Loading…

Flash Player 9 (or above) is needed to view presentations.
We have detected that you do not have it on your computer. To install it, go here.

Like this presentation? Why not share!

Kesusasteraan melayu

on

  • 1,857 views

 

Statistics

Views

Total Views
1,857
Views on SlideShare
1,668
Embed Views
189

Actions

Likes
1
Downloads
35
Comments
0

5 Embeds 189

http://tunasastera-cermin-diri.blogspot.com 181
http://www.tunasastera-cermin-diri.blogspot.com 3
http://tunasastera-cermin-diri.blogspot.sg 3
http://tunasastera-cermin-diri.blogspot.co.uk 1
http://tunasastera-cermin-diri.blogspot.kr 1

Accessibility

Categories

Upload Details

Uploaded via as Microsoft PowerPoint

Usage Rights

© All Rights Reserved

Report content

Flagged as inappropriate Flag as inappropriate
Flag as inappropriate

Select your reason for flagging this presentation as inappropriate.

Cancel
  • Full Name Full Name Comment goes here.
    Are you sure you want to
    Your message goes here
    Processing…
Post Comment
Edit your comment

Kesusasteraan melayu Kesusasteraan melayu Presentation Transcript

  • KESUSASTERAAN MELAYU
    Kajiansajak “KaudanAku” karyaA.Rahim Hamid dalamAntologiSajakCerminDiri
  • HuraianMaksud
    Dalamusahamemberimaksud, kitamempunyaikebebasanuntukmentafsirmaksudmengikutkefahamanmasing-masing.
    Saturangkaphendaklahdihuraidalamsatuperenggandenganhuraian yang jelasdanterperinci.
    HURAIAN MAKSUD KESELURUHAN SAJAK
    Sajakinimengisahkantentangseorangbapa yang sangatkasihkananak-anaknya. Diamenginginkananak-anaknyaberkelakuanbaiknamunsebaliknyaanaktersebutmenjadinakaldantidakmenurutkata. Anak-anaknyasemakinberkelakuanliar namunbapaituhanyamampumemandangkelakuananak-anaknyatanpamembuatapa-apa. Jiran yang memerhatimemujiakansikapbapa yang baikhatiitu. Akhirnya, bapaitumenyisihkandirinyadengananak-anaknyakeranadiatidaklagidiperdulikanolehanak-anaknya.
  • HURAIAN MAKSUD SETIAP RANGKAP
    • RANGKAP 1:
    Seorangbapa yang inginmenjadipemurahdanpengasihterhadapanak-anaknya. Diamenginginkananak-anaknyaberkelakuanbaiknamunsebaliknyaanaktersebutmenjadinakaldantidakmenurut kata. Sungguhpunkelakuananaknyasedemikianrupa, bapatersebuttetapberlembut, mengalahdanmenurutsahajaakankemahuananak-anaknya.
  • RANGKAP 2:
    Di rumah, anak-anaknyamulaimeninggikansuarakepadabapaitudantidakmahumendengarsegalanasihatdanteguran yang diberikanolehbapa. Bapaituhanyamampumemandangkelakuananak-anaknyatanpamembuatapa-apa. Jiran yang memerhatimemujiakansikapbapa yang baikhatiitu. Walaupunbapaitusenangmenerimapujiantersebut, akantetapi di benakhatinyadiamerasasunyidanberdukakeranadiatidakdapatmelakukanapa-apalagiuntukmendidikanak-anaknyaitusupayaberkelakuanbaik.
  • RANGKAP 3:
    Anak-anakitusemakin liar dandanberanimengikutiajaran yang bertentangandengan agama Islam. Bapatersedarbahawadiatidakberkemampuanuntukmemperbetulkankeadaan yang semakinteruk. Sementaraitu, anakperempuan pula telahmelakukanperbuatan yang dikutukoleh Allah denganbangsaasingsehinggamelahirkananakluarnikah. Jirannyamasihmengatakanbapaitubaikhatiwalaupunpadahakikatnyabapaitumerasasemakinkecewadanmaluatasperilakuburukanak-anaknya.
  • RANGKAP 4:
    Keadaan yang berlakupadabapadananak-anaknyamenyebabkanhubunganmenjadirengangdanterpisah. Si Bapatidaklagidipedulikanolehanak-anaknya. Kini, sibapasemakintuadanuzur. Akhirnya, dia pun menyisihkandirinyadarianak-anaknya yang tidakbermoralitu.
  • PROSA SAJAK
    MEMPROSA SAJAK KAU DAN AKU
    Kauadalahbapa yang inginjadipemurahdanjuakauadalahbapa yang inginmenjadipengasih. Kini, jadilahanakmuseoranganakperkasa yang gagahdanmemilikimatabolanyaapi yang merah. Dan kau pun menjadililin yang melembutkan.
     
    Di dalamrumahmu,anak-anakmulebihbersuaralantangnamunmatamuhanyamampuberkelip-kelipcuma. Walaubagaimanapun, jiranmasihmengatakanbahawakausangatbaikhatidansenanghatimumenerimapujiantersebut. Kini,kau pun semakinterasasunyi.
     
    Anak-anakmumenjadisemakinberanidanmulaiberguru liar padagagak-gagakhitam di rimba.Dan barukausedarkinibahawalangkahmusemakinterbelenggu. Sementaraitu,anakmusimanis pula pulangbersamadengancucumuyang berambutwarnaperang. Sunggguhpunbegitu, jiranmasihmengatakankaumemangbaikhatisedangkanhatimusemakindilandapilu.
    Beginilahlumrahnyaalam, kau pun telahtersisihdarianak-anakmu. Di perlabuhanwaktu,kauberada di sisiku di sepanjanghujungperjalananmudanaku pun terpisah.
    Memprosapuisiberbezadenganmentafsirkanataumemberimaksud. Gantinamadiriperludikekalkan (tidakbolehditukar).
    Contohnyajikapenyajakmenggunakanperkataanaku, kaudan kami, makaperkataantersebutperludikekalkan. Begitujugadengangantinamatempat.
    Tugasmemprosahanyamengubahkanbahasapuisikepadabahasaprosakaranganbiasa.
  • BENTUK SAJAK
    RANGKAP: Pelajarperlumenyatakanberapajumlahrangkapbagisesebuahsajakitu.
    BARIS: Pelajarperlumenyatakanjumlahbarisdalamsaturangkapbesertanamanya. Misalnya: monoton (1 baris), distikon (2 baris), terzina (3 baris) dansebagainya.
    SUKUKATA: Pelajarperlumenyatakansuku kata yang paling pendekdan yang paling panjangbagisesebuahsajakitu.
    RIMA: Rima akhirmerujukkepadahurufterakhirbagisetiapbarisdalamsetiaprangkap. Kemudiandinyatakanmenggunakan format a/b/c/d/e.
    Bentuksajakitumerujukkepadaluaranataufizikalsajaksebelummenyelamikandungansajakitu.
    Perkara yang diberiperhatiandalammenganalisisbentuksajakialahrangkap, baris, suku kata danrima.
  • Sajakinimempunyaiempatrangkap. Rangkapsatumempunyaienambaris (sekstet). Rangkapduamempunyaienambaris (sekstet). Rangkaptigamempunyaisembilanbaris. Rangkapempatmempunyailima baris (quint).
    Jumlahsukukata yang paling pendekialahempatsuku kata. Contohnya, Di/rum/ah/mu/ (R2, B1). Jumlahsukukata yang paling panjangialah lima belassuku kata. Contohnya, kau/a/da/lah/ba/pa/ya/ng/ing/in/ja/di/pe/mu/rah (R1, B1).
    Rima akhirbagirangkapsatuialaha/a/b/c/c/d. Rangkapduaialaha/b/c/d/d/d. Rangkapketigaialaha/b/c/a/d/e/e/a/ddanrangkapkeempatialaha/b/b/b/c.
    Kesimpulannya, sajakinibebasdantidakterpengaruhdaripuisi lama samaadadarisegijumlahbarisdalamserangkap, jumlahsukukatadanrimaakhirnya.
    BENTUK SAJAK “KAU DAN AKU”
  • TEMA
    TEMA:
    Kegagalanseorangbapadalammendidikanak-anak yang tidakberakhlak
    Penjelasannya:
    Seorangbapamerasakesalataskelakuananak-anaknya yang semakinterpesongdantidakbermoral. Demi kasihnyaterhadapanak-anaknya, diasanggupmengalahdanmenurutiapasajakeinginananak-anaknya. Diahanyamampuberdiamdirimelihatkerenahanak-anaknya yang semakin liar itu. Anaklelakitelahmengikutiajaran yang bertentangandengan agama Islam dananakperempuan pula telahmelahirkananakluarnikah. Tatkalakeadaanmenjadisemakinteruk, diatersedarbahawatingkahlakuanak-anaknyatidaklagidapatdiperbetulkan. Hatisibapamenjadipiludanmulaimembawadirinyajauhdarianak-anaknya. Diagagalmendidikanak-anaknyasupayaberkelakuanbaik.
    Temadiperolehimelaluihuraianmaksuddanpersoalan-persoalan yang terdapatdalamsajakitu. Dalamhalini, persoalan yang paling pentingbolehdisimpulkanmenjadisebuahtema.
  • PERSOALAN
    Persoalan yang timbuldalamsajak “kaudanaku” ialah:
    1. Kasihsayang ayah terhadapanak-anaknya
    -Seorangbapa yang sangatmengasihianaknyasehinggasanggupmengalahdanmenurutikemahuananak-anaknya yang nakal.
    2.Kekesalan seorangbapaterhadapanaknya
    -seorangbapamerasakecewaterhadapanak-anaknya yang berkelakuantidakbermoraldantidakberakhlak.
    3. Anakyang tidakmenurut kata danmenyisihkan orang tuanya
    -anak-anak yang telahmulaimelampauibatasansehinggaberanimeninggikansuaradantidakmahumendengarnasihatdari orang tuanya
    Sesebuahsajakselalunyamempunyaisatuataubeberapapersoalan yang cubadiketengahkanolehpenulisnya. Biasanyasaturangkapmengandungisatupersoalan.
    Untukmendapatkanpersoalan, langkahawal yang perludilakukanialahmemberikanmaksudkeseluruhansajak
  • PERUTUSAN
    Antaraperutusan yang dapatdiambildarisajak “kaudanaku”:
    1. Sebagaiketuakeluarga, seorangbapaharusbersikaptegasdalammenanganisoalanak-anaknya. Apabilaanakmelakukansesuatukelakuan yang tidakbaik, bapamestimeneguranaktersebutdanbukanmendiamkandirisahaja.
    2. Ibubapahendaklahmendidikanak-anakmerekadenganbaikdanmengasuhmerekadengannilai-nilaidanakhlak yang mulia.
    3. Seoranganakhendaklahmenurutiperintahdan kata, menerimategurandenganbaikdantidaksekali-kali menderhakakepada orang tuanya. Merekahendaklahmenghormati orang tuanyadanberkelakuanbaikkepadamereka.
    Perutusanjugadikenalisebagaipengajaran.
    Selepasmentafsirmaksudsajak, pelajarperlumencariapakahpengajaran di sebaliksajakitudibuat.
    Perutusansajakitubolehdiambilmelaluisajaksamaada yang bersifatlangsungatautidaklangsung
  • corak
    Elegi - kesedihandankekecewaanbapaterhadapkelakuananak-anak yang melampauibatasandantidakmenghormatibapanyalagi. Contohnya: Di rumah, anak-anaknyamulaimeninggikansuarakepadabapaitudantidakmahumendengarsegalanasihatdanteguran yang diberikanolehbapa. Bapaituhanyamampumemandangkelakuananak-anaknyatanpamembuatapa-apa.
    *ELEGI-Bermaksudsajak yang menekankankepadaratapan, hiba, pilu, duka, sedih, rindu, kesal, kecewa, hampadansebagainyaterhadapsesuatuperistiwamahupunkehidupannya.
    Coraksesebuahsajakdapatdikenalpastisetelahpelajarbenar-benarmembacadanmendalaminyadenganpenghayatan yang baik.
    Biasanyacorakdapatdikesansetelahseseorangdapatmengetahuimaksud, persoalandantema.
    Iajugadihubungkandengan motif ataupengajaransajakitu. Antaracorakdalamsajakialahsatira, ode, epigram, elergidanhimne.
  • NADA
    Kecewadanhampa- memperlihatkanperasaankecewadanhilangharapanseorangbapaterhadapanak-anaknya. Contohnya: Si bapamerasapilukeranaanak-anaknyasemakin liar dananakperempuannyatelahmelakukanperbuatan yang dikutuksehinggamelahirkananakluarnikah. Diatidaklagiberkemampuanuntukmemperbetulkankeadaan yang semakinteruklaludiameninggalkananak-anaknya.
    *Kecewadanhampa – Nada inibiasanyaterdapatdalamsajak yang memperlihatkanperasaanputusasadanhilangharapan. Diksi yang dipilihbernadarendahdanlembutbagimengimbangiemosikecewaatauhampaitu.
    Iadikaitkandengansikapatausemangatpenyajakketikamengungkapkanisidalamsajaknya.
    Antaranada yang selaludigunakanadalahsepertiprotes, kecewadanhampa, semangatdanharapan, simpati, sinisdanromantis
  • ALIRAN
    Realismeiaitunyatamemangterdapatsesetengahanak-anak yang tidaklagimenghormatikepada orang tuanya. Di sampingitu, memangterdapatjugasesetengah orang tua yang gagaldalammendidikanak-anakmereka.
    Didaktisismeiaitumendidikmasyarakatsupayamemberiperhatiankepadaanakdalamsoalmenberikasihsayang. Ibubapaperlutegasterhadapanak-anakmerekasekiranyamerekamelakukansesuatuperbuatan yang tidakbaik.
    *Realisme-Aliraninimengungkapkankehidupansecara real ataubenarseperti yang dapatdilihatdalamkehidupansebenaratauseharian.
    Didaktisme- Aliraninimerujukkepadamaksudmengajar, membimbing, menasihati, mengajakkepadakebaikandanmenjadiperbandinganuntukikutanpembaca.
    Aliranmerujukkepadaseluruh idea yang disampaikandalamsesebuahsajaksecarakeseluruhan. Alirandapatdikesansetelahmemahamimaksudsajak.
    Antaraaliran-aliranituialahrealisme, simbolisme, humanisme, naturalisme, didaktismedanidealisme
  • A. Asonasi- pengulanganhurufvokaldalamsatubaris
    Contohnya: kauadalahbapa yang inginjadipengasih (vokala), kaudi sisiku di hujungperjalananmu (vocal u)
    B. Aliterasi- pengulanganhurufkonsonandalamsatubarisContohnya: Matamumampuberkelip-kelipcuma (konsonan m)
    C. Repitasi- pengulangan kata di mana-mana. Contohnya: Kau, mu, anak-anakmu
    D. Simbolik- kata perlambangan. Contohnya:
    Api( R1 B5): marah, bahayadankejahatan
    Merah (R1 B5):bahayadangarang
    Gagak-gagak (R3 B3): kejahatan
    E. Gandaan- kata yang berganda
    Contohnya:
    Anak-anak (R2 B2)
    Berkelip-kelip (R2 B3)
    Gagak-gagak (R3 B3)
    GAYA BAHASA
    Gaya Bahasamerujukkepadabahasa yang digunakanolehpenyajakdalamsajaknya.
    Antaraaspek-aspek yang perludiperhatikanialahdiksi, frasa, unsurperbandingandanunsurpengulangan
  • SEKIAN, TERIMA KASIH