR (Sekolah Menengah Negeri Olahraga) Jatim itu bisa meraih prestasi terbaik di Por- tugal. "Saya berharap bisa jadi juara dengan merebut medali emas di Portugal. Keduanya memang menunjukan perma- inan yang terus meningkat," sebut Bambang Eko Suharta- wan, Rabu (9/7). Menurut Wawan - panggil- an Bambang Eko Suhartawan - dua anak didiknya itu dipas- tikan harus kerja keras di Por- tugal. Karena, pemain-pemain ne- gara lain juga bakal ikut ambil bagian di Portugal. "Usianya masih muda dan masih panjang. Kejuaraan di Portugal cukup penting untuk menguji kemampuan dan me- nambah pengalaman," terang Wawan. Sebelum meraih juara Asia Pasific di India, Rendy Ferdi- an/M Asfiyak merupakan pe- megang gelar di Kejuaraan Na- sional (Kejurnas) junior pada MULTISPORT SURYA/FATKHUL ALAMY LEVEL DUNIA - Rendy Ferdian (kanan) dan M Asfiyak (kiri) bakal terjun ke kejuaraan voli pantai U-19 di Portugal. Keduanya didampingi pelatih Bambang Eko Suhartawan. Laros Rekrut Tiga Bintang Sparta BELUM PUAS DIPUNCAK PERBAIKI DIRI - Bersama Olympic, Adi Irawan (14), masih punya waktu memperbaiki diri. 2011 dan 2012. Mereka juga mencatat hasil terbaik dengan meraih juara saat turun di Indonesia Open 2013 di pantai Kenjeran, Surabaya. Selain itu, Rendy Ferdian/M Asfiyak juga merupakan juara di Kejurnas Series di Padang pada bulan Mei 2013. Kala itu, Rendy Ferdian/M Asfiyak mengalahkan pasangan Indo- nesia 2. (fat) SURYA/DOK BUTUH NAKHODA - Kegiatan Tour de East Java 2011. Prestasi balap sepeda Jatim bisa terangkat kalau punya pemimpin visioner. SURYA/AHMAD ZAIMUL HAQ SURYA/AHMAD ZAIMUL HAQ join follow @portalsurya
  • 26. Aremania MALANG, SURYA - Penam- bahan tiga pemain belum bisa mengangkat performa Arema LPI. Manajemen masih membu- ru pemain baru agar bisa men- dongkrak performa tim besutan Abdurahman Gurning ini. Direktur OperasionalArema LPI, Haris Fambudy mengakui manajemen dan tim pelatih be- lum melakukan evaluasi hasil putaran pertama Liga Prima Indonesia (LPI) 2013. Tetapi manajemen sudah bisa meng- ambil kesimpulan sementara setelah mengamati laga yang dilakoni Arema LPI. Menurutnya, Gurning bu- tuh tambahan dua pemain sayap, baik sayap kiri maupun sayap kanan. Memang Singo Edan sering memanfaatkan kemampuan pemain sayap untuk mempertajam daya serang. Sayangnya peranan pemain sayap masih kurang maksimal. “Kami juga butuh gelandang serang. Selama ini hanya ada Legimin Raharjo yang bisa menjadi gelandang serang maupun gelandang bertahan,” kata Haris kepada Surya, Rabu (10/7). Kebutuhan gelandang se- rang ini mencuat saat Arema LPI melakoni tiga laga away terakhir. Meski dibekap ce- dera, Legimin tetap dipaksa merumput. Legimin yang bisa berperan sebagai playmeker ini tidak bisa maksimal meng- aturseranganataupertahanan. Akibatnya, Perseman Manok- mari membungkam 4-0 Arema LPI, sedangkan PSM Makassar membantai 5-0. Striker juga menjadi kebu- tuhan mendesak tim yang ber- markas di Stadion Gajayana ini. Memang Arema LPI baru mendapat Teddy Priyanto pada awal Juni 2013. Tetapi, Teddy belum bisa mengganti- kan peranan Jaya Teguh Ang- ga (JTA). (jay) Kembali Lakoni Latihan BURU PEMAIN - Herman Romansyah, gelandang Arema LPI berebut bola dengan Achmad Setawan, gelan- dang Bontang FC dalam lanjutan Kompetisi Liga Prima Indonesia (LPI) di Stadion Gajayana Malang, Kamis (27/6). Kini Arema ber- buru lima pemain lagi untuk meng- arungi putaran kedua LPI nanti. BEREBUT BOLA - Striker Arema Cronous, Alberto 'Beto' Goncalves, berebut bola dengan bek Victor Igbonefo dalam latihan simulasi game di stadion Gajayana Malang, beberapa waktu lalu. Menghadapi tur Kaltim nanti, Singo Edan mengagendakan uji coba malam. Arema LPI Berburu Lima Pemain Persema Malang Butuh Pengontrol Tim MALANG, SURYA - Penam- pilan Persema di putaran perta- ma Liga Prima Indonesia (LPI) 2013 kurang memuaskan. Las- kar Ken Arok hanya mengan- tongi 9 poin dari 13 laga. Rekor laga yang dilakoni anak asuh Rudi Hariantoko pun sangat buruk. Persema hanya mengemas tiga kali kemenangan, tanpa hasil seri, dan 11 kali kalah. Produkti- vitas gol tim yang bermarkas di Stadion Gajayana ini pun sangat buruk. Hanya 15 gol yang tercetak selama putaran pertama, dan 37 kali gawang Persema kebobolan. Asisten Manajer Persema, Patrick Theo Tarigan, meng- ungkapkan Persema keku- rangan pemain senior sebagai pengontrol tim. Persema ha- nya memiliki beberapa pemain senior di antaranya, Ruhanda Maridiansyah (kiper), Agung Dwi Jacksono, dan Irfan Ra- ditya di posisi bek. Di lini tengah hanya ada M Kamri, dan Dodit Fitrio di lini depan. Sisanya adalah pemain muda yang direkrut dari kontestan kompetisi internal Persema. “Anak-anak butuh sosok pemain yang bisa mengontrol, baik di dalam maupun di luar lapangan,” kata Patrick kepada Surya, Rabu (10/7). Persema masih memiliki peluang menambah pemainnya karena bursa transfer kompetisi musim ini baru akan ditutup pada akhir Agustus 2013. Me- nurutnya, manajemen sedang memburu pemain yang bisa me- nutupi kebutuhan tim. Bahkan, manajemen sudah mendekati sejumlah pemain senior. “Keha- diran pemain senior juga untuk meningkatkan mental anak- anak,” tambahnya. Hal senada juga diakui pe- latih Persema, Rudi Harianto- ko. Menurut Rudi yang juga mantan pemain Arema ini, suntikan pemain yang dibu- tuhkan tim besutannya adalah gelandang dan striker. Dia berharap pemain yang dida- tangkan tidak hanya sekadar pandai mengocek bola. “Pemain itu harus memiliki visi lebih baik dibandingkan pemain lain,” kata Rudi.(jay) SURYA/HAYU YUDHA PRABOWO DUEL UDARA - Dicky Prayoga, gelandang Persema Malang, duel udara dengan Sergey Litvinov,bek PSLS Lokhsumawe dalam lanjutan kompetisi Liga Prima Indonesia di Stadion Gajayana Malang, Senin (8/7). Persela Mainkan Pola Pressing Ketat PALEMBANG, SURYA - Pertandingan berat bakal dialami Persela Lamongan saat dijamu tuan rumah Sriwijaya FC, di Stadion Jakabaring, Palem- bang, Kamis (11/7) malam. Laskar Joko Tingkir harus menghadapi Laskar Wong Kito tanpa dua pilar asingnya. Sang kapten sekaligus kreator serangan Gustavo Lopez absen karena hukuman akumulasi kartu, sedangkan bek Han Sang Min absen karena cedera di tulang punggung. Tak hanya itu, Perse- la datang ke Stadion Jakabaring juga di- selimuti oleh ‘rasa malu’ yang mendalam. Pasalnya, di putaran pertama Liga Super Indo- nesia (LSI) lalu, Persela dipermalukan Sriwijaya dengan skor 1-2, di Stadion Surajaya, Lamongan, 31 Maret 2013 silam. Terkait hasil kalah di putaran pertama, Pelatih Persela Didik Ludiyanto memastikan timnya sudah meng- ambil pelajaran sekaligus sudah menyiapkan ramuan khusus untuk mematikan lawan. "Persela wajib pressing ketat begitu lawan mulai masuk garis pertahanan," kata Didik memaparkan strategi yang diusung- nya, Rabu (10/7). Mengenai Absennya Lopez dan Han, ungkap Didik, Persela masih memiliki banyak pilihan pemain yang bisa diplot mengisi posisi yang ke- duanya. NamuntetapsajaabsennyaLopezdanHandiakui Didik akan mempengaruhi kekuatan tim. Di posisi gelandang yang ditinggalkan Lopez, Persela masih memiliki Jimmy Suparno, Zaenal Arifin, dan darah muda Fandi Eko Utomo. Sedangkan untuk posisi bek yang ditinggalkan Han Sang Min, Persela memiliki bek alternatif seperti Djayusman Triasdi, Saiful Lewenussa, dan Eky Taufik. Menghadapi pertandingan pertama di bulan puasa, Didik mengaku tidak terlalu khawatir. Menurutnya dengan jeda waktu tiga jam usai ma- kan dan waktu pertandingan, kondisi pemainnya tidak akan banyak mengalami perubahan. "Jeda waktu sebelum petandingan adalah tiga jam. Sepanjang waktu itu, makanan berbuka pua- sa sudah bisa dicerna secara baik," ucapnya. Di klasemen sementara Liga Super Indonesia, po- sisi Sriwijaya dan Persela terpaut sangat jauh. Sriwijaya menghuni peringkat empat dengan raihan 52 poin. Sedangkan Persela di posisi 11 dengan kumpulan 33 poin. Namun jurang po- sisi yang lebar ini juga tidak membuat Didik minder. "Jangan melihat hasil masa lalu di putaran pertama (dan klasemen), tapi marilah menatap masa depan di putaran kedua ini. Yang jelas kami butuh bantuan doa untuk meraih poin di Jakabaring,” kata Didik. (edr) | PEVOLI PANTAI JATIM KE KEJUARAAN DUNIA Jatim selalu mencetak atlet bola voli pantai berprestasi internasional. Salah satunya pasangan voli pantai putra, Rendy Ferdian Licardo/M Asfiyak yang bakal mengikuti kejuaraan dunia U-19 di Portugal, pertengahan Juli 2013. Pelatih voli pantai Jatim, Bambang Eko Suhartawan menjelaskan, Rendy Ferdian/M Asfiyak merupa- kan pevoli pantai yang punya kualitas bagus. Mereka sudah sering tampil pada kejuaraan bola voli internasio- nal, seperti kejuaraan dunia junior, Asia Pasific junior, Indonesia Open, dan kejuaraan series lainnya. Rendy Ferdian/M Asfiyak baru saja sukses merebut juara pada Asia Pasific U-21 di India pada Mei 2013. Di final, keduanya mengalahkan pasangan Kazaktan 2-1. Bambang Eko Suhartawan berharap, dua atlet didikannya yang masih menimba ilmu di SMANOR (Sekolah Menengah Negeri Olahraga) Jatim itu bisa meraih prestasi terbaik di Portugal.(fat) HALAMAN 24 | | KAMIS, 11 JULI 2013 MARIO COSTAS PRAKIRAAN PEMAIN: SRIWIJAYA FC: Rivki Mokodompit, Abdul Rahman, Fandy Mochtar, Dong Won Lee, Mahyadi Panggabean, Ponaryo Astaman, Rifan Nahumarury, Foday Boakay, Erick Weeks Lewis, Tantan, Riski Ramdani. PERSELA:ChoirulHuda,RomanGolian,SaifulLewenussa, Djayusman Triasdi, Taufik Kasrun, Jimmy Suparno, Zaenal Arifin, Oh In-Kyun, Fandi Eko Utomo, Mario Costas, Samsul Arif. SURYA/HAYU YUDHA PRABOWO MA- L A N G , SURYA - Arema Cro- nous d i - j a d - w a l - k a n kembali melakoni latihan pada Kamis (10/7) sore di Stadion Gajayana. Latih- an ini dipersi- apkan untuk melakoni tur Kali- man- t a n T i - m u r (Kaltim) mulai akhir Juli 2013. Singo Edan akan melakoni dua laga di Kal- tim yaitu dijamu Mitra Kukar di Stadion Aji Imbut pada 28 Juli 2013 dan Persisam Sama- rinda di Stadion Segiri, 1 Agustus 2013. Untuk mempersiapkan diri menghadapi dua jamuan itu, Arema tetap melakoni latihan selama Ramadan. Tetapi latihan selama Ramadan ini dengan berbagai penyesuaian, diantaranya soal waktu latihan. Selama ini pelatih Arema Cronous, Rahmad Darmawan (RD), biasa memimpin latihan pada pagi atau sore. Namun, selama Ramadan latihan pagi ditiadakan. Latihan hanya digelar pada sore hari. Itu pun pelaksanaannya tidak terlalu siang. Biasanya latihan sore dimulai pukul 14.30 WIB atau 15.00 WIB. “Selama Ramadan ini, latihannya mung- kin digelar mulai pukul 15.45 WIB, dan baru berakhir sebelum berbuka puasa,” kata RD kepada Surya, Rabu (10/7). Durasi latihan ini memang lebih pendek di- banding latihan di luar Ramadan. Pelatih asal Metro Lampung ini biasa memimpin latihan an- tara 2-3 jam, kecuali saat menjelang laga latihan hanya digelar selama sejam. RD mengaku sengaja mengurangi volume latihan agar pemain yang puasa tetap bisa melahap menu latihan. Program serupa sudah dilakukan RD sejak memimpin beberapa klub profesional sebelumnya. Menurut RD, tidak ada pemain yang membatalkan puasa akibat mela- koni program latihan. “Waktu latihan memang lebih pendek, se- hingga materi latihan kami padatkan. Kami akan memberikan recovery training dari satu sesi latihan ke sesi latihan lain,” tambahnya. Uji Coba Malam Sementara sampai sekarang belum ada kepastian perubahan jadwal laga Arema Cronous di Kaltim melawan Mitra Kukar dan Persisam. Tetapi yang jelas dua laga ini akan digelar pada pukul 21.00 WIB. Panjangnya masa recovery ini membuat tim pelatih mengagendakan uji coba. Laga persa- habatan ini bukan hanya untuk menjaga skill dan atmosfer pertandingan Arema. Tim pela- tih pun ingin mengadaptasikan Alberto ‘Beto’ Goncalves dkk dengan suasana laga malam. Melakoni laga pada pukul 21.00 WIB me- mang bukan pertama kali bagi pemain Arema Cronous. Tetapi para pemain Arema tetap butuh adaptasi lagi. Selama ini PT LI hanya menggelar laga pada 15.30 WIB atau pukul 19.00 WIB. “Nanti kemungkinan ada uji coba malam,” ungkap Satia Bagja, Asisten Pelatih Arema Cronous, Rabu (10/7). Satia mengakui tim pelatih belum memutus- kan kebutuhan uji coba selama jeda kompetisi ini. Idealnya laga uji coba digelar sekali dalam sepekan. Dipastikan dalam pekan pertama Ramadan ini tidak ada laga uji coba. Menurutnya, laga uji coba ini harus diikuti semua pemain. Padahal, delapan pemain Arema masih memenuhi panggilan Timnas senior dan Timnas U-23. Delapan pemain ini dijadwalkan kembali bergabung di Arema pada 17 Juli 2013. “Rencana uji coba malam segera kami matangkan. Uji coba ini baru bisa dilakukan saat semua pemain bergabung ke klub,” pungkasnya. (jay) Agendakan Uji Coba Malam■ SURYA/ERFAN HAZRANSYAH SURYA/HAYU YUDHA PRABOWO join follow @portalsurya
  • 27. Bal-balan CakHALAMAN 24 | | KAMIS, 11 JULI 2013 malang, surya - Arema Cronous dijadwalkan kembali melakoni latihan pada Kamis (10/7) sore di Stadion Gajayana. Latihan ini dipersiapkan untuk melakoni tur Kalimantan Timur (Kaltim) mulai akhir Juli ini. Tim Singo Edan akan melakoni dua laga di Kaltim yaitu mela- wan Mitra Kukar di Stadion Aji Imbut, 28 Juli, disusul partai me- lawan Persisam Samarinda di Stadion Segiri, 1 Agustus. Untuk mempersiapkan diri menghadapi dua jamuan itu, Arema tetap melakoni latihan selama Ramadan. Tetapi latihan selama Ramadhan ini dengan berbagai penyesuaian. Di anta- ranya soal waktu latihan. Selama ini pelatih Arema, Rahmad Darmawan (RD) biasa memimpin latihan pada pagi atau sore. Tetapi sekarang latih- an hanya digelar sore hari. “Selama bulan puasa ini, la- tihan mungkin digelar mulai pukul 15.45 WIB, dan berakhir sebelum berbuka puasa,” kata RD kepada Surya, Rabu (10/7). Durasi latihan ini memang le- bih pendek dibandingkan latihan di luar Ramadan. RD mengaku sengaja mengurangi volume la- tihan agar pemain yang berpuasa tetap bisa melahap menu latihan. Program serupa sudah dilaku- kannya sejak memimpin bebera- pa klub profesional sebelumnya. Menurutnya, tidak ada pemain yang membatalkan puasa akibat melakoni programnya. “Volume latihan lebih pendek. Tetapiintensitaslatihannyakami tingkatkan. Kami akan membe- rikan recovery training dari satu sesi latihan ke sesi latihan lain,” tambahnya. (jay) surabaya, surya - Sekali lagiPersebayaDUmembuktikan kapasitasnya sebagai penantang kuat peraih tiket promosi ke Liga Super Indonesia (LSI) keti- ka menguasai puncak klasemen Grup B dengan nilai tujuh. Ini menjadi prestasi lanjutan Uston Nawawi dkk yang juga terus memimpin Grup III saat masih berkompetisi di fase pe- nyisihan grup lalu. Hanya, tan- tangan ke depan Persebaya DU le- bih berat. Pelatih Persebaya DU, Tony Ho meng- aku saat ini timnya memang be- lum terkalahkan dari 17 laga. "Semoga prestasi tim terus dipertahankan. Ke depan, tan- tangan kita pasti lebih berat lagi. Pemain jangan sampai lengah," sebut Tony yang sedang berli- bur di Makassar, Rabu (9/7). Merampungkan tiga laga di babak 12 besar, Persebaya DU meraup tujuh poin. Nilai itu diperoleh dari dua kemenang- an, saat memukul PSBS Biak 1- 0 dan menghajar PS Bangka 2-1. Sedangkan di satu laga lainnya, Persebaya DU bermain 2-2 de- ngan PSIS Semarang. Di laga selanjutnya, Persebaya DU harus tampil dua kali away dan sekali home di Grup B. Yaitu mengawali laga dengan berkun- jung ke markas PSBS Biak, 19 Agustus. "Tidak ada laga mudah, semua pemain harus bekerja ke- ras. Semua harus memiliki tekad dan kerja keras," tegas Tony. Menurut pelatih kelahiran Makassar 1960 ini, target lolos ke semifinal kompetisi musim ini harus diwujudkan. "Kita butuh proses. Semuanya harus bersatu dan memiliki tekad kuat untuk mewujudkan misi lolos," aku Tony. (fat) surya/erfan hazransyah SFC Ingin Teruskan Dominasi MENJADI tuan rumah tentunya tidak ada kata kalah bagi Sriwi- jaya FC. Karena bermain di luar saja, Sriwijaya berupaya menang apalagi saat menyambut Persela Lamongan di Stadion Jakabaring, Kamis (11/7). Sriwijaya FC tetap menarget- kan kemenangan demi meme- nuhi ambisi mengejar Arema Cro- nous dan Persib Bandung. Menghadapi Persela, Sriwijaya ingin dominasi mereka berlanjut usai mempermalukan Laskar Joko Tingkir 2-1 di Lamongan pada putaran pertama lalu. Pelatih Sriwijaya, Kas Hartadi pun menegaskan bahwa para pemainnya akan bermain mak- simal. Menurut Kas, meskipun tidak akan diperkuat pemain asingnya, Gustavo Lopez, akibat akumulasi kartu kuning, Persela tetaplah tim yang berbahaya. "Absennya Gustavo Lopez se- dikit menguntungkan kita, karena Gustavo terkenal dengan umpan- umpan matangnya. Namun Per- sela tetap berbahaya karena ma- sih memiliki Mario Costas dan Samsul Arif," kata Kas. Menurut Kas, selama ini tum- puan serangan Persela terletak pada kedua pemain ini. “Persela masih memiliki dua striker han- dal. Mereka wajib kita waspadai, jika ingin merebut kemenangan,” kata Kas. Sumbangan 13 gol dari Samsul serta sembilan dari Costas, mem- buktikan kalau dua striker ini tidak bisa dipandang sebelah mata. "Sedikit kita lengah, akan sangat berbahaya. Karena itu lini bela- kang harus waspada menjaga dua pemain ini,” ujar Kas. (goal) surya/erfan hazransyah menunggu lawan - Uston Nawawi dkk menemukan ritme permain- an terbaik musim ini. Namun belum menemukan lawan sepadan. Persebaya DU Dilarang Lengah Tunggu Persiba, Andik dkk Terus Geber Latihan surabaya, surya - Meski kompetisi Liga Prima Indonesia (LPI) diliburkan selama bulan Ramadan, tetapi Persebaya Su- rabaya tidak lantas meliburkan para punggawanya. Sebaliknya Persebaya sudah bersiap terus menggeber latihan bagi Andik Vermansyah dkk guna menjaga fisik selama bulan puasa ini. Setelah melakoni pertanding- an away lawan Persija Jakarta, Minggu (7/7) lalu, Tim Bajul Ijo diliburkan selama satu pekan. Mat Halil dkk kembali menjala- ni sesi latihan pada 15 Juli. "Kita beri kesempatan pema- in libur seminggu. Tanggal 15 Juli nanti kita kembali latihan sampai menjelang lebaran. La- tihan harus tetap jalan, meski bulan puasa,"sebut IbnuGrahan, arsitek Per- sebaya, Sela- sa (8/7). Menurut Ibnu, porsi latihan skuadnya nanti bisa di- lakukan malam hari. Ini supaya latihan bisa berjalan maksimal. "Latihan sore sebenarnya juga bisa dilakukan. Nanti dilihat ke- butuhan dan kondisi. Kalau ma- lam, dilakukan sehabis tarawih kita latihan di lapangan futsal. Yang penting feeling ball dan sta- mina tim terjaga," jelas Ibnu. Jika tidak latihan, lanjut Ibnu, dirinya khawatir kondisi fisik pemain drop. Kemudian nalu- ri bermainnya akan hilang. Pa- dahal kompetisi masih berjalan panjang. Persebaya tetap berbenah, kata Ibnu, bukan hanya untuk menghadapi putaran kedua LPI. Latihan selama Ramadan juga sebagai antisipasi Perse- baya jika laga tunda lawan Per- siba Bantul jadi diumumkan pihak Liga Prima Indonesia Sportindo (LPIS). "Sampai saat ini belum ada pemberitahuan jadwal per- tandingan lawan Persiba dari LPIS," jelas Ibnu ketika ditanya soal laga sisa Persebaya di pu- taran pertama ini. Laga Persiba kontra Perseba- ya sejatinya dihelat 26 Juni lalu. Hanya, pertarungan tersebut ditunda karena tidak mendapat izin dari Polda Jogjakarta. (fat) Bubarkan Saja LPIS! padang, surya - Krisis keuangan yang men- dera banyak tim peserta Liga Prima Indonesia (LPI) membuat Semen Padang (SP) gerah. Ketua Umum SP, Erizal Anwar pun akhirnya ‘berteriak’ meminta pertanggungjawaban LPIS (Liga Prima Indonesia Sportindo) selaku operator kompetisi. Erizal bahkan mendesak agar LPIS dibubar- kan, karena lembaga itu tidak bersikap apapun ketika sudah banyak tim yang tidak sanggup melanjutkan kompetisi. Hal ini membuat tim yang kuat seperti SP rugi. Pasalnya untuk mengikuti satu laga tandang, pi- haknya mengeluarkan dana sampai Rp 135 juta. "Seperti laga tandang yang gagal saat mela- wan Persija. Mereka tidak memiliki dana untuk menggelar pertandingan di JogJakarta," kata Erizal kepada Berita Kota Super Ball (Tribunnews. com Network). SP juga gagal menjamu tiga klub, yaitu Are- ma, Persebaya, dan Persibo. Tiga klub itu tidak bisa datang ke Stadion H Agus Salim karena krisis dana. "Seharusnya untuk tim yang tidak bisa meng- ikuti pertandingan diberi sanksi pengurangan tiga poin. Tidak hanya memberikan kemenang- an kepada tuan rumah. Dengan demikian ada kejeraan dari tim tamu," ucapnya. Untuk menghindari kejadian serupa, ucap Eri- zal seharusnya LPIS tidak lagi mengikutsertakan tim yang mengalami krisis keuangan. Sayangnya LPIS tidak berbuat banyak, sehingga kondisi ini mengganggu kualitas kompetisi LPI. "Kalau tidak sanggup menjalan aturan seba- iknya LPIS dibubarkan. Mereka tidak tegas me- nerapkan aturan dan regulasi. LPIS tidak profe- sional, karena banyak pertandingan yang tidak berjalan dengan benar. Kami tim yang sehat jadi banyak keluar dana besar untuk menyiapkan laga yang batal digelar," tutur Erizal. Jika tim-tim yang 'sakit' ini dibiarkan, Erizal tidak yakin putaran kedua kompetisi LPI bisa digelar pada 24 Agustus nanti. "Bagaimana kompetisi bisa berjalan dengan baik, jika masih banyak tim yang krisis finansial. Makanya saat ini lebih fokus menyiapkan diri di Piala AFC 2013 saja," imbuhnya. (wartakota) Arema Siapkan Tur Kalimantan surya/hayu yudha prabowo ubah ritme - Para pemain Arema mulai beradaptasi dengan pola latihan yang lebih padat selama bulan puasa. lamongan, surya - Awal puasa tetap tidak ada rehat bagi Persela Lamongan, karena Laskar Joko Tingkir malah harus mengu- kur kekuatannya melawan Sriwi- jaya FC pada lanjutan Liga Super Indonesia (LSI) di Stadion Jaka- baring Palembang, Kamis (11/7). Sejak awal pelatih Persela, Di- dik Ludiyanto, sudah memberi warning bahwa dua pemain ber- pengaruh di Sriwijaya yaitu ge- landang gaek Ponaryo Astaman, dan striker cerdik Tantan, wajib ditutup pergerakannya. “Semua pemain Sriwijaya ber- bahaya, tidak hanya Ponaryo dan Tantan. Namun yang jelas, siapa saja (pemain Sriwijaya) yang ma- suk ke daerah pertahanan Persela wajib di-pressing ketat,” tegas Di- dik kepada Surya, Rabu (10/7). Di laga nanti, perjuangan Per- sela dipastikan berat karena ha- rus menghadapi Sriwijaya tanpa dua pilar asingnya. Sang kapten sekaligus kreator serangan Gustavo Lopez absen karena akumulasi kartu, sedang- kan bek Han Sang Min absen ka- rena cedera tulang punggung. Cobaan harus dihadapi Mario Costas dkk agar memetik poin di Stadion Jakabaring. “Kami harus kerja ekstra di pertandingan ini. Kami akan meng- usahakan sekuat tenaga agar bisa memetik poin atas Sriwijaya,” tegas Didik. Terkait absen- nya Lopez dan Han, Persela bisa memilih antara Jimmy Suparno, Zaenal Arifin, dan darah muda Fandi Eko Utomo. Sedangkan Djayusman Triasdi, Saiful Lewe- nussa, dan Eky Taufik bisa me- nambal sektor belakang. Di laga home terakhir, Persela hanya bermain imbang 0-0 men- Semua Pemain Sriwijaya Berbahaya ■ jamu Barito Putera. Sedangkan Sriwijaya di laga away ter- akhirnya menahan imbang Pelita Bandung Raya (PBR) 2-2. Di putaran pertama lalu, Persela dipermalukan Sriwijaya dengan skor 1-2 di Lamongan. Terkait hasil di putaran pertama lalu, ungkap Didik, Persela harus bisa mengam- bil pelajaran serta memiliki kekuatan men- tal sebagai modal untuk membalas. “Jangan melihat hasil masa lalu, tetapi marilah menatap masa depan di putaran kedua ini. Yang jelas kami butuh doa untuk mengejar poin di Jakabaring,” kata Didik. Di klasemen sementara LSI, posisi Sri- wijaya dan Persela terpaut jauh. Sriwijaya menghuni peringkat empat dengan 52 poin. Sedangkan Persela tercecer di posisi 11 de- ngan 33 poin. (edr) EKSTRA BUTUH KERJA surya/erfan hazransyah Prakiraan Pemain Sriwijaya: Rivki Mokodompit; Abdul Rahman, Fandy Moch- tar, Dong Won-Lee, Mahyadi Panggabean; Ponaryo Astaman, Rifan Nahumarury, Foday Boakay, Erick Weeks Lewis; Tantan, Riski Ramdani. Persela: Khoirul Huda; Roman Golian, Saiful Lewenussa, Djayusman Triasdi, Taufik Kasrun; Jimmy Suparno, Zaenal Ari- fin, Oh In-Kyun; Fandi Eko Utomo, Mario Costas, Samsul Arif. terus mencoba - Striker Persela, Mario Costas mendapat perhatian khusus dari Sriwijaya FC pada pertandingan, Kamis (11/7). Persela harus menolak status inferior di depan lawan. senasib - Krisis finansial yang melanda Persebaya Surabaya dan Persibo Bojonegoro menjadi contoh kegagalan LPIS mengelola kompetisi profesional. join follow @portalsurya