Media  Umat _ 104
Upcoming SlideShare
Loading in...5
×
 

Media Umat _ 104

on

  • 970 views

Media Umat _ 104

Media Umat _ 104

Statistics

Views

Total Views
970
Views on SlideShare
970
Embed Views
0

Actions

Likes
1
Downloads
38
Comments
0

0 Embeds 0

No embeds

Accessibility

Categories

Upload Details

Uploaded via as Adobe PDF

Usage Rights

© All Rights Reserved

Report content

Flagged as inappropriate Flag as inappropriate
Flag as inappropriate

Select your reason for flagging this presentation as inappropriate.

Cancel
  • Full Name Full Name Comment goes here.
    Are you sure you want to
    Your message goes here
    Processing…
Post Comment
Edit your comment

    Media  Umat _ 104 Media Umat _ 104 Presentation Transcript

    • HargaRp.000,-LuarjawaRp.500,-HargaRp.000,-LuarjawaRp.500,-6767HargaRp.000,-LuarjawaRp.500,-67 Edisi 104, 22 Jumadil Akhir - 6 Rajab 1434 H/ 3 - 16 Mei 2013 MERUSAKMERUSAKMERUSAK A Q I D A HA Q I D A HA Q I D A H SINETRONSINETRONSINETRON Caleg“Indonesia Idol”2014Caleg“Indonesia Idol”2014Caleg“Indonesia Idol”2014 Media NasionalMedia NasionalMedia Nasional Mereka Ingin UmatTakMereka Ingin UmatTak Percaya SyariatPercaya Syariat Mereka Ingin UmatTak Percaya Syariat Wawancara: Iwan JanuarWawancara: Iwan Januar Lajnah Siyasiyah DPP HTILajnah Siyasiyah DPP HTI Wawancara: Iwan Januar Lajnah Siyasiyah DPP HTI Bom Boston, Menyisakan MisteriBom Boston, Menyisakan MisteriBom Boston, Menyisakan Misteri MancanegaraMancanegaraMancanegara Tak Ada Alasan BBM NaikTak Ada Alasan BBM NaikTak Ada Alasan BBM Naik Hukum Royalti BukuHukum Royalti BukuHukum Royalti Buku Ustadz MenjawabUstadz MenjawabUstadz Menjawab FokusFokusFokus www.mediaumat.comwww.mediaumat.comwww.mediaumat.com
    • Salam Media Pembaca2 S a l a m R e d a k s i Assalamu’alaikumwarahmatullahiwabarakatuhu Salam Perjuangan! Alhamdulillah, Allah masih memberikan kenikmatan kepada kita semua sehingga kita bisa menjadi bagian dari perjuangan menegakkan kembali syariah Islam. Sungguh, tidak banyak orang yang diberi kenikmatan sebagai pejuang. Sebaliknya, banyak orang yang menjadi hamba-hamba dunia, terpedaya oleh fatamorgana. Pembaca yang dirahmati Allah, jika kita sadar posisi kita sebagai makhluk ciptaan Allah, tentu kita akan senang melaksanakan ketentuan Allah. Soalnya, pasti aturan Allah itu pas dengan manusia. Allah Maha Mengetahui apa yang manusia butuhkan dan apa yang harus manusia tinggalkan. Dan pasti, aturan Allah akan membuat manusia bahagia di dunia dan akhirat. Sayangnya, banyak orang yang mengingkari aturan Allah ini dengan banyak dalih. Padahal mereka itu mengaku dirinya orang- orang yang beriman. Lantas di mana logikanya? Apakah aturan manusia itu jauh lebih bagus dari aturan Allah? “Apakahhukum Jahiliyahyangmerekakehendaki,dan(hukum)siapakahyanglebih baikdaripada(hukum)Allahbagiorang-orangyangyakin?”(TQSAl Maidah:50) Pembaca yang dirahmati Allah, akibat kita menjauh dari Alquran dan Sunnah, negeri ini kian terpuruk dalam segala bidang. Masalah demi masalah menghinggapi kita dari waktu ke waktu. Keberkahan hidup hanya tinggal impian. Setelah tarif listrik naik pada awal April lalu, kini pemerintah berencana menaikkan harga bahan bakar minyak (BBM). Jelas, kenaikan ini akan memberatkan masyarakat, meski tidak semua jenis kendaraan merasakan kenaikan tersebut.Tapi dapat dipastikan, angka inflasi akan naik. Dampaknya, ya kepada rakyat semuanya, bukan hanya sekelompok pemilik mobil saja. Lalu kenapa pemerintah ngotot menaikkan harga BBM?Tidak adakah cara lain untuk mengatasi apa yang disebut pemerintah sebagai 'kenaikan subsidi'? Masalah ini akan kami kupas di rubrik Fokus. Di Media Utama, kami menyoroti bagaimana bahayanya siaran televisi khususnya acara sinetron bagi umat ini. Memang, acara tersebut kesannya hanya sekadar hiburan, tapi sebenarnya isi di dalamnya sarat dengan pesan-pesan yang bisa merusak akidah. Kalau Anda jeli menonton acara sinetron, belakangan banyak sinetron berlatar belakang kehidupan Islam, mulai dari pesantren, sekolah, sampai rumah tangga.Tapi, apa yang digambarkan, banyak hal-hal yang menyimpang. Apa saja? Apakah para produser sinetron ini sengaja membuat tontonan seperti itu dengan maksud tertentu? Mengapa pemerintah diam saja? Ada pengalaman menarik ketika kami meminta tanggapan MenkominfoTifatul Sembiring soal sinetron ini. Ia langsung merespon sms yang kami kirimkan dengan menelopon balik dalam waktu 1,5 jam kemudian. Ini di luar dugaan kami sebelumnya. Isinya? Silakan Anda baca di rubrik Media Utama dan Aspirasi. Pembaca yang dirahmati Allah, di rubrik lain Anda tetap akan mendapatkan suguhan kami yang uptodate, menarik, dan berisi. Semoga sajian kami ini senantiasa menambah cakrawala berpikir Anda. Akhirnya, kami sampaikan selamat membaca! Sebarkan pengetahuan Anda—dan juga media ini—kepada saudara-saudara kita yang lain! Semoga Allah melimpahkan pahala. Aamiin. Wassalamu’alaikumwarahmatullahiwabarakatuhu Penerbit: Pusat Kajian Islam dan Peradaban. Dewan Penasihat : KH Ma'ruf Amien, KH Nazri Adlani, KH Amrullah Ahmad, KH Syukron Makmun, KH Muhammad Arifin Ilham , KH Athian Ali M Dai, AchmadMichdanSH,HAzwir,KHdrMuhammadUtsman, HHariMoekti,UstadzAbuBakarBaa'syir,AGHSanusiBaco,Lc,KHDRMiftahFaridl,DraHjNurdiatiAkmaM.Si,DraHjNurniAkma,ProfDrIr Zoer’aini Djamal Irwan MS, KH Husin Naparin, Lc, MA. Penasihat Hukum: Achmad Michdan SH. Pemimpin Umum/Pemimpin Redaksi: Farid Wadjdi. Pemimpin Perusahaan: Anwar Iman. SidangRedaksi:HafidzAbdurrahman,MRKurnia,HaristAbuUlya,MuhammadIsmailYusanto,RochmatS.Labib.RedakturPelaksana:Mujiyanto.Redaksi:Walmaroky,Zulkifli,JokoPrasetyo,Iwan Setiawan, Zulia Ilmawati, NanikWijayati, Febrianti Abbasuni, Kholda. Kontributor Daerah: Rifan (Jatim), Fakhruddin (Babel), Apri Siswanto (Riau), Rikhwan Hadi (Sumbar), Kurdiyono & Ahmad Sudrajat (DIY), Eko (Sultra), Nazar Ali& Handani (Jabar), BahrulUlum (Sulsel), Abduh(Kalsel), Budianto Haris (Sumsel), Dani Umbara Lubis (Sumut), Dadan Hudaya (Banten) Desain dan Pracetak: KholidMawardi.Keuangan:BudiDarmawan.Marketing:MuhammadIhsan.Sirkulasi: WWahyudi.Iklan:ArisRudito,MRosyidAziz.AlamatRedaksi:Jl.Prof.SoepomoNo.231,JakartaSelatan 12790. Email: pembaca.tabloidmu@gmail.com. Iklan Pemasaran: Jl. Prof. Soepomo No. 231, Jakarta Selatan 12790. Email Iklan: iklan.tabloidmu@gmail.com . Email Marketing: marketing.tabloidmu@gmail.comHuntingPemasaran:085711044000,sms:089650202478. HuntingIklan: 085780137043.Rekening:BankMuamalatNoRek9064150699a.nBudiDarmawan. www.mediaumat.comwww.mediaumat.comwww.mediaumat.com J E L A J A H I SMS Redaksi: 081288020261. Sertakan Nama dan Asal SMS Media Pembaca/Komentar untuk MU: 08998206844. Sertakan Nama dan Asal daerah. SMS Berlangganan: 0857 8013 7043 Media Umat | Edisi 104, 22 Jumadil Akhir - 6 Rajab 1434 H/ 3 - 16 Mei 2013 DPP HizbutTahrir Indonesia (HTI) berkunjung ke Kantor Media Grup dalam rangka silaturahmiDPP HizbutTahrir Indonesia (HTI) berkunjung ke Kantor Media Grup dalam rangka silaturahmi bersama pimpinan Media Indonesia dan MetroTV, Senin (29/4) Kedoya, Kebon Jeruk, Jakarta.bersama pimpinan Media Indonesia dan MetroTV, Senin (29/4) Kedoya, Kebon Jeruk, Jakarta. DPP HizbutTahrir Indonesia (HTI) berkunjung ke Kantor Media Grup dalam rangka silaturahmi bersama pimpinan Media Indonesia dan MetroTV, Senin (29/4) Kedoya, Kebon Jeruk, Jakarta. M e d i a Pe m b a c a Demokrasi Cacat Demokrasi membuat negara cacat dan masyarakatnya juga cacat, karena menjadikan hukum buatan tangan manusia yang diterapkan dalam kehidupan. Demokrasi menghancurkan umat Muslim di dunia. Untung saya berada dalam dakwah pembebasan sistem kapitalis dan tahu busuk dari sistem demokrasi. Insya Allah perjuangan saya dalam dakwah ini tetap terus tegar dan istiqamah untuk "Perubahan besar dunia menuju Khilafah". Allah swt berfirman: "Kemudian kami jadikan kamu berada diatas suatu syariat (peraturan) dari urusan (Agama) itu, maka ikutilah syariat itu dan janganlah kamu ikuti hawa nafsu orang-orang yang tidak mengetahui (QS. Al-Jaatsiyah : 18) Demokrasilah hukum yang mengikuti hawa nafsu manusia. Sebagai manusia kita harus berjuang untuk menegakkan hukum Allah di muka bumi ini yaitu syariah dan khilafah. Wallah a'lam bi ash-shawab. Maria Ulfa. Ternate-Maluku Utara. +6285712079xxx Perbedaan Demokrasi Perbedaan antara demokrasi dan khilafah; demokrasi bersumber dari kafir Barat. Khilafah bersumber dari Allah. Demokrasi belum 1 abad sudah diambang kehancuran dan jutaan kasus kriminal diadili, khilafah tegak selama 14 abad hanya sekitar 200 kasus yang diadili. Demokrasi menciptakan jutaan orang miskin bahkan orang kaya pun ikut-ikutan antri raskin. Khilafah menyejahterakan bahkan hampir tidak ada orang yang mau menerima zakat. Demokrasi itu crazy, khilafah itu perfect. Pilihan di tangan anda, mau hadap sengsara atau sejahtera. mau jadi pendukung, pemain, atau penonton. Muslimin al-Fatih. Sangatta-Kutai Timur. +6281355495xxx Tiada Kemuliaan Assalamualaikum. Wahai saudara seakidah, tiada kemuliaan tanpa Islam, karena Islam agama yang sempurna. Insya Allah Islam yang kita rindukan akan ditegakkan ditengah-tengah kita. Semoga tangan- tangan kita syabab di Indonesia kelak juga ikut bersaksi di hadapan Allah SWT atas ikhtiar kita. So do the best for Islam. Zahra. Magelang. +6287834167xxx Aturan yang Benar Assalamu'alaikum. Umat Islam paham dan tahu bahwa aturan hidup yang tepat dan benar adalah dari Allah dan Rasul-Nya yaitu Alquran dan hadits. Akan tetapi mengapa mereka enggan untuk melaksanakan atau menjadikan aturan tersebut menjadi aturan universal kehidupan? Dan kita jika tahu bahwa aturan manusia adalah banyak yang salah dan selalu menimbulkan permasalahan yang rumit dan bertambah kacau. Buktinya di negeri kita ini, walaupun presiden ganti sampai hari kiamat pun, tapi sistemnya tak diubah dengan aturan Allah yaitu sistem khilafah ala minhajin nubuwwah, negeri ini tetap menjadi negeri yang bobrok yang penuh dengan penyakit yang ganas dan menjijikkan. Oleh karena itu wahai saudaraku seiman dan seislam sambutlah dengan semangat jihad untuk gigih memperjuangkan khilafah tegak di bumi Allah SWT. Agar Allah menurunkan berkahnya dari langit. Samsul. Mojokerto. +6285748396xxx BhinnekaTunggal Ika Di manakah bhineka tunggal ika?? Hal ini patut dipertanyakan. Karena dengan konsep bhineka tunggal ika negeri kita itu menganggap bahwa meski Indonesia terdiri dari berbagai suku, agama dan budaya, namun, mereka tetap bisa bersatu. Akan tetapi faktanya kita bisa melihat dengan meningkatnya konflik sosial yang ada di masyarakat baik konflik yang bersifat individual maupun kelompok. Dengan kondisi ini kita bisa menilai bahwa konsep bhineka tunggal ika telah gagal menyatukan masyarakat Indonesia. Sebenarnya kalau kita mau membuka mata hati dan pikiran kita ada satu ikatan yang mampu menyatukan tidak hanya masyarakat Indonesia bahkan masyarakat dunia yaitu ikatan akidah Islam.
    • Editorial 3 arut marut negeri ini sungguh menyesakkan dada kita. Sungguh sulit diterima nalar, bagaimana Kseorang bocah kecil yang berusia 8 tahun – kalau kemudian memang terbukti benar—tega membunuh teman sepermainannya sendiri, yang usianya baru 6 tahun. Sampai sekarang polisi belum bisa memastikan apa motif sebenarnya tersangka pelaku. Diduga karena korban memiliki utangseriburupiahkepadapelaku.Bagaimanamungkinanaksekecilitusudahmenjadipembunuh? Maraknyapencabulan,pemerkosaan,sampaipembunuhansangatmengkhawatirkankita. Pelakunyapun tak jarang masih berusia sangat muda. Seperti yang terjadi di Gowa Sulawesi Selatan, lima orang siswa SD memerkosatemannyasendiri,akibatkecanduannontonfilmporno. Marakhyapulapencabulanyangdilakukan justru oleh ayah sendiri yang seharusnya menjadi pelindung, atau oleh guru sendiri yang seharusnya menjadi teladan. Kita juga bersedih melihat lima orang siswa SMA 2 Tolitoli mempermainkan shalat, seperti yang kita saksikan dalam laman Youtube. Apakah begitu buramnya kondisi pendidikan kita, sehingga mereka tega mempermainkanibadahsuciumatIslam? Kita juga sulit mencari prestasi dari negara ini yang bisa kita banggakan. Hampir semua perkara, negara tidak becus mengurusnya. Mengurus Ujian Negara (UN), yang sudah puluhan tahun dilakukan, tidak becus. Banjir dan kemacetan, seolah menjadi masalah yang tidak bisa diselesaikan, terus terjadi dan berulang. Harga- hargapunseringkalisulitdikontrolsepertibawangdandaging. Masalahkorupsipunmembuatkitamiris.Meskipunsudahbanyakkoruptor yangditangkap,dihukumdan dipenjarakan, namun masih saja koruptor-koruptor baru bermunculan. Saat media marak membicarakan korupsi proyek pembangunan pusat sarana olahraga nasional Hambalang, Bogor, KPK menangkap ketua DPRD Bogor,IyusJuhersebagaitersangkakasuspembangunanmakamyangjugaadadiBogor. Sulitnyamemberantaskorupsiinisampai-sampaiPresidenSBYmengungkapkanrasafrustasi,kejengkelan, dan kegeramannya. Di depan peserta dialog Forum Pasar Global di Singapura (23/4), Presiden SBY menyatakan betapasulitnyamemberantaskorupsidiIndonesia. Tidak hanya itu, pemerintah pun kembali dengan teganya menyusahkan rakyatnya sendiri. Pemerintah bersikukuh untuk menaikkan harga BBM. Apapun ceritanya, pengalaman menunjukkan kenaikan BBM pasti akanmenambahbebanhidupmasyarakat. Menurut pengamat ekonomi Komite Ekonomi Nasional (KEN) Nina Septi Triaswati, dengan menaikkan harga BBM menjadi Rp 6.500 per liter per Mei 2013, pemerintah hanya akan menghemat Rp 16 trilyun hingga akhir tahun. Sementara sebenarnya masih banyak cara lain untuk mendapatkan Rp 16 trilyun itu, tanpa menaikkanBBMyangsudahdidugakuatakanmemberikandampakyangmenyulitkanmasyarakat. UntukmendapatkanRp16trilyun,kenapatidakdihematdaribelanjabirokrasidiAPBN2013yangbesarnya mencapai Rp 400,3 trilyun. Kenapa pula pemerintah selalu menjadikan rakyat sebagai tumbal kebijakannya? Padahal di sisi lain kita akan punya pendapatan yang sangat besar hingga ratusan trilyun kalau kekayaan alam berupa tambang-tambang yang dikuasai asing itu diambil alih, dikembalikan sebagai pemilikan rakyat, yang dikelola oleh negara dengan baik, dan hasilnya untuk kepentingan rakyat. Lagi-lagi kenapa selalu rakyat yang dijadikantumbal? Kita kembali tegaskan inilah potret negara demokrasi yang kita anut. Semua karut marut yang kita hadapi sekarang pangkalnya adalah sistem demokrasi. Demokrasi, bukan hanya sistem kufur, namun juga telah melahirkan berbagai banyak persoalan. Demokrasi, telah melahirkan sistem politik transaksional, yang menumbuhsuburkankorupsidankolusi. Liberalisme (kebebasan) yang menjadi nilai penting dari sistem demokrasi telah benar-benar merusak. Kebebasan bertingkah laku, memarakkan kemaksiatan dan kejahatan seksual. Kebebasan pemilikan telah melahirkan sistem ekonomi kapitalisme yang rakus. Ekonomi yang memiskinkan rakyat dan memberikan jalan pada negara-negara imperialis untuk merampok kekayaan alam kita. Perlu kembali kita garis bawahi, semua ini merupakanpenyakitbawaandarisistemdemokrasi.Bukanpenyimpangandarisistemdemokrasi. Maka, demokrasi tak perlu diluruskan karena sistem ini telah sakit sejak lahir dan mengandung dan memproduksivirusberbahayadaritubuhnyasendiri.Yangharuskitalakukanadalahmencampakkandemokrasi ketongsampahperadaban. Tidak berhenti di sana, kita menggantikannya dengan sistem yang dijamin kebenarannya karena berasal dari Allah SWT, yaitu sistem Islam. Sistem inilah yang akan menerapkan syariah Islam secara menyeluruh, denganKhilafahsebagaiinstitusinegaranya. Siapapun yang berpikir sehat, apalagi didasarkan kepada akidah Islam, akan menyimpulkan, kita tidak butuh sistem demokrasi yang kufur dan merusak ini! Yang kita butuhkan adalah sistem Khilafah yang akan menerapkan syariah Islam. Dengan itu kita akan mendapatkan keridhaan Allah SWT, kebaikan di dunia maupun diakhirat.[]faridwadjdi K o m e n t a r u n t u k M U Siapa ButuhSiapa Butuh Negara Demokrasi ?Negara Demokrasi ? Siapa Butuh Negara Demokrasi ? Media Umat | Edisi 104, 22 Jumadil Akhir - 6 Rajab 1434 H/ 3 - 16 Mei 2013 Rubrik tentang Mahasiswa Assalamualaikum. Semoga MU semakin jeger, mau usul, gimana kalo MU, membuat artikel tentang dunia kampus, atau lebih bagus kalau HT membuat majalah untuk mahasiswa, sebagai bahan dakwah untuk mahasiswa, pengusaha udah ada, remaja sudah ada, mahasiswa? Syukron. Mursalin. Riau. +6285376920xxx Keterangan Lengkap Assalamu'alaikum. Subhanallah penjelasan yang dimuat di dalam MU sangat lugas dan revolutif, sehingga membuat para pembaca bersemangat untuk membaca. Saya memberi saran sedikit agar setiap sumber atau kutipan disertakan dengan keterangan lengkap, contoh: pada bagian editorial, edisi 101 "Dua Tahun Revolusi Suriah", kitab Ishabah karya al asqalani yang lengkapnya adalah Al Ishabah fi Tamyiz ash Shahabah. Husein. Pekanbaru-Riau. +6282392163xxx Profil Amir HT Assalamualaikum. Kalau bisa MU juga muat profi-profil amir dan syabab Hizbut Tahrir yang tengah berjuang menegakan khilafah, supaya bisa jadi contoh bagi para pejuang khilafah Islam yang lain. Abu Ammar. Bukittinggi. +6285664000xxx Terima Kasih MU Assalamualaikum. Pertama saya ucapkan kepada MU yang telah banyak membantu saya, keluarga saya, dan teman-teman saya. Yang tadinya tidak tahu khilafah sekarang jadi tahu. Dan apa itu demokrasi, demokrasi hanya menyengsarakan rakyat. Sekali lagi terima kasih buat MU. Karenamu aku jadi tahu, teruskan perjuangkan agama Allah. Aku mendukungmu. Allahu Akbar. Acep Ali. Singaparna-Tasikmalaya. +6282317508xxx Wassalamualaikum wr wb. Alhamdulillah, terima kasih atas saran dan masukan para pembaca semua. Semoga kami bisa memberikan yang terbaik kepada Anda. Beberapa usulan tambahan rubrik, tampaknya sulit karena keterbatasan ruang. Tapi tetap akan tampilkan tentang aktivitas kampus secara temporal. Profil singkat Amir HT sudah kami tampilkan edisi lalu. Redaksi. Ketika ikatan akidah ini telah terpatri dalam diri masyarakat tidak hanya konflik sosial yang dapat teratasi juga masalah lain yang sedang melanda seperti kemiskinan, korupsi dan kriminal sebab ketika masyarakat sudah menanamkan ikatan akidah pasti mereka punya satu tujuan yang sama yaitu mendirikan daulah Islam yang nyata. Ummu Ghozy. Magelang. +6285725914xxx Bertentangan dengan Islam Demokrasi bertentangan dengan Islam. Inti dari demokrasi adalah kedaulatan rakyat, menyerahkan hak membuat hukum kepada manusia. Sedangkan dalam Islam yang berhak membuat hukum hanyalah Allah, selain itu demokrasi adalah salah satu bentuk kesyirikan karena menjadikan manusia sebagai tandingan bagi Allah. Wahai saudaraku umat Islam layakkah kita menjadi pemuja demokrasi? Safar Abu Anam. Aceh. +6281260713xxx Hukum Sekuler Dalam sistem kapitalis yang jelas akidahnya adalah sekuler, maka seluruh kehidupan umat akan diatur dengan hukum- hukum yang sekuler. Hukum-hukum yang meniadakan campur tangan Allah dalam kehidupan. Lingkup pendidikan yang notabene sebagai wadah untuk mencetak generasi juga tak luput dari tatanan kurikulum yang sekuler. Akhirnya banyak sekali pemahaman-pemahaman yang bertentangan dengan Islam. Sebagai contoh kecil saja teori evolusi Darwin, manusia purba dan pendapat orang-orang atheis dicekokkan kepada para siswa untuk menerima mentah- mentah pemahaman tersebut yang akhirnya membekas di benak pelajar, dan menjadikan mereka sedikit ragu akan keimanannya pada Allah bahwa manusia diciptakan oleh Allah. Dari situ saja, sebenarnya jka kita mau dengan ikhlas membuka mata, dan hati akan sangat terlihat jelas bagaimana upaya kaum kafir menghancurkan akidat umat. Sungguh tak kan kita dapatkan pemurnian akidah yang semurni-murninya kecuali dalam sistem yang menjamin kemurnian ketaatan kepada Allah. Itulah khilafah ala minhaj an- nubuwwah. Aruum-Tuban. +6285731299xxx
    • 4 Media Utama Islam disodok lewat sinetron-sinetron konyol dan bodor, tapi negara mendiamkannya. Kok bisa? S etiap hari pemirsa televisi di Indonesia di- suguhi tontonan sine- tron. Bukannya sine- tron yang membuat orang tambah pintar, tapi justru tambah bodoh alias blo'on. Bagai- mana tidak, sinetron-sinetron itu jauh dari realitas sosial, meng- awang-awangtakkaruan. Anehnya, yang kini banyak tayangdanmendapatratingting- gi itu adalah sinetron-sinetron yang digambarkan berlatar bela- kang kehidupan umat Islam. Mulai pribadi Muslim, keluarga Muslim, dan komunitas Muslim (pesantren). Tapi bukannya keba- ikan yang ditonjolkan, sebaliknya adalah karakter buruk para to- kohnya. Lihat saja sinetron Ustad Fotocopy, Islam KTP, Haji Medit (SCTV), Tukang Bubur Naik Haji (RCTI), Berkah (RCTI) dan Oesman 77 (Trans TV). Sinetron-sinetron tersebutmemperolehratingyang tinggi. Lama kelamaan muncul ke- san ada unsur kesengajaan untuk melecehkan simbol-simbol Islam. Bagaimanadigambarkanseorang haji yang tidak mencerminkan sama sekali sikapnya sebagai seorang haji. Juga seorang us- tadzah juga yang digambarkan sangat narsis. Ada pula santri se- buah pesantren yang digam- barkan sangat gaul dan dengan mudahnyapacaran. Pantas saja, penggambaran yang buruk simbol-simbol Islam itu menuai protes masyarakat. Mereka mendesak pemerintah menghentikan tayangan-ta- yanganyangtidakmendidikini. Di luar itu, banyak tayangan televisi —termasuk sebagian sinetron— yang membahayakan akidah umat. Tayangan itu meng- gambarkan ketakhayulan dan juga klenik-klenik. Bagaimana tokoh-tokohnya sakti mandra- gunaakibatbantuan'jimat'dalam berbagai bentuknya. Juga ada tayangan yang mengeksploitasi 'dunia lain' sehingga membuat pemirsanya takut terhadap setan, dan jin—sikap yang dilarang oleh agama. Bisnis Besar Di balik sinetron-sinetron berating tinggi itu ternyata ada bisnis besar. Para kapitalis pemilik televisi diuntungkan sangatbesar dengan keberadaan sinetron ter- sebut. Dengan sinetron yang ratingnya tinggi maka pemasang iklan akan berbondong-bondong memasang iklan, kendati harga iklanselangit. Bagi stasiun televisi itu sen- diri, tayangan sinetron tak me- merlukan banyak kerja. Tak perlu susah-susah menyiapkan sumber daya manusia dan peralatan yang mahal. Penggarapannya dilaku- kan oleh pihak lain, dalam hal ini rumah produksi. Begitu sinetron sudah jadi, stasiun televisi tinggal menayangkannya. Di sinilah terjadi simbiosis mutualisma (kerja sama saling menguntungkan) antara stasiun televisi dan rumah produksi. Tujuan kerja sama ini semata- mata hanya urusan untung, bis- nis, dan uang. Sama sekali bukan masalahedukasiataulainnya. Maka wajar jika banyak sinetron yang secara muatannya sebenarnya sangat tidak bermutu tapi mendapat tempat yang baik di stasiun televisi. Bagi stasiun televisi, mutu tidak penting. Yang penting, duit mengalir melalui iklan. Dan itu sangat mungkin dilakukan dengan merekayasa rating. Sangat berat membuat sinetron yang bermutu di tengah tuntutan tayangan yang bersifat harian.Yangpalingmudahadalah memproduksi sinetron konyol dan bodor tapi menghibur. Inilah yangterjadisaatini. Bagi rumah produksi, ta- yangan sinetron ini merupakan ladang mencari penghasilan. De- mikian pula bagi aktor dan aktris, menjadi pekerja sinetron adalah sebuah kebanggaan karena penghasilan yang menggiurkan. Puluhan juta bisa mereka dapat- kandarisatuepisodesinetron. Walhasil, sinetron-sinetron tersebut adalah lahan bisnis ba- nyak kalangan. Satu sama lain saling menopang dan bergan- tung. Pantas jika dunia pertele- visian menjadi lahan basah untuk mengerukpendapatan. Negara tak Berdaya Ditengahserbuantayangan sinetron di televisi, sayangnya perannegarasangatminim,kalau tidak dibilang tidak ada. Peme- rintah seolah berlepas tangan terhadap dampak penayangan sinetron tersebut bagi masyara- kat. Menteri Komunikasi dan Informasi Tifatul Sembiring, me- ngaku dirinya tak punya kewe- nangan untuk menghentikan tayangan di televisi, kendati ia sendiri sangat tahu, banyak sine- tron dan tayangan televisi yang merusakakidahkaumMuslim. Ini gara-gara ada UU No 32 tahun 2002 tentang Penyiaran, yang mengubah kewenangan mengontrol konten siaran televisi dan radio itu ke Komisi Penyiaran Indonesia (KPI). KPI ini dipilih oleh wakil rakyat, sebagai kepanjang- an tangan rakyat dalam mengon- trol televisi. Pemerintah merasa tak perlu cawe-cawe (ikut cam- pur)karenasudahadaKPI. Sementara itu KPI sendiri merasa kewenangan yang ada padanya juga dikebiri. KPI tidak bisa mencabut izin siaran stasiun televisi yang melanggar aturan. Soalnya, keberadaan izin itu jus- truadadipemerintah. Walhasil, KPI paling-paling hanya menyampaikan teguran dari mulai teguran satu, dua, dan tiga. Setelah itu memang ada pencabutan izin, tapi prosesnya membutuhkan waktu yang sa- ngat panjang dan harus melibat- kanpemerintah. Nah kalau sudah begini, siapa sebenarnya yang mengon- trol dan mengendalikan program pertelevisian di Indonesia? Masak rakyat setiap saat harus bertindak sendiri? Inilah negara liberal, di mana peran negara dikurangi, bahkan hilang sama sekali dalam halini. Pandangan Islam Islam memiliki seperangkat kebijakan yang jelas tentang per- televisian ini. Ada departemen yang menangani masalah ini yak- nidepartemenpenerangan. Kebijakan pertelevisian di- rancang untuk mewujudkan tiga hal; (1) membangun masyarakat Islam yang kokoh dan kuat, (2) melenyapkan unsur-unsur yang bisa menghancurkan sendi-sendi masyarakat Islam, serta (3) me- nonjolkan kebaikan dan keluhur- anIslam. Itukebijakankedalam. Sementara kebijakan ke luar negeri, ditujukan untuk mene- rangkan Islam, baik dalam keada- an damai maupun perang, de- ngan penerangan yang menam- pakkan keagungan dan keadilan Islam; kekuatan Daulah Islamiyah, baik militer, ekonomi, serta per- adabannya; serta menerangkan kerusakan sistem selain Islam, kedzaliman dan kerusakannya, serta kelemahan negara-negara kafir, baik militer, ekonomi, dan peradabannya. Maka program siaran tele- visi, dilarang menayangkan hal- hal yang diharamkan oleh Islam. Demikian pula program-program siaran yang mengandung unsur- unsuryangbertentangandengan akidah dan syariah, dibekukan dan dilarang seketika, tanpa menunggu-nunggu waktu lagi. Larangan ini pun ditujukan kepada program-program yang menjajakan pemikiran-pemikiran kufur, seperti demokrasi, libe- ralisme, pluralisme, nasionalisme, danlainsebagainya. Apakah kita tidak ingin semuaituterwujud?[]mujiyanto Media Umat | Edisi 104, 22 Jumadil Akhir - 6 Rajab 1434 H/ 3 - 16 Mei 2013 Sinetron Berbahaya,Sinetron Berbahaya, Negara tak BerdayaNegara tak Berdaya Sinetron Berbahaya, Negara tak Berdaya
    • Stop Sinetron Tak Layak Tonton Sinetron yang tak layak tonton bertebaran di berbagai stasiun televisi, selain tidak mendidik sinetron-sinetron tersebut berpotensi untuk merusak akidah dan akhlak penontonnya terutama remaja dan anak-anak. J amal, Halimah dan Mak- mur mendadak 'tobat'. Ketiga tokoh antagonis (penentang/jahat) dalam sinetron Ustad Fotocopy (SCTV) tersebutselalunaikpitam, bila warga Kelurahan Manis Asem tidak memanggilnya dengan julukanyangberbauIslam. Jamal misalnya, sumpah serapah akan meluncur bertubi- tubi dari mulut tokoh yang di- perankan Qubil AJ tersebut, bila warga tidak memanggilnya de- ngan sebutan Haji Jamal, HajiTiga Kali. Dalam sekali tayang bisa lebih dari lima adegan ia men- campur asma Allah dengan caci maki yang menghina orang yang lupa menyebutnya Haji Tiga Kali. Namun kini ia malah menolak dipanggil haji. “Panggil Cang Jamalaje,”ujarnya. Begitu juga dengan Hali- mah (Ranti Purnamasari).“Panggil aje gue Mpok Halimeh,” ujar pe- rempuan kerap kali marah dan menghina lawan mainnya bila tidak dipanggil dengan sebutan UstadzahHajaaah... Haaalimaah. Sedangkan Makmur (Julian Kunto) yang selalu mengaku sebagai “Ustadz yang dimuliakan Allah” dan meminta warga yang berpapasan di jalan agar men- ciumtangannya.Kinitidaklagi. Entah sudah diskenariokan sejak awal atau tidak, tetapi yang jelas episode 'tobat' tersebut tayang beberapa hari setelah warga yang diwakili Masyarakat TV Sehat Indonesia pada Senin (15/4) memprotes sinetron yang dianggap melecehkan simbol- simbol Islam itu ke Komisi Pe- nyiaranIndonesia(KPI). Bukan kali ini saja SCTV menayangkan sinetron yang me- lecehkan simbol Islam. Sebelum- nya, televisi tersebut, menayang- kan sinetron Islam KTP yang men- jadikan Madit (Qubil AJ) sebagai tokoh antagonis yang kerap ma- rah dan bersumpah serapah de- ngannamaAllah. Hingga akhirnya, KPI pun memberikan sanksi penundaan tayang Islam KTP.Tidak kehabisan akal, SCTV pun meluncurkan Ustad Fotocopy. Setelah Ustad Fotocopy tayang lebih dari dua ratus kali, namun KPI tidak juga menegur, maka salah satu stasiun televisi yang kerap menggelar konser musik ini menayangkan sinetron yang juga melecehkan simbolIslamyakniHajiMedit. Tokoh antagonis yang sa- ngat pelit ini diperankan pula oleh Qubil AJ. Namun baru saja beberapa kali tayang, langsung diproteswargadanHajiMeditpun olehKPI'di-IslamKTP-kan'. B er barengan dengan mengadukan kedua sinetron yang diperankan Qubil AJ terse- but, Masyarakat TV Sehat juga mengadukan sinetron Tukang Bubur Naik Haji (RCTI), Berkah (RCTI)danOesman77(TransTV). Koordinator Masyarakat TV Sehat Ardy Purnawan Sani me- nyatakan,sinetron-sinetronterse- but banyak menggunakan judul terminologi Islam, akan tetapi pesanyangdisampaikannyatidak mencerminkan nilai-nilai Islam. Selain itu, tayangannya juga di- nilai meresahkan masyarakat karena mendiskreditkan dan mendistorsiajaranIslam. Merusak Akidah Menurut Menteri Komuni- kasi dan Informatika Tifatul Sem- biring, keberatan masyarakat bukan pada sinetron di atas saja. “Banyak sinetron lain yang meru- sak bahkan mengganggu akidah. Model-model sihir begitu, mayat terbang, alam ghaib, itu semua menggangguitu!”tegasnyakepa- daMediaUmat. Sinetron dimaksud di anta- ranya Kian Santang (MNC TV) yang kerap menampilkan sihir serta siluman maung bodas, silu- man munding bodas dan tokoh- tokoh siluman lainnya, Oh Ter- nyata (Trans TV) menampilkan berbagaimacambentukhantu. Di RCTI ada Magic. Sinetron ini mengisahkan tiga anak SMA yang memiliki kemampuan sihir, seperti menggerakan benda- benda tanpa sentuhan fisik, me- reka pun mampu memindahkan bendadengantatapanmata. Sedangkan di Indosiar ada Tebe dan Kakak Cantik. Bila dulu di RCTI ada sinetron Jinny oh Jinny yang mengisahkan persahabatan antara jin cantik yang keluar dari lampu ajaib dengan seorang re- maja laki-laki, sekarang di Indo- siar mengisahkan jin cantik yang keluar dari cincin ajaib yang ber- sahabat dengan Tebe (Tubagus Indra) seorang anak kecil yang rajinbershalawat.Jin ini kerapkali membantu Tebe baik diminta ataupuntidak. Sebuah serial yang diper- untukkan bagi penonton anak- anak ini jelas berbahaya bagi per- kembangan pemahaman anak terhadap haramnya manusia ber- interaksi dengan jin apalagi me- mintatolongdenganjin. Oleh karena itu, Menteri Tifatul yang merasa tidak berwe- nang untuk menghentikan se- mua tayangan itu meminta agar NU, Muhammadiyah dan MUI mendesak KPI dan stasiun televisi menghentikan tayangan yang merusak akidah itu. “Jangan diam saja dong. Inikan sudah merusak akidah!”tegasnya. Merusak Akhlak Di negeri yang mayoritas penduduknya Muslim ini, ta- yangan televisi yang seharusnya mendidik masyarakat agar ber- akhlak mulia, malah dirusak de- ngan berbagai sinetron yang terkesan mengajari pergaulan bebas kepada penontonnya ter- utama pada ababil alias anak baru gede(remaja)yangmasihlabil. SCTV misalnya, selain setiap hari menayangkan beberapa sinetron lepas (FTV) yang tema sentralnya adalah pe-de-ka-te dan pacaran tersebut, menayangkan pula sinetron yang juga meng- inspirasi para ABG labil untuk menirunya. Sebut saja Love in Paris. Sinetron yang merupakan siaran ulang tahun lalu ini memang ingin menceritakan dua tokoh yang memiliki penyakit parah namun bisa bertahan hidup lan- taran masih adanya harapan dan cinta. Namun sayang, rambu- rambu pergaulan dalam Islam dilanggar semua, adegan khal- wat, berpelukan, berciuman dan mempertontonkan aurat hingga sampai ke paha kerap kali dita- yangkan. Filminijelassangatmerusak akhlak dan tidak mendidik lan- taran semua tokoh dalam sine- tron tersebut ceritanya beragama Islam. Namun tidak ada satu adegan pun yang menyatakan bahwaberduaan,berpelukandan sekamar dengan pacar adalah haram. Sedangkan di Indosiar ada sinetron Bukan Mawar tetapi Melati. Selain masalah percintaan, sinetron ini juga menonjol dalam aksitipumuslihat,ambisius,intrik, provokasi untuk menguasai harta yangbukanhaknya. Di RCTI ada Yang Muda Yang Bercinta. Meski sinetron ini ber- latar belakang sekolah SMA dan tokoh utamanya berseragam pu- tih abu-abu. Namun yangdibahas bukanlah bagaimana suka duka dalam belajar atau bersaing da- lam meraih nilai ujian terbesar. Tapi... sesuai dengan judulnya, sinetron ini malah menceritakan suka duga dan perjuangan anak SMAagardapatpacaran. Pengamat Sosial Iwan Janu- ar mengatakan sinetron-sinetron yangbertemakanpacaranituber- bahaya bagi penonton terutama yang ababil alias ABG labil. “Ya mereka akan langsung copy paste apa yang muncul di televisi dalam kehidupan sehari-hari, termasuk dalam hal pacaran. Akhirnya ada kesan kalau remaja gak pacaran ya bukan remaja namanya,”tegas- nya.[]jokoprasetyo Media Umat | Edisi 104, 22 Jumadil Akhir - 6 Rajab 1434 H/ 3 - 16 Mei 2013 S inetron anak dan remaja di TV banyak adegan ciuman. Begitu juga film kartun, banyak mengekspos pornografi. Contoh saja, kartun Popeye dan belum lagi lainnya yang lebih parah. Sebetulnya anak belum bisa membedakan bahaya atau tidak. Jadi, belum bisa mengambil keputusan begitu, juga dia belum bisa membuat perencanaan ke depan akan jadi apa. Dia juga belum bisa mengontrol emosinya. Karena di usia itu, dengan pendidikan dan pelatihan yang baik baru berkembangdiatasusia15tahun. Anak yang kena pornografi, perasaannya akan kacau balau. Orangtua pun nggak mengerti jika anaknya tiba-tiba suka marah-marah dan uring-uringan. Setidaknya prosesnya begitu. Ada hormon-hormon kenikmatan yang keluar dan berbagai hormon lainnya berlebihan mengeluarkannya, karena si anak harus berkonsentrasi merasakan kenikmatan yang dirasakannya. Maka, dengan sendirinya otak anak akan menciut. Kalau sudah begitu, apa lagi yang bisa diharapkan anak dari masa depannya. Sifat kemanusiaanya rusak dan bisa-bisa perilakunya berubah jadisepertibinatang. Ada empat langkah yang bisa dilakukan untuk menormalkan otak anak. Pertama, anak itu sadar jika dia kena adiksi (kecanduan). Kedua, dia mau keluar dari kecanduan itu dan harus ada dukungan keluarga. Ketiga, harus ada terapi. Keempat, harus hadirkan Allah di dalam dirinya. Sebab, baik anak maupun orang dewasa yang kecanduan pornografi otomatis telah melanggar perintah Allah. Allah mengatakan tahan pandanganmu dan jaga kemaluanmu. Tetapi, justru dilanggar dan tidak mau menahan pandangan. Islam harus diambil seluruhnya, tidak boleh setengah-setengah. Jadi, bila melakukan zina mata dalam keadaan yang luar biasa, maka Allah akan melebihkan hormon-hormon di otak sehingga dia banjir dan over produksi dari hormon tersebut. Dan, itu mudah sekalibagiAllah.[]hidayatullah.com/joy Elly Risman Musa, Psikolog Spesialis Parenting Dampak Sinetron Berbau Porno pada Anak
    • Media Utama6 H ampir tidak ada t e l e v i s i u m u m —bukan televisi berita— yang tidak menayangkan si- netron. Jika tidak sinetron baru, biasanya mereka menayangkan ulang sinetron lama yang pernah sukses. Dan, tayangan sinetron ini bagi sebagian stasiun televisi menjadi acara unggulan sehing- ga penayangannnya mengguna- kan jam tayang utama (prime time). Pertanyaannya, sebegitu pentingkah sinetron bagi stasiun televisi tersebut? Ternyata, sine- tron ini menghasilkan keuntung- an yang luar biasa bagi konglo- merat pemilik televisi. Hanya dalamhitunganmenit,merekabi- sa mengeruk uang ratusan juga rupiah. Bahkan saking nikmatnya mengeruk keuntungan dari sine- tron, ada stasiun televisi yang hampir sepanjang hari mena- yangkanprogramsinetron. Stasiun televisi ini pun tak harus repot-repot memproduksi program tersebut. Banyak rumah produksi (production house) yang siap menjual produk sinetronnya. Stasiun televisi tinggal membeli dan menayangkannya. Jadi tidak banyak kru televisi yang terlibat. Tinggalsetelsaja. Harga satu episode sinetron berbeda-beda. Ini sangat tergan- tung pada sejauh mana sinetron itu memikat pemirsa televisi atau tidak. Ukurannya adalah rating. Jika ratingnya rendah, meski mutu tayangan sinetron itu seba- gus apapun, harganya rendah. Pihak stasiun televisi tidak me- mentingkan mutu, tapi lebih kepadarating. Satu episode sinetron yang ratingnya tinggi, harga per episo- denya bisa mencapai Rp 300 juta bahkan lebih. Tapi tahukah Anda, berapa keuntungan yang dikeruk daritayanganitu?Berlipat-lipat. Jika sinetron itu ditayang- kan di prime time, maka harga iklan per 30 detik bisa mencapai Rp 20-Rp 60 juta. Padahal slot iklan dalam satu episode bisa sampai 20 menit. Maka dari iklan, stasiun televisi minimal menda- patkan Rp 20 juta x 20 menit x 2, yakni sebesar Rp 800 juta. Ke- untungan kotor mencapai Rp 500 juta. Coba jika harga iklannya Rp 50 juta/30 detik, maka Rp 1 milyar lebihadaditangan. Inilah mengapa stasiun tele- visi tak terlalu peduli dengan isi sinetron yang ditayangkan. Sela- ma masyarakat masih memfavo- ritkan channel sinetron, selama itu pula stasiun televisi terus memproduksi tayangan tersebut. Kapitalistelevisitinggalongkang- ongkang menunggu duit datang lewatiklan. Selain pihak stasiun televisi, keuntungan yang besar dinikmati oleh para kapitalis produsen sine- tron dan pekerjanya termasuk para artis. Para produser sinetron ini tidak banyak. Tapi mereka ini menguasaipasarsinetrondiIndo- nesia. Dengan kekuatan modal- nya, mereka inilah yang menam- pung para pekerja seni untuk ber- kreasi membuat produk sinetron yang bisa memikat pemirsa te- levisi.Tentu bukan tayangan yang berbobot, tapi tayangan yang memikat. Dan bukan tidak mung- kin,dibalikituadaniatburukpara produsen ini terhadap sinetron yangdiproduksinya. Soalnya sudah beberapa kali, sinetron yang tayang di televisi terkena semprit Komisi Penyiaran Indonesia (KPI) karena melanggar ketentuan dan mele- cehkan simbol-simbol Islam. Ti- dak bisa dipastikan ini disengaja atau tidak. Tapi melihat latar belakang para pemilik televisi penayang sinetron (MNC Grup, SCTV, Indosiar), yang bukan Mus- lim, bukan tidak mungkin, ada maksud di balik tayangan sine- tron yang melecehkan simbol- simbolIslamitu. Parahnya lagi, para pekerja seni ini juga mau saja 'berkarya' sesuai kemauan rumah produksi. Aktor dan aktris seolah tak memi- liki pikiran sama sekali terhadap peran yang dimainkannya. Bisa jadi ini karena pikirannya sudah tertutupidenganuang. Tahukah Anda, dalam satu episode sinetron unggulan, ak- tor/aktris pemeran utama gajinya bisa mencapai puluhan juta? Wow, bagaimana tidak nurut de- ngan kemauan produsen dan sutradara tanpa basa basi karena takut kontraknya diputus di te- ngahjalan. Kolaborasi para pengejar uang inilah yang menjadikan sinetron tak lagi memiliki misi edukasi kepada masyarakat pe- mirsa televisi. Sebaliknya, isinya justrumerusak. “Saya tidak tahu apakah para produser tayangan-ta- yangan yang merusak itu berniat untukmerusakakidah,akhlakdan gaya hidup penontonnya. Tetapi memproduksi itu semua untuk kepentingan komersial iya. Yang pentingkan duit masuk. Jadi di sini dia mengabaikan nilai-nilai edukatif, yang penting ada iklan, duit masuk. Jadi lebih mengejar ke komersialisasi,”kata Satrio Aris- munandar, dosen Newsmaking CriminologyFISIPUI. Ia menekankan, lepas apa- kah para produsen sinetron dan pekerjanya berniat mau merusak atau tidak merusak, dampaknya sama saja, merusak. “Kalau niat kan yang tahu hanya dia sama Tuhan, kita tidak tahu. Tetapi fak- tanya memang merusak,” tandas- nya. Ketua MUI KH Cholil Ridwan menilai, mereka yang secara sengaja mengolok-olok Islam dan simbol-simbolnya sebagai orang- orang munafik. “Itu tergolong golongan munafikin itu, baik sutradara, produser, pemain, itu kalau memang sengaja Islam di- jual sebagai komoditas,” katanya kepadaMediaUmat.[]mujiyanto A dzan menjadi tayangan 'wajib' bagi stasiun televisi, kendati tidak ada yang mewajibkannya. Hambar rasanya kalau sampai ada stasiun televisi yang tidak menayangkan adzan di tengah pemirsanya yang mayoritasMuslim. Tapi, hati-hati, kendati menayangkan adzan, stasiun televisi tetap bisa memasukkan pesannya melalui tayangan yang sebenarnya bagian dari ibadahini.Adayangcukupbagus,tapiadajugayangperludikritisi. Sebuah tayangan adzan di sebuah televisi swasta berita, dalam beberapa saat menayangkan kumandang adzan dengan latar belakang iklan komersial. Parahnya lagi, di dalamnya ada iklan leasing baik itu berupa rumah maupun kendaraan roda empat. Padahal, jelas leasing ini adalah muamalahyangtidaksesuaidengansyariat. Ada juga adzan yang menggambarkan bagaimana kehidupan kaum hedonis di kota besar. Mereka mengumbar auratnya, tapi begitu adzan tiba mereka mencari mushala untuk mereka shalat. Mereka laki dan perempuan. Usai shalat, mereka kembali membuka auratnya dan meneruskan aktivitasnya. Selain itu ada pula adzan yang berlatar belakang muda-mudi. Stasiun televisi ini tampaknya ingin menggugah kepedulian lewat tayangan itu. Memang itu baik, tapi menggambarkan sosok-sosok di dalamnya sebagai sosok Islam moderat. Mereka naik motor berboncengan laki perempuan, tanpamenutup auratlagi.Khasgaulanakgedongan. Nah tayangan background adzan ini bisa saja diikuti oleh pemirsanya. Tayangan itu seolah menjadi pembenar bagaimana sikap seorang Muslim: perempuan boleh membuka aurat, dan sikap sekuler lainnya. Waspadalah![] emje Media Umat | Edisi 104, 22 Jumadil Akhir - 6 Rajab 1434 H/ 3 - 16 Mei 2013 Tayangan Adzan pun Bisa Mengandung Racun Kapitalis dan Artis,Kapitalis dan Artis, Penikmat Sinetron LarisPenikmat Sinetron Laris Kapitalis dan Artis, Penikmat Sinetron Laris Bahkan saking nikmatnya mengeruk keuntungan dari sinetron, ada stasiun televisi yang hampir sepanjang hari menayangkan program sinetron.
    • 7 M araknya sine- tron dan ta- yangan televisi lainnya yang m e l e c e h k a n simbol-simbol Islam tak otomatis menggerakkan negara untuk berbuat. Aksi-aksi masyarakat yang memprotes beberapa jenis tayangan, seolah tak dipedulikan. Padahal, banyak di antara para pejabat negara adalah Muslim, bahkan sebagian dari mereka berasaldaripartaiIslam. Menteri Komunikasi dan Informasi Tifatul Sembiring, mengaku dirinya tak punya kewenangan untuk menghen- tikan tayangan di televisi, kendati ia sendiri sangat tahu, banyak sinetron dan tayangan televisi yang merusak akidah kaum Muslim. Menurutnya, UU No 32 tahun 2002 tentang Penyiaran, mengubah kewenangan me- ngontrol konten siaran televisi dan radio itu ke Komisi Penyiaran Indonesia (KPI). “Jadi kewenang- annya, mengontrol, menegur dan memberikan sanksi ada di KPI,” katanya. Tifatul mengingatkan KPI untuk bertanggung jawab. “KPI jugaperludibekaliagarmemberi- kan sanksi itu, jangan hanya tegur-teguran saja. Karena biasa- nyaakandiabaikan,”katanya. Sementara itu KPI sendiri merasa kewenangan yang ada padanya juga dikebiri. Menurut Nina Mutmainnah Armando, Komisioner KPI Bidang Isi Siaran, KPI tidak bisa mencabut izin siaran stasiun televisi yang melanggar aturan. Soalnya, ke- beradaan izin itu justru ada di pemerintah. Walhasil, KPI paling-paling hanya menyampaikan teguran dari mulai teguran satu, dua, dan tiga. Setelah itu memang ada pencabutan izin, tapi prosesnya membutuhkan waktu yang sa- ngat panjang dan harus melibat- kanpemerintah.“Danjanganlupa kewenangan KPI terbatas karena memang terjadi judicial review terhadap undang-undang penyi- aran yang menyebabkan kewe- nangan KPI terbatas tadi,” kata- nya. KPI sendiri, kata Nina, mem- butuhkan masyarakat untuk ber- gerak menolak berbagai tayang- anyangmerusak.“Karenaitukami membutuhkan publik sebenar- nya. Karena KPI itu adalah lemba- gayangmewakilipubliksehingga publik harus bersama-sama KPI memperbaikisiaran,”kataNina. Ia sendiri mengelak disebut diam saja terhadap berbagai pelanggaran yang dilakukan oleh stasiun televisi. Pihaknya meng- aku terus memantau siaran tele- visi 24 jam.“Tanpa tekanan publik punsanksiadministrasikamiakan jatuh bila tayangan memang me- langgar P3 SPN itu. Jadi kami in- dependen dalam hal ini,” tutur- nya. Di tengah karut marut pengawasan siaran televisi seper- ti ini Menkominfo memintarakyat untuk ikut bergerak menolak ta- yangan-tayangan yang merusak akidah itu langsung ke televisi yang menayangkannya. “Masya- rakat tidak ada salahnya juga datang ke SCTV-nya protes. Ja- ngan diam saja dong. Ini kan su- dah merusak akidah. Di Indonesia kan banyak lembaga masyarakat. Kan boleh protes. Kalau diam saja ya tidak berubah nasib kita,” kata Tifatul. Ia pun kemudian menyebut beberapa organisasi besar seperti NU dan Muhammadiyah serta MUI. “Masa kita mau cuek saja? Ayo bergerak, jangan pada diam juga pemimpin umat ini,”katanya seraya mengatakan, “Kalau saya punya kewenangan sudah saya tutupdaridulu.” Sementara itu, juru bicara Muslimah HTI Iffah Ainur Rohmah menyesalkan sikap pemerintah, termasuk di dalamnya KPI. “Se- mestinyanegaratidakmenunggu protes masyarakat. Ada atau tidak ada protes, mestinya tayangan semacamitudilarang,”katanya. Menurutnya, yang bisa menghentikan tayangan seperti ini hanyalah negara melalui lem- baga pengawas yang selalu me- mantau semua produk pemikiran ditengahmasyarakat,jugamemi- liki otoritas untuk mengajukan ke pengadilan, pembinaan, peng- arahan, penyetopan hingga pela- rangan berdiri media jika tidak memenuhi ketentuan syariat. “Karenanya standar yang dipakai oleh lembaga pengawas media dan peradilan harus sama, yakni rambu-rambu syariat Islam,” kata Iffah. Kebijakan Khilafah Khilafah pun memiliki se- perangkat kebijakan dalam per- televisian ini. Anggota Lajnah Tsaqafiyah DPP HTI Syamsuddin Ramadhan menjelaskan, kebijak- an program televisi negara khila- fah. Departemen penerangan adalah departemen yang memi- liki kewenangan untuk mengatur pertelevisian berdasarkan syariat Islam. Di dalam negeri, kebijakan pertelevisian dirancang untuk mewujudkan tiga hal; (1) mem- bangun masyarakat Islam yang kokoh dan kuat, (2) melenyapkan unsur-unsur yang bisa menghan- curkan sendi-sendi masyarakat Islam, serta (3) menonjolkan ke- baikandankeluhuranIslam. Adapun di luar negeri, ditu- jukan untuk menerangkan Islam, baik dalam keadaan damai mau- pun perang, dengan penerangan yang menampakkan keagungan dan keadilan Islam; kekuatan Daulah Islamiyah, baik militer, ekonomi, serta peradabannya; serta menerangkan kerusakan sistem selain Islam, kedzaliman dan kerusakannya, serta kele- mahan negara-negara kafir, baik militer, ekonomi, dan peradaban- nya. Program siaran televisi, me- nurut Syamsuddin, dilarang me- nayangkan hal-hal yang diharam- kan oleh Islam, seperti infotain- men ghibah, pemujaan terhadap materi, penonjolan hal-hal yang berbau seksualitas, tabarruj, serta siaran-siaran yang merendahkan akhlak manusia, dan lain sebagai- nya. Siapa saja yang membuat program-program siaran yang bertentangan dengan syariat dan akhlak Islam, akan dikenai sanksi ta'zir. Program-program siaran yang mengandung unsur-unsur yang bertentangan dengan akidah dan syariah, dibekukan dan dilarang seketika, tanpa menunggu-nunggu waktu lagi. Begitu juga program-program yang menjajakan pemikiran- pemikiran kufur, seperti demo- krasi, liberalisme, pluralism, na- sionalisme, dan lain sebagainya, semuanya dilarang ada dalam program-program siaran televisi. Begitu juga program-program siaran yang ditujukan untuk me- ragukan kesempurnaan Islam, se- muanyadilarangtanpakomentar. Menurutnya, semua prog- ram siaran televisi yang ada di dalam Khilafah Islamiyah, diarah- kan kepada penguatan masyara- kat Islam, penjauhan masyarakat dari unsur-unsur yang bisa meru- sak sendi-sendi masyarakat Islam, serta penonjolan ketinggian Islam di tengah-tengah masya- rakat. Dengan kebijakan seperti itu, siaran televisi akan menjadi kekuatan yang luar biasa untuk mendidik umat dan menyebar- kan dakwah Islam. Tidak seperti sekarang, siaran televisi justru menjadiduribagiumat.[]emje A nda penggemar acara 'Bukan Empat Mata'? Acara yang menampilkan host Tukul Arwanan itu sempat dihentikan penayangannya oleh KPI. Sebelum dihentikan pada 2008, tayangan ini sempat ditegur karena menampilkan adegan Sumanto pemakan manusia (2007). Setahun kemudian ketika di dalamnya adaacaramakankatakhidup-hidup, acarainidihentikan. Tapi bukan stasiun televisi kalau tidak pandai ngeles. Pihak Trans7, mengakali vonis tersebut dengan mengubah nama program tersebut menjadi “Bukan EmpatMata”dantetapmenayangkannya. KPI dibuat tak berkutik. Buktinya KPI tidak bereaksi terhadap tindakan Trans7 tersebut. KPI hanya mengimbau agar acara tidak membicarakan hal-hal yang vulgar,mesum,danberbauseks. Tidak ada yang berubah dari isi acara 'Bukan Empat Mata' ini. Semuanya sama. Walhasil, ya sama saja. Tak heran pasca itu, teguran demi teguran muncul lagi. Pada Tahun 2009, KPI memberikan teguran pertama karena tamu Tukul pada saat itu adalah Kangen Band, tidak sengaja menyebut nama alat kelamin karena latah saat menjatuhkan sesuatu dan pada Bulan Desember 2009, acara ini kembali ditegur karena Tukul mencolek Bella Saphiradengansengaja. Untuk kesekian kalinya, tepatnya pada bulan Juni Tahun 2010, Bukan Empat Mata kembali menerima teguran dari KPI karena Atika (tamu Tukul) membaca Basmalah saat akan minum wine (minuman haram).[] emje Akal Bulus Agar Tetap Mulus Media Umat | Edisi 104, 22 Jumadil Akhir - 6 Rajab 1434 H/ 3 - 16 Mei 2013 Negara tak BerdayaNegara tak BerdayaNegara tak Berdaya Menteri menyatakan ia tak memiliki kewenangan lagi, sementara KPI merasa lembaga itu pun dikebiri. Media Utama
    • Berbedadenganerasebelumnya,erareformasimemberikankebebasanseluas-luasnya kepadamediapenyiaranuntukmenayangkantayagannya.Sakingbebasnya,banyak tayanganyangmerusakakidahumat.Pemerintahsendiritakdiberikewenanganuntuk menghentikannya.SebagaigantinyaadaKomisiPenyiaranIndonesia(KPI).Tapinyatanya KPIsendiritakbisaberbuatbanyak.Mengapa?WartawanTabloidMediaUmatJokoPrasetyo mewawancaraiKomisionerKPINinaMutmainnahArmando.Berikutpetikannya. Tanggapan KPI terhadap aduan warga yang keberatan dengan sinetron Tukang Bubur Naik Haji (RCTI) dan Ustad Fotocopy (SCTV) karena dianggap melecehkan simbol Islam? Kami sudah menerima aduan masyarakat tentang ini dari kelompok Masyarakat Televisi Sehat Indonesia. Kami mempertemukan antara pihak pengadu dengan pihak stasiun televisinya. Kita undang mereka pada Senin (22/4) kemarin. Kami minta agar stasiun televisinya mendengarkan apa diadukan masyarakat sehingga tahu apa yang diprotes masyarakat apa. Kemudian kami minta stasiun televisi memperbaiki acaranya. Komitmen perbaikan itu kemudian disepakati oleh RCTI dan SCTV. Bahkan SCTV bukan hanya program Ustad Fotocopy yang diprotes, tetapi Haji Medit juga. Nah, Haji Medit sudah dihentikan penayangannya sejak Rabu lalu. Selain ketiga tayangan tersebut, program apa saja yang diprotes masyarakat? Pada 2012, ada empat aduan yang sangat besar. Pertama, kasus Rohis, kami menyebutnya kasus Rohis (Metro TV). Saat itu Metro TV menampilkan talkshow tentang terorisme yang dianggap menyudutkan kelompok Kerohanian Islam Siswa. Pengaduannya itu sampai hampir 30.000. Kedua, pengaduan tentang acara Indonesian Lawyers Club (tvOne). Saat itu hostnya dianggap melecehkan kaum Bonek (Bondo Nekad/suporter Persibaya). Komunitas Bonek marah mengirimkan aduan ke KPI. Ketiga, ada pengaduan publik tentang acara Super Trap (Trans TV). Saat itu Super Trap menampilkan toilet orang yang dipasang kamera tersembunyi di toilet umum. Itu dianggap sangat tidak pantas dan melanggar privasi. Keempat, ada juga pengaduan yang cukup besar tentang salah pasang foto terduga teroris (tvOne). Saat itu tvOne memajang foto Badri yang disebut teroris, padahal fotonya salah. Kalau di tahun ini? Untuk tahun 2013, sampai sekarang banyak yang mengadukan Metro TV yang memelesetkan kepanjangan nama Partai Keadilan Sejahtera terkait dijadikannya Presiden PKS, saat itu, sebagai tersangka penerima suap penambahan kuota impor daging sapi. Yang terakhir, sebelum Ustad Fotocopy, adalah program Khazanah (Trans 7). Tetapi untuk Khazanah pengaduan publiknya beragam. Tidak hanya yang memprotes saja, tetapi justru lebih banyak yang mendukung program tersebut. Mengapa dari tahun ke tahun selalu saja ada televisi mengulangi kesalahan yang sama? Bukan melakukan kesalahan yang sama. Karena pelanggarannya bisa sama bisa tidak. Yang jelas adalah ada hal- hal yang ditampilkan itu mengganggu kenyamanan masyarakat. Dan itu sudah diatur oleh undang-undang. Bahkan bisa jadi yang diprotes masyarakat itu, isinya tidak melanggar ketentuan lho! Kita kan patokannya KPI, Pedoman Prilaku Penyiaran (P3) dan Standar Program Penyiaran (SPN). Sehingga bisa jadi isinya tidak melanggar P3 dan SPN tetapi masyarakat merasa terganggu dengan itu. Masyarakat merasa tidak pantas kalau tayangan seperti itu ditampilkan. Apakah televisi tidak mengetahui patokan konten yang tidak boleh dilanggar? Harusnya mengetahui. Karena itu ada di undang- undang. Setelah ditegur KPI adakah televisi yang membangkang? Ya, ada yang membangkang, sehingga tidak mau menjalankan komitmennya. Tetapi mayoritas mau menjalankan ya. Yang membangkang siapa? Misalnya, Pesbukers (ANTV) tahun lalu kami memberikan sanksi. Baru setelah berganti tahun dia menjalankan sanksi tersebut. Jadi ada memang yang mencoba membangkang. Itu semua dikembalikan ke publik lah. Publik lah yang menilai dan berteriak juga. Karena itu kami membutuhkan publik sebenarnya. Karena KPI itu adalah lembaga yang mewakili publik sehingga publik harus bersama-sama KPI memperbaiki siaran. Jadi kalau publik diam, KPI tidak bisa bertindak? Enggak juga. Sanksinya tetap jalan. Kami memberikan sanksi teguran tidak semata- mata atas tekanan publik. Tanpa tekanan publik pun sanksi administrasi kami akan jatuh bila tayangan memang melanggar P3 SPN itu. Jadi kami independen dalam hal ini. Jadi kami bukannya diam dan tidak ngapa-ngapain, ya enggak lah. Kami melakukan pengawasan, monitoring dan pemantauan ke sebelas televisi yang disiarkan dari Jakarta. Pemantauannya langsung 24 jam. Full. Dan kami punya rekaman-rekamannya. Dan kami juga memfasilitasi pengaduan masyarakat. Dari pemantaun itu, banyak juga ya acara yang merusak akidah, akhlak dan gaya hidup penontonnya? Sebenarnya kalau di aturannya KPI kalau Anda baca, semuanya sudah diatur. Kami tidak menyebutnya akidah ya, karena itu diambil dari sudut pandang agama. Jadi semuanya, sebenarnya sudah dijaga. Sebenarnya kalau televisi mematuhi segala aturan KPI ini beres sudah. Tidak akan ada orang yang merasa akidahnya dirusak. Karena kan dalam aturannya KPI harus dijaga penghormatan terhadap nilai- nilai agama, tidak boleh melecehkan kelompok tertentu, aturan tentang pembatasan dan larangan muatan seks, muatan kekerasan. Itu semua sudah diatur. Jadi semestinya tidak ada lagi hal-hal yang dianggap merusak atau mengganggu kalau saja aturannya itu dipatuhi. Sanksi yang paling berat dari KPI terhadap penyelenggara siaran? Sebenarnya kalau di undang-undang itu sampai pencabutan siaran. Tetapi untuk menjatuhkan sanksi itu butuh proses yang sangat panjang. Dan jangan lupa kewenangan KPI terbatas karena memang terjadi judicial review terhadap undang- undang penyiaran yang menyebabkan kewenangan KPI terbatas tadi. Sejauh ini sanksi yang kami berikan adalah sanksi administratif. Yang umumnya kami berikan adalah teguran. Teguran I, Teguran II, ... kalau belum berubah juga sanksinya ditingkatkan menjadi penghentian tayangan sementara atau pembatasan durasi. Siapa yang melakukan judicial review? Asosiasi televisi swasta APPSI. Mereka ingin membatalkan UU Penyiaran ini, namun tidak dikabulkan. MK memutuskan ada satu pasal yang harus dihapus karena pasal tersebut menyebutkan bahwa PP aturan tentang UU ini dibuat oleh pemerintah. Jadi pemerintah terlibat, terutama soal perizinan. Ditambah lagi, PP-PP itu tidak melibatkan KPI dan banyak yang bertentangan dengan UU. Sehingga ini menyulitkan KPI untuk bertindak. Di Undang-Undang-nya disebutkan KPI bisa mencabut izin siaran. Lha, izinnya kan tidak di tangan KPI tetapi di tangan Kemenkominfo! Sehingga ini melewati proses yang sangat panjang. Mengapa tidak ada sanksi denda? Sanksi denda sebenarnya ada. Dan ini memang sangat efektif. Tetapi sanksi denda bisa dilaksanakan dalam bentuk PP yang dibuat oleh Kemenkominfo. Tetapi sayangnya, sanksi denda hanya bisa dilakukan untuk iklan rokok yang menyalahi aturan dan jumlah iklan yang melebih kuota 20 persen. Jadi sangat terbatas sanksi denda ini.[] UU-nya Menyulitkan KPI untuk Bertindak Nina Mutmainnah Armando, Komisioner KPI Bidang Isi Siaran Media Umat | Edisi 104, 22 Jumadil Akhir - 6 Rajab 1434 H/ 3 - 16 Mei 2013
    • Berulang-kaliKomisiPenyiaranIndonesia(KPI)menegurdanmemberikan sanksiadministrasikepadatelevisiyangmenyiarkantayanganyangdianggap melecehkansimbolIslam.Namunberulangkalipulatelevisimemproduksisinetron danberbagaitayanganyangmerusakakidah,akhlaksertagayahiduppenontonnya. Mengapainibisaterjadi?Apaakarmasalahdansolusimendasarnya?Temukan jawabannyadalamwawancarawartawanMediaUmatJokoprasetyodengan pengamatsosialIwanJanuaryangjugaanggotaLajnahSiyasiyahDPPHizbutTahrir Indonesia.Berikutpetikannya. Tanggapan Anda tentang teguran KPI kepada stasiun televisi yang menayangkan tokoh antagonis bergelar “Haji”dan“Ustadz”? Memang sudah seharusnya pihak pemerintah dalam hal ini KPI mengawasi dan memberikan teguran bahkan sanksi, bila perlu, kepada tayangan- tayangan yang bermuatan anti- sosial termasuk yang berisi pelecehan ajaran agama, atau menggiring opini publik kepada stigmatisasi ajaran-ajaran agama. Sekarang ini banyak program televisi baik itu sinetron, reality show termasuk iklan yang bermuatan anti sosial. Hanya saja dulu yang dominan adalah konten pornografi tapi kalau sekarang sudah mulai berani 'bermain' membawa- bawa simbol agama. Bila dibiarkan maka akan membuat tayangan-tayangan seperti ini menjamur dan dianggap biasa. Tapi bukankah sinetron tersebut hanya mengungkap realitas yang ada? Ya, sebagian ada benarnya. Kita bisa dengan mudah melihat orang bertitel haji tapi punya sifat hasud pada orang lain, atau ustadz dan ustadzah yang matre misalnya. Namun demikian jangan lupa, sinetron atau tayangan televisi yang mengungkap seperti secara berulang-ulang pada akhirnya bukan lagi mengungkap realita, tapi sudah bisa menggiring atau menciptakan opini negatif. Kan seharusnya tayangan itu memberikan edukasi bahwa haji yang hasad itu salah, ustadz yang matre itu nggak benar, lalu diberikan penjelasannya. Bukannya justru 'dipelihara', dijadikan ikon dan dibiarkan terus berulang-ulang. Selain itu, adakah sinetron lain yang Anda nilai merusak akhlak, tauhid, pergaulan, gaya hidup dan anti sosial lainnya? Wah banyak sekali, mulai dari iklan sampai sinetron atau film-film lepas. Iklan banyak yang mengeksploitasi wanita atau ikhtilat pria-wanita. Sinetron- sinetron kita banyak yang terlalu mendramatisir tokoh antagonis, jadi kalau tokoh jahat benar- benar dibuat aktingnya jahat bener. Mengumbar kebencian dan permusuhan. Ini kan sudah menyebarkan watak anti-sosial kepada publik. Sinetron kita juga banyak yang mengumbar mimpi, mengumbar kemewahan. Rumah dan kendaraan mewah hal yang sepertinya 'wajib' dipajang dalam sinetron- sinetron Indonesia. Nilai-nilai pergaulan bebas juga begitu kental dalam dunia sinetron tanah air. Meski tidak sampai ada adegan persetubuhan, tapi aktifitas seperti pacaran dan perselingkuhan jadi tema yang biasa. Bahayanya bagi penonton? Bahaya bagi penonton terutama yang ababil alias ABG labil ya mereka akan langsung copy paste apa yang muncul di televisi dalam kehidupan sehari- hari, termasuk dalam hal pacaran. Akhirnya ada kesan kalau remaja gak pacaran ya bukan remaja namanya. Melahirkan ikonisasi tokoh Muslim yang jahat dan matre. Seperti haji yang kerjanya menghasut melulu, atau ustadz yang centil dan matre. Sehingga menimbulkan ketidakpercayaan publik kepada ajaran Islam atau orang yang sedang menjalankan ajaran Islam. Orang awam akan mencibir 'haji' atau mencibir 'ustadz', karena biasanya publik sering melakukan generalisasi. Tayangan-tayangan yang mengandung khurafat dan takhayul juga sudah pasti merusak akidah. Karena tidak ada tuntunannya seorang Muslim harus memburu hantu. Mengapa? Kita hidup di alam yang berbeda, dan masing-masing ada taklif amal yang harus dijalankan. Mengurus manusia saja sudah susah ngapain juga mengurus makhluk halus. Lagipula kewajiban dakwah kita adalah memperbaiki kehidupan umat manusia, bukan bangsa jin. Apakah tayangan-tayangan tersebut memang sekadar dibuat untuk menghibur atau memang benar-benar dibuat untuk merusak pemahaman dan gaya hidup penonton? Ya ini bisa saling berkelindan, saling menumpangi. Ada produser atau sutradara yang awalnya membuat sinetron sekadar memenuhi permintaan pasar atau produser atau pihak televisi. Bangsa kita kan biasa copy paste, apa yang laku biasanya langsung ditiru. Hanya saja mungkin insan perfilman itu tidak menyadari kalau sinetron yang mereka buat itu sudah terkategori melecehkan ajaran- ajaran agama, stigmatisasi. Di sisi lain sangat mungkin ada pihak yang punya kepentingan untuk melakukan tindakan stigmatisasi. Siapa di balik ini semua? Para pengusung sekulerisme dan liberalisme. Mereka ingin khalayak berada dalam kondisi tidak percaya kepada syariat Islam. Digerogoti dulu dari persoalan akidah dan ibadah, dibuat ikonisasi tokoh- tokoh agama buruk akhlak seperti itu. Mengapa sinetron yang merusak itu bisa marak? Ada dua keping di sini. Pertama, bisnis perfilman yang memang menguntungkan bagi para pemilik modal, pemilik stasiun televisi dan insan perfilman. Dan mereka secara umum belum punya pemahaman yang benar serta kuat tentang ajaran Islam. Malah dunia televisi swasta yang besar kan dikuasai non Muslim. Bagi mereka sinetron- sinetron seperti ini seperti kata pepatah; sekali merengkuh dayung, dua tiga pulau terlampui. Uang dapat, perusakan terhadap umat Islam juga berhasil. Kedua, selama ini memang perhatian pemerintah terhadap pembinaan akidah dan akhlak umat minim. Film-film cabul, horor yang penuh takhayul bahkan yang bermuatan lesbian, gay, biseksual dan transeksual juga sudah beberapa kali tayang di layar bioskop. Mengapa pemerintah begitu? Negara ini kan pondasinya sekulerisme; persoalan akidah dan akhlak ya diserahkan kepada diri masing-masing. Mau jadi apa terserah kepada individu yang bersangkutan. Yang penting jangan mengganggu hak orang lain dan meresahkan umum. Negara sekuler tidak akan ikut campur dalam persoalan ini. Karenanya paham sekulerisme itu memang jahat dan merusak umat Islam. Apa yang harus dilakukan negara untuk menjaga umat dari sinetron atau pun konten media massa yang merusak lainnya? Harus ada standar hukum yang benar dan ajeg, tidak multitafsir. Sekarang batasan pornografi dan pornoaksi adalah pasal karet, bisa ditarik-ulur sesuka orang. Makanya sampai kapan pun bila kondisinya seperti sekarang tidak akan bisa mencegah maraknya tayangan atau konten media massa yang merusak. Seharusnya ada rambu- rambu tentang dunia seni dan budaya, sehingga dari awal insan seni sudah tahu mana yang boleh dan yang tidak. berikutnya ada lembaga sensor yang memang disiplin dan tidak kompromi dalam persoalan agama. Berikutnya harus ada sanksi tegas bagi mereka yang melanggar aturan ini. Menghambat seni dan kreativitas dong? Tidak. Dengan adanya aturan ini justru orang akan terpacu untuk menghasilkan karya seni yang bermoral dan bermutu. Bukankah dalam kehidupan sekulerisme dan liberalisme seperti sekarang, orang malah berlomba-lomba membuat karya seni dan budaya yang murahan. Film horor atau komedi kalau tidak ada paha dan dada perempuan seperti kurang lengkap. Itu norak! Nah, perlindungan umat dari konten media massa yang merusak hanya bisa efektif dan efisien bila negara berpondasikan Islam dengan sistem pemerintahan khilafah- nya. Mengapa harus khilafah, tidak cukupkah kita mencegah anak untuk menonton televisi? Memang, secara pribadi dan keluarga setiap Muslim sebenarnya bisa melindungi akidah dan akhlak dari tayangan- tayangan negatif televisi, tapi hanya sampai batas-batas tertentu. Hanya saja apa yang bisa dilakukan oleh keluarga dan komunitas ruang lingkupnya amat terbatas? Keluarga Muslim hanya bisa menyampaikan petisi dan melindungi secara lokal. Lantas, siapa yang bisa mencegah ditayangkannya karya seni yang tidak bermoral dan tidak bermutu? Pertanyaannya apakah sistem budaya dan hukum sekarang bisa melakukan itu semua? Ternyata tidak, malah semakin menjadi-jadi.[] Media Umat | Edisi 104, 22 Jumadil Akhir - 6 Rajab 1434 H/ 3 - 16 Mei 2013 Iwan Januar, anggota Lajnah Siyasiyah DPP HTI Mereka Ingin Umat Tak Percaya Syariat
    • 10 Aspirasi Media Umat | Edisi 104, 22 Jumadil Akhir - 6 Rajab 1434 H/ 3 - 16 Mei 2013 Mereka BicaraMereka BicaraMereka Bicara Tayangan yang MerusakTayangan yang MerusakTayangan yang Merusak TifatulSembiring, Menkominfo Bukan Kewenangan Menkominfo Keberatan masyarakat itu bukan hanyapadaTukangBuburNaikHaji(RCTI)dan UstadzFotokopy(SCTV)saja.Banyaksinetron lain yang merusak bahkan mengganggu akidah. Model-model sihir begitu, mayat terbang, alam ghaib, itu semua mengganggu itu. Dalam hal ini menurut UU No 32 tahun 2002 tentang Penyiaran, kewenangan mengontrol konten siaran televisi dan radio itu ada di KPI. Jadi kewenangannya,mengontrol,menegurdanmemberikansanksiadadi KPI. Jadi jangan membayangkan Kemenkominfo seperti zaman Departemen Penerangan dulu. Sejak Departemen Penerangan diubah menjadiKemenkominfodicabutlahkewenangantersebut. Jadi kita ini ditugaskan untuk membangun infrastruktur teknologi, informasi dan komunikasi. Kalau dalam penyiaran hanya TVRIdanRII,jaringantelekomunikasidaninternet.JadidiluaritukeKPI. Begitulah di dalam undang-undangnya, kalau kewenangan orangkitaambil,disalahkanlagi.Pascareformasibegitudiaturnya. Hal-hal seperti ini akan kami ingatkan lagi kepada KPI, semestinyadiabertanggungjawab.JanganberlepastanganjugaKPIdi situ. KPI juga perlu dibekali agar memberikan sanksi itu jangan hanya tegur-teguransaja.Karenabiasanyaakandiabaikan. Ke depan ini perlu aturan yang lebih tegas sehingga KPI bisa memberikansanksibahkanbilaperludendasecaramateri.[] EffendiGazali, PakarKomunikasiPolitik Kepentingan Rating dan Sharing Media kita itu banyak dipengaruhi kepentingan bisnis, jadi sangat tergantung padaratingdansharingdanbagianlainyang dipengaruhipolitik.Kitamelihatketikaorangpunyakanal,merekabisa mengiklankan dirinya berkali-kali dalam bentuk iklan politik dan lain sebagainya. Soal rating dan sharing ini, saya melihat sangat serius. Bagaimana bangsa kita harus mengakui akhirnya, misalkan kita harus terlibatdenganpembahasanyanglamasepertiEyangSubur,initerlalu lamadanbertele-tele.Untuktidakterpengaruhhaldemikiankitaharus punya lembaga rating yang mengaudit tayangan pertelevisian tersebut. Macam-macam kanal di Indonesia umumnya kalau mereka tidakdi-driveolehekonomikdenganratingdansharingsemata,laluada hiburan, lalu ada unsur politiknya kita tahu siapa yang punya kanal- kanaltelevisitersebut.[] KHCholilRidwan, KetuaMUIPusat IniPelecehanterhadapIslam Menurut saya dan tidak hanya MUI bahkan seluruh ulama juga tidak menginginkan Islam dijadikan komoditas, bahan olok-olok supaya rating naik. Itu kan merupakanpelecehansebetulnyaterhadapIslam. Haji itu gelar kehormatan untuk seseorang yang naik haji, tapi sinetronTukangBuburNaikHaji,UstadzFotocopydanHajiMeditituyang sifatnya merendahkan harkat martabat haji, itu sudah melakukan penistaanterhadapagama. AgamaIslamsudahjadimain-mainan,kalausengajamengolok- olok Islam dihukumnya bisa dianggap keluar dari Islam loh, tergolong golonganmunafikin,adaterdapatdalamsurah al-Baqarahayat13-14. Mereka membuat sinetron hanya memperolok-olok Islam saja. Itutergolonggolonganmunafikinitu,baiksutradara,produser,pemain, itukalaumemangsengajaIslamdijualsebagaikomoditas. Hal ini selalu berulang, padahal perkara ini sudah lama tayangan-tayangan seperti ini, ditegur sama KPI muncul lagi dengan beda cerita jadi memang suatu kebijakan yang mengatur itu dan kita tidakpunya,untukmenindaktegassiaranitu.[] AsrorunNi'amSholeh, Wakil Ketua Komisi Perlindungan Anak Indonesia MudahDitiruolehAnak Pengaruh tayangan pada anak, yang terlihat dari banyak penelitian menunjukkan korelasi tayangan kekerasan di televisi dengan perilaku kekerasan yang dilakukan oleh anak-anak. Baik anak menjadi pelaku tidak kekerasan ataukah menjadi korban tindak kekerasan. Temuan itu sudah sangat banyak, ada beberapa tayangan yang kemudian dihentikan salah satunya smack down yang menujukkan pada kita bertapa hubungan kausalitas atara kekerasan pada anak itu menjelmamenjadiaktifitasyangberbahayapadaanak. Kemudian,darisisiteori,apayangdisaksikananakituakanjauh lebih banyak dari apa yang dituturkan. Ini yang dikenal dalam teori akademik sebagai teori peniruan (imitasi). Karena akan lebih mudah mengambildariapayangdilihat. Sekalipun, visualisasi kekerasan itu mengirimkan pesan jangan meniru adegan itu, tetapi anak dalam konteks teori itu tidak bisa menghindari dari tampilan tidak kekerasan untuk tidak diikuti, karena semakinpenasarandenganvisualisasisepertiitu. Ditambah lagi, tayangan yang secara frekuensi milik publik harusnyatayangandanpenyiaranyangmemanfaatkanfrekuensipublik itu harus dijadikan kepentingan publik bukan untuk kepentingan kapitalsemata.[] SatrioArismunandar, DosenNewsmakingCriminologyFISIPUI Harus Kompak dan Serius Menolak Kalau saya lihat, sinetron Ustadz Fotokopy (SCTV) itu isinya sudah bukan lagi kritik sosial tetapi sudah konyol-konyolan yang tidak ada unsur edukatifnya. Tidak ada mutunya. Bandingkan ya dengan sinetron yang rada bermutu seperti ParaPencariTuhan (SCTV). Di PPT juga kan digambarkan ada tokoh ustadz yang mempunyai kelemahan. Tapi kesannya bukan melecehkan, di situ digambarkan secara proporsional, ada kebaikan tetapi juga ada kekurangan, yang semuanampakwajarnampakpulanilaikearifannya.TetapikalaudiUF, itu 100 persen isinya jelek. Mulai dari tokoh hajinya hingga tokoh ustadznya. Saya muak banget lihatnya, karena tidak ada bagus- bagusnya. Hatinya selalu dengki, ngomong selalu kasar, tukang bohong, fitnah, belagu, sombong, memutarbalikan ayat. Jadi tampak sekaliketidakwajarannyadantidakadanilaiedukatifnyasamasekali. Saya tidak tahu apakah para produser tayangan-tayangan yang merusak itu berniat untuk merusak akidah, akhlak dan gaya hidup penontonnya. Tetapi memproduksi itu semua untuk kepentingan komersialiya.Yangpentingkanduitmasuk.Jadidisinidiamengabaikan nilai-nilai edukatif, yang penting ada iklan, duit masuk. Jadi lebih mengejarkekomersialisasi. Tetapi akibatnya sama juga, apakah berniat mau merusak atau tidak merusak, dampaknya sama saja merusak. Kalau niat kan yang tahu hanya dia sama Tuhan, kita tidak tahu. Tetapi faktanya memang merusak. Bila dia berkilah,“saya berniat baik kok”ya mana kita tahu, tetapiyangjelastayanganitutidakmendidik. Sebenarnya begini, bila ingin tayangan itu tidak ditayangkan, yang penting adanya kekompakan. Contohnya waktu itu, di Lativi kan adaserialgulatSmackDown.Meskiditayangkannyamalam,anak-anak kecil juga kan senang menontonnya. Kemudian ada anak kecil memitingtemannyahinggamatidenganalasanhanyameniruadegan gulat di Smack Down tersebut. Kemudian Menteri Pendidikan, Menteri Perempuan, Komnas Anak segala macam tokoh-tokoh, semua sepakat memintafilmtersebuttidakbolehtayanglagi. Akhirnya Lativi tidak lagi menayangkannya padahal ratingnya sangat tinggi, dan iklannya banyak. Jadi kalau kita kompak, ada kampanye dari berbagai kelompok massa, yang penting keras tekanannya,televisipunakanmenyerah.Tapikalaukitasekederprotes, kirim surat doang, ya tidak didengar. Jadi kampanye penolakannya harusserius.[]fatih-joy IffahAinurRohmah, JubirMuslimahHTI Harus Melarang, Jangan Tunggu Diprotes Sinetron bermasalah yang sebagian besar mengajarkan gaya hidup bebas dan hedonis (Contohnya, Akibat Pergaulan Bebas/SCTV); perzinahan (Selingkuh/Indosiar), juga merendahkan Islam dan simbol nilai/hukum (Haji Medit/SCTV, Ustadz Fotocopy/SCTV dan TukangBuburNaikHaji/RCTI) yang menjual simbol Islam 'Haji' dan 'Ustadz' untuk menarik perhatian penontonnya dengan cara menampilkan sosok yang bertolak belakang dengan sosok ustadz dan hajiyangsemestinya. Jadi ini menyakiti umat Islam karena mengolok-olok simbol- simbolIslam.Sinetronbermasalahinimerusakumatdanmenanamkan nilai-nilaiyangbertentangandenganIslam. Sinetron dengan model begini semakin banyak diproduksi, menunjukkan pihak produser dan stasiun TV hanya berorientasi keuntungansaja,tidakmempertimbangkanaspekpengaruhburuknya bagi masyarakat. Ini juga menunjukkan bahwa negara gagal melindungi rakyat dari berbagai pemikiran dan gaya hidup yang merusakyangdisebarkanmelaluimedia. Meskiberalasanmenggambarkanrealitasdimasyarakat,namun media semestinya memerankan diri membimbing masyarakat ke arah perilakuyangbenar,bukanhanyaberorientasipadaselerapasarsaja. Memang hanya negaralah yang bisa mengarahkan masyarakat yang memiliki bermacam orientasi –positif dan negatif- sehingga masyarakat bisa terjaga dari terpapar berbagai pemikiran maupun tayanganyangmencontohkanperilakukontraproduktif. Negara semestinya menggariskan rambu-rambu penataan mediadandiiringipenegakanhukumyangtegas.Dalamkaitandengan sinetron-sinetron bermasalah semestinya negara tidak menunggu protes masyarakat. Ada atau tidak ada protes, mestinya tayangan semacamitudilarang. Yangbisastopyanegaramelaluilembagapengawasyangselalu memantau semua produk pemikiran di tengah masyarakat, juga memiliki otoritas untuk mengajukan ke pengadilan, pembinaan, pengarahan, penyetopan hingga pelarangan berdiri media jika tidak memenuhi ketentuan syariat. Karenanya standar yang dipakai oleh lembaga pengawas media dan peradilan harus sama, yakni rambu- rambusyariatIslam.[]jokoprasetyo
    • 11Telaah Wahyu Oleh: Rokhmat S Labib, MEI Perilaku JahatPerilaku Jahat Penghuni NerakaPenghuni Neraka Perilaku Jahat Penghuni Neraka Media Umat | Edisi 104, 22 Jumadil Akhir - 6 Rajab 1434 H/ 3 - 16 Mei 2013 Ikhtisar: 1. Perilaku orang yang dimasukkan ke dalamnerakaJahannam:(a)menukar kenikmatan Allah dengan kekufuran; (b) menjerumuskan kaumnya di nera- kaJahannam;(c)menyesatkanmanu- siadijalanAllah. 2. Kita tidak boleh terpengaruh dengan mereka, apalagi mengikuti propagan- dasesatmereka. Tidakkah kamu perhatikan orang-orang yang telah menukar nikmat Allah dengan kekafiran dan menjatuhkan kaumnya ke lembah kebinasaan? Yaitu neraka Jahannam; mereka masuk ke dalamnya; dan itulah seburuk-buruk tempat kediaman. Orang-orang kafir itu telah menjadikan sekutu-sekutu bagi Allah supaya mereka menyesatkan (manusia) dari jalan-Nya. Katakanlah: "Bersenang-senanglah kamu, karena sesungguhnya tempat kembalimu ialah neraka" (TQS Ibrahim [14]: 28-30). K esudahan nasib ma- nusia di akhirat amat ditentukan oleh tin- dakan mereka sendiri selama hidup di du- nia. Ayat ini adalah di antara yang menjelaskan realitas tersebut secara gamblang. Perilaku orang- orang yang menjerumuskan diri mereka dan orang lain di neraka jahannam digambarkan ayat ini. Dengan gambaran tersebut, di- harapkan manusia terhindar dari perilaku buruk yang mengantar- kankepadanerakatersebut. Mengganti Nikmat dengan Kufur Allah SWT berfirman: Alam tara ilâ al-ladzîna baddalû ni'ma- tal-Lâh kufr[an] (tidakkah kamu perhatikan orang-orang yang telah menukar ni`mat Allah de- ngan kekafiran). Imam al-Qur- thubi meriwayatkan dari Ibnu 'Abbas bahwa orang-orang yang diceritakan dalam ayat ini adalah musyrikQuraisy. Menurut al-Syaukani dalam tafsirnya, Fath al-Qadîr, ini merupakan pendapat jumhur mufassirin berpendapat bahwa yang dimaksud mereka dalam ayat ini adalah kafir Mak-kah. Ayat ini juga turun berkaitan dengan mereka. Meskipun demikian, dite- gaskan Ibnu Katsir bahwa makna ayat ini bersifat umum mencakup semua orang kafir. Sebab, Allah SWT telah mengutus Nabi Mu- hammad SAW sebagai rahmat bagi alam semesta dan nikmat bagi manusia. Barangsiapa yang menerima dan mensyukurinya, masuksurga.Sebaliknya,siapasa- ja yang menolak dan menging- karinya, maka masuk neraka. Pen- jelasan senada juga dikemukakan al-Hasan.Sebagaimanadikutipal- Qurthubi, al-Hasan mengatakan bahwa ayat ini meliputi semua orangmusyrik. Ini merupakan khithâb (se- ruan) yang ditujukan kepada Rasulullah SAW dan semua orang yang tepat dengan seruan terse- but. Seruan tersebut mengan- dung makna ta'jîb (memunculkan rasa heran) pada diri Raslullah SAW terhadap orang-orang kafir yang melakukan sejumlah peri- laku buruk dan jahat yang me- nyebabkanmerekasengsara. Perbuatan buruk pertama yang disebutkan adalah: baddalû ni'matal-Lâh kufr[an] (orang- orangyangtelahmenukarnikmat Allah dengan kekafiran). Menurut Fakhruddin al-Razi ada tiga ke- mungkinan maksud dari 'meng- ganti nikmat Allah dengan keku- furan'. Pertama, mereka meng- gantisikapsyukur merekakepada nikmat Allah dengan kekufuran. Ketika mereka diwajibkan men- syukuri kenikmatan, tetapi mere- ka justru melakukan kekufuran. Seolah-olah mereka telah meng- ubah dan mengganti total syukur dengankekufuran. Kedua, yang mereka tukar adalah nikmat Allah SWT itu sen- diri dengan kekufuran. Pasalnya, mereka telah mengingkari kenik- matan tersebut, kemudian Allah SWT mencabut nikmat itu dari mereka. Sehingga, yang tersisa hanya kekufuran sebagai peng- gantikenikmatan. Ketiga, sesungguhnya Allah SWT memberi kenikmatan kepa- da mereka berupa Rasul SAW dan Alquran. Namun mereka lebih memilih kekufuran daripada ke- imanan. Dijelaskan juga oleh al- Thabari, makna telah menukar kenikmatan Allah dengan keku- furan; bahwa Allah SWT telah memberikan kenikmatan kepada Quraisy dengan diutusnya Nabi Muhammad SAW dari kalangan mereka dan menjadi rasul yang memberikan rahmat bagi mere- ka. Namun mereka mengingkari dan mendustakannya; sehingga mereka menukar kenikmatan Allah dengan kekufuran. Ituah perbuatan dan perilaku buruk mereka. Menjerumuskan Pengikutnya ke Neraka Perbuatan buruk mereka yang kedua adalah: Wa ahallû qawmahum dâr al-bawâr (dan menjatuhkan kaumnya ke lem- bah kebinasaan?). Kata ahallû qawmahum dalam ayat ini berarti anzalûhum (menjatuhkan, men- jerumuskan mereka). Menjeru- muskan kaum mereka adalah de- ngan menghalangi mereka (un- tuk mengimani kenikmatan Allah SWT itu). Demikian penjelasan Abdurrahmanal-Sa'di. Sedangkan yang dimaksud dengan qawmahum, menurut al- Zamakhsyari dalam tafsirnya, al- Kasysyâf, adalah orang-orang yang mengikuti mereka atas kekufuran.Tak jauh berbeda, Ibnu 'Athiyah juga menafsirkan qaw- mahum sebagai orang-orang yangmenaatimereka. Kaum yang mengikuti me- reka itu pun dijerumuskan ke dalam dâr al-bawâr. Diterangkan oleh banyak mufassir, kata al- bawâr berarti al-halâk (kebinasa- an). Sehingga dâral-bawâr berarti dâr al-halâk (tempat kebinasaan, kehancuran). Yang dimaksud de- ngan lembah kebinasaan dite- rangkan dalam ayat selanjutnya Allah SWT berfirman: Jahannam yashlawnahâ (yaitu neraka Ja- hannam; mereka masuk ke da- lamnya). Menurut al-Zamakhsyari, kata Jahannam merupakan athf al-bayân (menambahkan kata baru yang berfungsi sebagai pen- jelas). Itu artinya, yang dimaksud dengan dâr al-bawâr adalah Ja- hannam. Demikian penjelasan para mufassir, seperti Ibnu Zaid, sebagaimana dikutip al-Qurthubi dalam tafsirnya, al-Jâmi' li Ahkâm al-Qur`ân. Dikatakan juga oleh al- Samarqandi, bahwa frasa: Jahan- nam yashlawnahâ (neraka Jahan- nam yang mereka masuki) berarti mereka masuk ke dalamnya di akhirat. Kemudian ditegaskan de- ngan firman-Nya: Wabi`sa al- qarâr (dan itulah seburuk-buruk tempat kediaman). Kata bi`sa merupaka kata yang digunakan untuk celaan terhadap segala se- suatu. Sedangkan kata al-qarâr di sini berarti al-mustaqarr (tempat kediaman). Sehingga bi`sa al- qarâr berarti tempat kembali yangpalingburuk. Dikatakan al-Samarqandi, bi`sa al-qarâr berarti bi`sa al- mustaqarr Jahannam (seburuk- buruknya tempat kediaman adalahadalahnerakaJahannam). Menjadikan Sekutu bagi AllahSWT Perbuatan buruk ketiga yang mereka lakukan adalah: Waja'alû lil-Lâh andâd[an] liyu- dhillû 'an sabîlihi (orang-orang kafir itu telah menjadikan sekutu- sekutu bagi Allah supaya mereka menyesatkan (manusia) dari jalan-Nya). Kata andâd[an] meru- pakan bentuk jamak dari kata nidd[an]. Dijelaskan Fakhruddin al- Razi, yang dimaksud dengan al- andâd adalah al-asybâh wa al- syurakâ` (serupa dan sekutu). Me- nurutnya, sekutu yang dimaksud- kan mengandung tiga kemung- kinanmakna. Pertama, mereka memberi- kan bagian tertentu untuk ber- hala dalam kenikmatan yang dianugerahkan Allah SWT kepada mereka. Contoh ucapan mereka dalam ini adalah: Ini untuk Allah, daniniuntuksekutu-sekutukami. Kedua, mereka menyekutu- kan antara berhala dan al-Khaliq dalam peribadatan. Dan ketiga, mereka menyampaikan secara terang-terangan keberadaan se- kutu bagi Allah. Ucapan mereka dalam hal ini seperti ketika ber- haji: Labayka lâ syarîka laka illâ syarîka huwa laka tamlikuhu wa mâ milk (kami menghadiri pang- gilanmu, tidak ada sekutu bagi- Mu kecuali sekutu yang menjadi milik-Mu). Menjadikan sekutu selain Allah SWT jelas merupakan kese- satan. Selain membuat mereka tersesat, tindakan tersebut juga dapat menyesatkan orang lain. Ini ditegaskan dalam frasa selanjut- nya: liyudhillû 'an sabîlihi. Mereka menyesatkan manusia dari sabî- lihi. Pengertian sabîlihi adalah dî- nihi(agama-Nya).Sehingga,seba- gaimana dijelaskan al-Samarqan- di, frasa tersebut bermakna: liyushrifû al-nâs 'an dîn al-Islâm (untuk memalingkan manusia dariagamaIslam). Dikatakan juga oleh Ibnu Katsir, di samping telah menjadi- kan sekutu-sekutu bagi Allah yang mereka sembah, mereka juga mengajak manusia untuk melakukanhalyangsama. Kemudian Allah SWT me- merintahkan Rasulullah SAW un- tuk menyampaikan ancaman terhadap mereka: Qul tamatta'û (katakanlah: "Bersenang-senang- lah kamu). Artinya, bersenang- senanglah di dunia dengan keku- furankalian.Kalimatini,sekalipun menggunakan shîghah fi'l al-amr (bentuk kata perintah), akan tetapi menghasilkan makna al- tahdîdwaal-wa'îd(ancaman). Makna ini dapat disimpul- kan dari kalimat berikutnya: Fainna mashîrakum ilâ al-nâr (karena sesungguhnya tempat kembalimu ialah neraka"). Ini sebagaimana firman Allah SWT: Perbuatlah apa yang kamu kehen- daki; sesungguhnya Dia Maha Melihat apa yang kamu kerjakan (TQSFushilat[41]:40). Dijelaskan Imam al-Qur- thubi, ancaman terhadap mereka ini mengisyaratkan sedikitnya ke- nikmatan dunia. Pasalnya, kenik- matanduniatersebutterputus. Kata mashîrakum berarti maruddukum wa marji'ukum (tempat kembali kalian). Se- hingga ayat ini berarti: Tempat kembali kalian di akhirat kelak adalah neraka Jahannam. Bukan yang lain. Inilah balasan yang setimpal atas kejahatan dan ke- kufuranmerekadidunia. Diterangkan Ibnu Katsir, ayat ini sebagaimana firman Allah SWT: Kami biarkan mereka ber- senang-senang sebentar, kemudi- an Kami paksa mereka (masuk) ke dalam siksa yang keras (TQS Luk- man [31]: 24). Juga firman Allah SWT: (Bagi mereka) kesenangan (sementara) di dunia, kemudian kepada Kamilah mereka kembali, kemudian Kami rasakan kepada mereka siksa yang berat, disebab- kan kekafiran mereka (TQS Yunus [10]:70). Demikianlah perilaku jahat orang-orang kafir selama di du- nia. Kenikmatan yang Allah SWT anugerahkan kepada mereka tidak disyukuri. Di antara kenik- matan besar adalah diutusnya Rasulullah SAW dan risalah yang beliau bawa, Islam. Kenikmatan tersebut mereka tolak dan ing- kari. Mereka sendirilah meng- ubah kenikmatan dengan keku- furan, yang akhirnya berbuah ke- sengsaraan. Mereka dimasukkan ke dalam neraka Jahannam. Tak berhenti pada dirinya. Mereka memalingkan manusia dari Islam dan menjerumuskan mereka ke dalam neraka. Semoga kita ter- masuk yang terselamatkan dari proganda sesat mereka. Wal-Lâh a'lambial-shawâb.[]
    • 12 Media Nasional Maraknya artis menjadi calon legislator (caleg) merupakan sebuah kegagalan dari budaya politik di Indonesia. Caleg “Indonesia Idol” 2014 Media Umat | Edisi 104, 22 Jumadil Akhir - 6 Rajab 1434 H/ 3 - 16 Mei 2013 Angel LelgaAngel LelgaAngel Lelga Anang HermansyahAnang HermansyahAnang Hermansyah Ikang FauziIkang FauziIkang Fauzi Mandala ShojiMandala ShojiMandala Shoji Donny DamaraDonny DamaraDonny Damara Mahalnya jadi Caleg B esarnya animo untuk menjadi caleg bukan tanpa modal yang sedikit. Setidaknya para calon anggota legislatif itu harus merogoh koceknya dalam-dalam. Hasil penelitian disertasi doktornya, Wakil Ketua DPR Pramono Anung mengatakan, modal menjadi calon legislator tergantung latarbelakangsikandidat. Figur publik dan artis biasanya menyiapkan dana maksimal Rp 600 juta. Sementara birokrat dan pengusaha, setidaknya menyediakan Rp 6 milyar. “Anggaran artis lebih sedikit karena sudah punya modal popularitas,” katadia. Pramono mengakui biaya calon selama kampanye tak sebanding dengan pendapatan bersih anggota DPR, yang rata-rata Rp 50 juta per bulan. Namun, seorang pengusaha yang terpilih menjadi anggota DPR bisa memanfaatkan kemudahan akses informasi tentang kebijakan pemerintah. Bermodal jaringan bisnis, mereka dapat mengantisipasi kebijakan yang diterbitkanpemerintah. Direktur Eksekutif Pol-Tracking Institute Hanta Yuda menyatakan, tingginya biaya politik pada Pemilu 2014 bakal berdampak pada korupsi politik. Ia menegaskan, tidak sedikit dari calon legislatif yang berharap uangnya kembali. “Karena biaya politik tinggi bakal meningkatkan political costdanjugamemunculkanmoneypolitics,”kataHanta. Memulai debut sebagai calon legislator dari Partai NasDem, Taufik Basari, yang juga pengacara, menyiapkan dana Rp 200 juta. Sejak awal ia bertekad menghindari politik biaya tinggi. Jika dana yang dihabiskan terlalu banyak, ujar Taufik, legislator hanya berpikir mengembalikan modal selama kampanye.[]fm P anggung idola tak hanya di layar kaca. Rupanya, pentas idola juga akan digelar da- lam pemilihan anggo- ta legislatif tahun 2014. Bagaima- na tidak, banyak artis tampil sebagai calon anggota legislatif. Apakah para caleg selebritas itu dapat menjawab aspirasi masya- rakat? Setiap artis punya alasan mengapa mereka banting stir jadi politikus. Aktor film Donny Dama- ra, bakal calon legislatif Partai NasionalDemokrat(Nasdem)me- nerangkan ikutnya ia sebagai caleg karena ingin mendorong pembangunan infrastruktur de- nganmemangkasbirokrasi. “Saya mau memastikan jika dari sini Rp 10, sampai di daerah juga Rp 10," ujar Donny Damara di Jakarta. Lain Donny lain pula alasan pemain sinetron dan presenter Mandala Shoji. Ia beralasan ingin menghijaukan Indonesia. “Saya ingin menanam pohon. Tapi apa bisa di semua wilayah?Apabisa di bekaslahantambang?”katadia. Sederet nama artis papan atas meramaikan perebutan kursi DPR.AdaAnangHermansyah,Eko Patrio, Cornelia Agatha, Marisa Haque, Ikang Fauzi, Emilia Conte- sa,AngelLelgadll. Kordinator Forum Masyara- kat Peduli Parleman Indonesia (Formapi), Sebastian Salang me- nyatakan keberadaan caleg artis yang akan maju di Pemilu 2014 diyakini tidak akan membawa perubahanbaikkinerjaDPR. Menurutnya, partai politik menjadikan artis sebagai caleg hanya sebagai pendorong untuk memperoleh suara. "Partai prag- matis untuk mendulang suara yang besar. Artis-artis yang popu- ler dipakai untuk menghasilkan suara yang besar dan kursi di DPR," ujar Salang dalam jumpa pers di kantor sekretariat Formapi di Matraman, Jakarta Timur, Ahad (28/4). Salang menilai kebanyakan caleg yang diajukan minim kom- petensi terhadap tugas DPR yakni anggaran, legislasi dan penga- wasan. "Mayoritas artis direkrut tanpa melalui pembinaan parpol, meski ada beberapa yang sudah membina diri sejak lama di par- pol,"sebutnya. Dari catatan Formapi, hanya PKS, PKPI dan PBB yang tidak menyodorkan artis sebagai caleg- nya. Sementara partai lain utama- nya PAN paling banyak menyo- dorkan artis. PDIP memiliki 5 artis, Demokrat (5), Golkar (3), PAN (9), PKB (7), Gerindra (9), Hanura (3), Nasdem (6) dan PPP dengan 4 calegartis. Sedangkan pengamat poli- tik dari Universitas Airlangga Su- rabaya, Haryadi menilai, penye- bab kalangan artis yang memilih berpindah ke ranah politik karena merasa pamornya mulai memu- dar hingga berpikir untuk men- cari lahan baru, yaitu mencoba peruntungandiduniapolitik. Menurutnya, tujuan utama artis menjadi caleg untuk menda- patkan lahan baru untuk menge- ruk materi. "Biasanya artis yang lari ke sana adalah mereka yang sudah tidak laku, artinya pamor- nyasudahturun,"tegasHaryadi. Hal itulah yang membuat mereka memutuskan untuk ikut bergabung di ranah politik. "Jujur saja, saat ini profesi menjadi anggota dewan bukan hanya sekadar lahan politik, tapi juga lahan ekonomi yang memikat," tandasHaryadi. KegagalanParpol Pengamat komunikasi po- litik Effendi Gazali mengatakan, maraknya artis menjadi caleg merupakan sebuah kegagalan dari budaya politik di Indonesia. “Partai politik gagal menciptakan kader, dan di parlemen partai politik gagal menjaga marwah dari DPR,” tuturnya kepada Media Umat,Sabtu(27/4)Jakarta. Menurutnya, begitu putus asakah parpol sehingga tidak mampu lagi menciptakan kader. Dan bahkan, menurutnya, parpol tidak menghargai proses internal mereka sendiri. “Ini akan menim- bulkan perkelahian loh,” imbuh- nya. Ini bisa terjadi, lanjutnya, karena sudah ada kader, tiba-tiba adaartismasuk.“Iniakanmenghi- langkan kepercayaan diri kader partaiitusendiri,”paparnya. Apakah artis bisa memberi sumbangsih? Effendi menutur- kan beberapa berhasil. Namun, menurutnya, tidak sedikit dari mereka yang kadang datang, kadang enggak. “Terus kalau bicara diketawain sama teman- temannyadikomisi,”bebernya. “Yang paling bahaya kalau menganggap jika menjadi ang- gota DPR itu sebagai sambilan, inilah yang saya katakan meng- hilangkan marwah DPR,” terang- nya. Hal yang sama diterangkan, Yahya Abdurrahman. Menurut- nya,adanyacalegartismembukti- kan kalau parpol itu tidak memili- ki platfom/garis perjuangan dan ide-ide perjuangan. “Kenapa? Se- bab memilih artis karena popu- laritasnya, yang akan memikat suara,”bebernya. Ketua Lajnah Siyasiyah DPP Hizbut Tahrir Indonesia (HTI) ini menilai hal itu karena tidak ada- nya proses kaderisasi dari parpol dan bahkan dikuatkan dengan banyaknya partai yang membuka pendaftarancaleg. “Ini seperti ajang Indonesia Idol saja, ada pendaftaran, terus diseleksi lalu jadilah mereka yang menang karena dipilih,” imbuh- nya. Yahya menuduh bahwa seperti itulah demokrasi yang tidak bersandar dengan menca- lonkan seseorang itu yang benar- benarlayak. “Demokrasi memang hanya bertumpu pada popularitas, tidak bertumpu konsepnya pada orang-orang yang layak,” terang- nya. Kalau seperti ini kondisinya, menurutYahya,sama saja dengan menggadaikan nasib umat. “Ba- gaimana bisa menyerahkan nasib umat pada orang-orang yang kehidupannya kayak gituh kok, yang terjadi akan seperti artis putus nyambung-putus nyam- bungpernikahannya,”paparnya. Kualitas artis, terang Yahya, nyatanya tidak terdengar kiprah- nya di legislasi, karena modal me- reka cuma popular.“Memang ada satu dua artis yang modalnya se- lain popular dan punya kemam- puan, namun itu hanya sebagian kecil,” pungkasnya.[] fatih muja- hid
    • 13Media Nasional UDAH DIMAKLUMIN AJA?UDAH DIMAKLUMIN AJA?UDAH DIMAKLUMIN AJA? Oleh: Luky B Rouf Lajnah Dakwah Sekolah (LDS) Pusat Penulis dan Pemerhati Masalah Remaja UDAH DIMAKLUMIN AJA?UDAH DIMAKLUMIN AJA?UDAH DIMAKLUMIN AJA? Media Umat | Edisi 104, 22 Jumadil Akhir - 6 Rajab 1434 H/ 3 - 16 Mei 2013 Buruknya Legislasi dalam Sistem Demokrasi Sistem Islam memiliki proses legislasi yang khas, yang sangat berbeda dengan sistem demokrasi. MEDIA GAUL Berita terheboh beberapa pekan ini tentang perilaku ngawur yang ditun- jukkan siswi SMAN 2 Toli-toli, yang melecehkan gerakan shalat. Dalam video yang berdurasi 5 menit 33 detik, kelima siswa yang merekam keisengan mereka pada tanggal 9 Maret 2013, memperlihat- kan plesetan bacaan ayat-ayat Alquran (surah al-Fatihah) yang diiringi musik "one more night"-nya Maron Five serta goyang- analayalaHarlemShake. Jujur lho, ketika pas ada beberapa anakremajangelakuin, kayakkasusdiatas, maka ada yang minta untuk dimaklumin. Alasan utamanya, ya karena mereka masih remaja. Masih labil emosinya, masih cari jati diri, masih meluap-luap emosinya, dan lainsebagainya. Namun rupanya kita masih harus ngurut urat kesabaran kita, karena faktanya pada saat pencarian jati diri itu, remaja menemukannya di dunia pergaul- an mereka. Mereka menemukannya dari apa yang mereka dengar dan apa yang mereka tonton seperti film, sinetron, musik, majalah, koran, dsb. Wajar jika Akbar S Ahmed (1992) pernah mengung- kapkan, “tidak ada ancaman yang lebih gawatterhadapeksistensimasyarakatIslam daripadaancamanserbuanmediaBarat.” Perilaku remaja nyontek abis dari media sekuler, kalo ini terjadi pembiaran oleh ortu, lingkungan bahkan sekolah dan negara, maka akan menjadi sebuah kewa- jaran. Nah, pada saat itulah 'kewajaran', seperti sudah menjadi hukum tak tertulis di tengah masyarakat. Orang tua dan masyarakat menganggap wajar perilaku pelecehan shalat ala SMAN 2Toli-toli, pada saat yang bersamaan nggak tahu atau merasa biasa-biasa aja, ketika mereka pa- hamIslamataunggak. UdahKhilafahAja! Loh, koq gampang banget dikasih solusi khilafah? Ya iya memang itu solusi- nya. Mau solusi apa lagi coba? Sistem kapitalisme-sekularisme yang sekarang diterapkan udah jelas-jelas melahirkan generasi free thinker macam SMAN 2 Toli- toli. Maka pilihannya cuman ada sistem Islam, karena sistem selain Islam, termasuk Sosialisme-Komunismejugatelahgagal. Cobakitajujur,ulamasekaliberImam Syafi'i yang sudah jadi ulama semasa mudanya, hidup di sistem apa? Sistem khilafah, yakni di masa Khalifah Harun Ar- Rasyid. Kemudian, ada ilmuwan Muslim Jabir ibn Hayan, Al-Khawarizmi, dll, juga hidupdimasakhilafah. Nah, pertanyaannya pentingnya kenapa ulama dan ilmuwan tersebut bisa muncul di masa khilafah? Karena para ilmuwan atau ulama tersebut mempunyai idealisme atau semacam mimpi besar, dan idealisme mereka terpelihara, karena didukung oleh keluarga, masyarakat dan sistemyangkondusifsaatitu. Bandingkan dengan kondisi seka- rang. Seorang remaja atau pelajar seka- rang, jangankan punya idealisme, lha wong masa depan mereka aja mau ke mana, mereka masih nggak tahu. Kalo pun ada sebagian remaja Muslim yang punya idealisme, tapi idealismenya mengalami pasang surut. Ya, tergantung godaan dan ujiandisekitarnya,kuatnggakdihadapinsi remajatersebut. Seorang remaja Muslim yang punya idealisme ingin menjaga ketakwaannya, tapi pada saat bersamaan penggoda ketakwaan itu ada sekitar remaja. Pengin- nya nggak ngelakuin pacaran, tapi teman- temannya ngolok-olok dibilangin kuno kalo nggak pacaran. Trus, teve ngasih conto gimana ngegaet lawan jenis. Kemu- dian negara malah memfasilitasi sarana pacaran, maka remaja yang tadi punya idealisme, bisa tergoda dan akhirnya ngelakuinpacaran. Nah, dalam sistem khilafah Islam, diterapkan pilar pengontrol individu, masyarakat dan negara. Misal, ketika syariat memerintahkan seseorang untuk bertakwa, "Bertakwalah kepada Allah di mana saja engkau berada.." (HR. Ahmad danalTirmidzi). Maka masyarakat menyokongnya dengan kontrol berupa amar ma'ruf nahyi munkar, seperti perintah, 'Barang siapa di antara kalian yang melihat kemungkaran, hendaklah dia merubahnya dengan tangannya. Apabila tidak mampu maka hendaknya dengan lisannya. Dan apabila tidak mampu lagi maka dengan hatinya, sesungguhnyaitulahselemah-lemahiman.'.” (HR.Muslim) Kemudian negara juga ikut memeli- hara dengan hukum-hukum yang diterap- kannnya sesuai dengan perintah,“Hendak- lah kamu memutuskan perkara di antara mereka dengan hukum yang diturunkan oleh Allah, dan janganlah kamu mengikuti hawanafsumereka.(TQS.al-Maidah:49). So, dengan adanya kontrol masyara- kat serta penerapan hukum oleh negara, maka itu bisa menjaga individu-indivudu warganya—yang berpotensi melakukan kemaksiatan—agar senantiasa terikat dengan hukum-hukum syariah, yang denganketerikatannyaituiadijamindapat meraihkebahagiaanduniadanakhirat.[] T ahukah Anda bagai- mana proses sebuah undang-undang lahir? Tentu tidak banyak yang tahu. Tiba-tiba sudahdibahasdigedungDPR. Prof Fahmi Amhar, pakar Geospasial, yang bersama rekan- rekannya di Bakorsutanal, pernah menjadi penyusun naskah akade- mik RUU di bidangnya, menutur- kan pengalamannya dalam me- nyusun UU. “Mulai dari proses awal hingga akhir, semuanya amburadul. Dalam pansus itu, yang peduli hanya sedikit. Se- dangkan yang kompeten di bidang tersebut hanya satu orang, karena dialah satu-satunya alumni geologi. Bahkan, ada juga yang komentarnya ngaco,” kata- nya dalam Dirasah Syar'iyyah Ammah edisi 23 dihelat oleh Lajnah Tsaqafiyah DPP Hizbut Tahrir Indonesia (HTI), Sabtu (27/4) di Kantor DPP HTI, Crown Palace,Jakarta. Pembahasan RUU di DPR kadang dilakukan secara terbuka, dan diliput wartawan. Biasanya, pembahasannya sangat alot, bahkan dalam sehari hanya satu pasal yang selesai. Tetapi, karena waktu tidak cukup, rapat pun berpindah ke hotel. “Nah, kalau sudah di hotel, rapat yang alot ketika di DPR itu akan berlang- sung kilat. Karena, nggak ada war- tawan,”paparnya. Fakta tersebut, menurut Ketua Lajnah Tsaqafiyah DPP HTI Hafidz Abdurrahman, membukti- kan bahwa sistem demokrasi, yang diklaim lebih baik daripada sistem Khilafah itu, jelas bobrok. “Ini jelas jauh berbeda dengan legislasi di Negara Khilafah,” sambungnya. Dalam sistem Khilafah, ke- wenangan legislasi hukum tidak diserahkan kepada Majelis Umat, tetapi diserahkan kepada khali- fah. Karena, Ijmak Sahabat me- nyatakan demikian. Khalifah pun, dalam penyusunan UU, harus berdasarkan sumber wahyu, jika terkait dengan UU Syariah. Yaitu, Alquran, Sunnah, Ijmak Sahabat danQiyas. Selain itu, lanjutnya, “Baik hukum, pandangan dan pemikir- an yang dijadikan UU harus dibangun berdasarkan akidah Islam atau terpancar dari akidah Islam. Juga tidak boleh berten- tangandenganIslam,”jelasnya. Ia menerangkan, dalam prosesnya, khalifah pun tidak mengadopsihukumkarenafaktor mazhab, tetapi karena dalil yang paling kuat. Sedangkan dalam perkara yang terkait dengan pan- dangan, strategi dan sejenisnya diambil yang paling kuat berda- sarkan aspek khibrah (keahlian). Dalam perkara operasional, dilak- sanakan atau tidak, bisa diambil berdasarkan suara mayoritas.[] fatih
    • 14 Ekonomi Plat Merah versus Plat Hitam Sebagai pengusaha, sudah pasti dia akan membela kepentingan swasta lainnya. Bisnis Syariah Pengusaha danTantangan Pasca Berdirinya Khilafah (5-Tuntas) Muhammad KarebetWidjajakusuma Ketua LKP Pusat Praktisi Bisnis Syariah bidang Konsultasi, Riset danTraining Alhamdulillah…Luarbiasa…AllahuAkbar!!! Muslimpreneur, kini kita tuntaskan bedah tantangan yang terakhir berikut peran strategis yang bisa dan sudah seharusnyadimainkanolehpengusaha. Inilah tantangan yang terakhir, yaitu penghapusan dan pengubahan berbagai realitas buruk peninggalan sistem lama dalamsegalabentuknyadisegalabidang,seperti: (1) pengubahan sistem pendidikan sekuler menjadi sistempendidikanIslami; (2) penataan ulang media massa (koran, majalah, TV, internet,dll)agarsesuaidenganIslam; (3) transformasi sistem uang kertas (fiat money) menjadi sistemmatauangdinardandirhamberbasisemasdanperak; (4) perbaikan sistem birokrasi yang korup menjadi sistembirokrasiyangbersihdanprofesional; (5)penataanulangkepemilikanumum(sepertilistrik,air, dan berbagai tambang) dan redistribusinya secara adil menurutIslam; (6) reorganisasi dan restrukturisasi angkatan bersenjata dankepolisian; (7) penyelesaian berbagai tanggung jawab yang terkait hak dan kewajiban sebelum Khilafah, seperti masalah utang piutang, sengketa tanah, termasuk berbagai kejahatan (pembunuhan, pencurian, dll) yang belum divonis oleh pengadilansebelumKhilafah. Muslimpreneur, untuk mengatasinya diperlukan upaya- upayastrategisberikutini: (1) penyiapan berbagai peraturan (termasuk penataan lembaganya) baik undang-undang syar'i (qanun syar'i) maupun undang-undang administratif (qanun idari) dalam bidang-bidang yang ditangani, seperti undang-undang pendidikan, undang-undang media massa, undang-undang birokrasi (jihaz idari), undang-undang kepemilikan umum, undang-undang kemiliteran dan kepolisian, undang-undang dinardandirham,dansebagainya; (2) penyiapan berbagai sarana dan prasarana fisik yang dibutuhkan,sepertidana,infrastruktur,dansebagainya; (3) penyiapan sumberdaya manusia baru, yang memiliki kepribadian Islam (syakhshiyah Islam) dan kapabilitas profesional. Mengenai para pejabat atau pegawai dari sistem lama, mereka masih dibolehkan berada dalam struktur Khilafah, dengan syarat mereka memberikan loyalitasnya (al-wala`) kepadaKhilafahdansyariahIslam. Ini mengenai tantangan-tantangan yang pasti muncul. Lalu, bagaimana dengan tantangan yang tidak pasti yang bisa saja muncul namun bisa juga tidak? Nah, untuk tantangan seperti ini, negara memberikan solusi sesuai problem yang terjadi. Misalkan terjadi pembangkangan sebagian personil militer dan mereka telah berbuat anarkis (kekerasan) terhadap umat atau pengemban dakwah. Maka negara menerapkan hukum bughat atas mereka. Pertama-tama dilakukan upaya persuasif dengan jalan dialog (al-murasalat). Jika gagal, maka negara akan menerapkan langkah tegas yaitu penumpasan dengansenjata(QSAl-Hujurat[49]:9). Muslimpreneur yang sama-sama merindukan rahmat AllahSWT, Demikianlah sekilas penjelasan mengenai berbagai tantangan potensial yang diperkirakan akan muncul dan bagaimana langkah-langkah mengatasinya, saat Khilafah berdirilagi nanti.InsyaAllah. Semua ini disampaikan dengan harapan agar umat menyadari dengan sepenuhnya bahwa perjuangan tidaklah selesai dengan berdirinya Khilafah. Justru kembalinya Khilafah adalah tahap awal penerapan ideologi Islam secara praktis. Diharapkan juga umat menginsyafi, bahwa sungguh tidak mudah menghadapi tantangan-tantangan yang mungkin muncul pasca berdirinya Khilafah nanti. Pengorbanan memang harus kita siapkan, karena sunnatullah mengajarkan tidak akan ada kemenangan dan kemuliaan, tanpa pengorbanandanperjuangan.Nopains,nogainsBrother... Namun yakinlah di tengah kesulitan, marabahaya, dan malapetaka yang mungkin akan timbul nanti, termasuk kemungkinan serangan negeri kafir atas khilafah, wajib kita yakini bahwa hasil finalnya sudah jelas dan amat menggembirakan:Islamakanmenang.Kekafiranakanhancur. Laa rayba fiihi. Alhamdulillah. Maha Benar Allah yang telah berfirman: “Mereka hendak memadamkan cahaya (agama) Allah dengan mulut (ucapan-ucapan) mereka, dan Allah tetap menyempurnakan cahaya-Nya meskipun orang-orang kafir benci; Dia-lah yang mengutus Rasul-Nya dengan membawa petunjuk dan agama yang benar agar Dia memenangkannya di atas segala agama-agama meskipun orang-orang musyrik benci.”(QSAsh-Shaff[61]:8-9) Muslimpreneur, pada tantangan terakhir inilah, peran strategis pengusaha akan lebih dalam. Menajamkan peran- peran sebelumnya sebagai 'juru bicara' khilafah, 'teladan inspirator motivator', dan memberikan pengorbanan. Peran dimaksud adalah pengusaha dapat mengambil peran sebagai bagian utama dalam komponen Muslim pertama yang siap menghadapi perubahan sistem dari sekarang. Dengan menyiapkan seluruh aspek bisnisnya agar sesuai dengan aturan Islam. Menyiapkan diri dan keluarganya untuk ber- Islam secara kaffah. Menyiapkan kolega, mitra bisnis dan masyarakat sekitarnya untuk sama-sama hijrah menuju sistem hidup Islam seutuhnya. Sebagai benchmark, kiranya teladan para shahabat pengusaha di era Nabi Muhammad SAW, mestinya sudah lebih dari cukup untuk semua itu. Bahkan, shahabat pengusaha menjadi komponen utama perubahan dari sistem jahiliyah menuju sistem hidup Islam. Maka tak heran jika 9 dari 10 shahabat Nabi SAW yang dijamin masuk surga adalah shahabat yang berstatus Pengusaha! Subhanallah. Bunga mawar dibeli seikat, jadi dibeli sebagai bunga terindah Muslimpreneur mari satukan tekad, jadi Pengusaha PejuangSyariahdanKhilafah![] Media Umat | Edisi 104, 22 Jumadil Akhir - 6 Rajab 1434 H/ 3 - 16 Mei 2013 “S aya minta swasta lawan BUMN," u c a p M e n t e r i BUMN, Dahlan Is- kan, pada Mandiri CFO Forum, di Hotel Ritz Carlton, Senin, (22/4) lalu. "Ada satu logi- ka. Kalau BUMN terlalu maju, tidak baik. Tolong swasta menge- tahui bahwa BUMN bergerak ce- pat, ekspansi sangat besar," tam- bah pemilik usaha Jawa Pos Grup itu. Sebagai seorang pejabat pemerintah yang juga pengusa- ha, pernyataan Dahlan sebenar- nya bukan suatu yang aneh. Sebagai pengusaha, sudah pasti dia akan membela kepentingan swasta lainnya. Karena itu tidak aneh juga saat mantan Dirut PLN ini menganggap sebuah dilema ketika ekspansi BUMN akan mempersempit ruang gerak perusahaan swasta. Namun yang anehnya ada- lah sebagai pejabat pemerintah seharusnya membesarkan per- usahaan plat merah ketimbang plat hitam. Dengan kekuatan sumberdaya, baik keuangan, finansial dan sumberdaya manu- sia, menjadi 'fardu ain' bagi pe- merintah membesarkan perusa- haannegara. Sebab perusahaan negara mempunyai tugas bukan sekadar mencari untung (seperti swasta), tapi juga mempunyai kewajiban menjaga sumberdaya yang dimi- liki negara, terutama sumberdaya alam Indonesia. Bahkan lebih ja- uh adalah mengangkat kesejah- teraan rakyat. Jika kemudian pemerintah memilih membesarkan swasta, maka kapitalisme besar-besaran yang bakal terjadi. Apalagi kemu- dian pemerintah memberikan pengelolaan sumberdaya alam yang mengusai hajat hidup orang banyak kepada swasta. Saat ini saja sudah tampak jelas, bagaimana banyaknya per- usahaan swasta, bukan hanya PMDN (Penanaman Modal Dalam Negeri), tapi juga PMA (Pena- naman Modal Asing) yang justru mengelola sumberdaya alam In- donesia. Perusahaan-perusahaan swasta mengusai sumberdaya alam Indonesia dari mulai hulu sampai hilir. Contohnya saja di sektor migas, data menyebutkan ham- pir 74 persen kegiatan usaha hu- lu atau pengeboran minyak dan gas (migas) di Indonesia dikuasai perusahaan asing. Perusahaan nasional cuma menguasai 22 persen dan sisanya konsorsium asing dan lokal. Bahkan kontraktor migas di Indonesia dipegang perusahaan swasta multinasional. Kelompok pertama yang super major terdiri dari ExxonMobile, Total Fina Elf, BP Amoco Arco, dan Texaco yang menguasai cadangan minyak 70 persen dan gas 80 persen Indo- nesia. Kedua, Major (Conoco, Repsol, Unocal, Santa Fe, Gulf, Premier, Lasmo, Inpex dan Japex yang menguasai cadangan mi- nyak 18 persen dan gas 15 per- sen). Ketiga, perusahaan inde- penden (menguasai cadangan minyak 12 persen dan gas 5 persen. Contoh tersebut memberi- kan gambaran bahwa sumberda- ya alam Indonesia memang su- dah benar-benar dikuasai swasta, terutama asing. Apalagi kemudi- an sejak era reformasi bergulir, pemerintah begitu jor-joran me- lakukan privatisasi perusahaan negara. Privatisasi BUMN yang pe- merintah lakukan cenderung tidak lagi memperhatikan peran yang dapat dilakukan perusaha- an negara dalam pembangunan nasional. Pemerintah sekadar mencari tambahan pemasukan negara dari penjualan saham. Tapi sisi lain yang lebih penting justru tidak lagi menjadi bahan pertimbangan. Apakah perusahaan negara tersebut strategis atau tidak? Atau perusahaan negara yang akan diprivatisasi mengelola sumberdaya alam atau tidak? Contoh perusahaan yang telah diprivatisasi adalah PT. Aneka Tambang (Antam), PT. Timah, PT. Bukit Asam, PT. Telkom, PT Indosat, dan PT. Krakatau Steel. Padahal perusahaan-peru- sahaan tersebut sangat strategis. Bahkan bukan masuk dalam ka- tegori perusahaan yang 'sakit'. Jadi alasan bahwa privatisasi untuk menyehatkan perusahaan negara hanya akal-akalan. Bah- kan tahun ini, pemerintah sudah berancang-ancang memprivati- sasi lima BUMN lagi, salah sa- tunya PLN Batam. Kapitalisme memang sudah menjadi bagian hidup di negeri ini. Karena itu, jangan berharap terlalu banyak dari pejabat- pejabat yang lebih mementing- kan kapitalis, ketimbang rakyat.[] joe lian
    • 15Siyasah Syar’iyyah Oleh: Fathiy Syamsuddin Ramadhan An Nawiy, Lajnah Tsaqafiyah DPP HTI Kebijakan PertelevisianKebijakan Pertelevisian Khilafah IslamiyahKhilafah Islamiyah Kebijakan Pertelevisian Khilafah Islamiyah Kebijakan pertelevisian Khilafah Islamiyahdapatdisarikansebagaiberikut: Pertama, televisi sebagai wasilah (sarana) untuk merealisasikan tujuan- tujuan tertentu, hukum asalnya adalah mubah. Penggunaan dan pemanfaatan televisi di dalam Daulah Khilafah Islamiyah mengacu kepada kepentingan dakwah Islamiyah serta kemashlahatan kaum Mus- lim. Departemen penerangan adalah de- partemen yang memiliki kewenangan untuk mengatur pertelevisian berdasarkan syariat Islam. Di dalam negeri, kebijakan pertelevisian dirancang untuk mewujud- kan tiga hal; (1) membangun masyarakat Islam yang kokoh dan kuat, (2) melenyap- kan unsur-unsur yang bisa menghancur- kan sendi-sendi masyarakat Islam, serta (3) menonjolkan kebaikan dan keluhuran Islam. Adapun di luar negeri, ditujukan untuk menerangkan Islam, baik dalam keadaan damai maupun perang, dengan penerangan yang menampakkan ke- agungan dan keadilan Islam; kekuatan Daulah Islamiyah, baik militer, ekonomi, serta peradabannya; serta menerangkan kerusakan sistem selain Islam, kedzaliman dan kerusakannya, serta kelemahan negara-negara kafir, baik militer, ekonomi, danperadabannya. Kedua, Khilafah Islamiyah menge- luarkan kebijakan-kebijakan yang berhu- bungan dengan pendirian stasiun-stasiun televisi, lalu lintas frekuensi dan gelom- bang, program siaran dan pengaturan waktu tayang, baik secara global maupun rinci. Berkaitan dengan pendirian stasiun televisi, Khilafah Islamiyah menggariskan ketentuansebagaiberikut:  Warga negara Khilafah, baik Muslim maupun non Muslim tidak dilarang men- dirikan stasiun televisi. Hanya saja, asas, tujuan, dan kegiatannya tidak boleh ber- tentangandenganakidahdansyariatIslam.  Pendirian stasiun televisi harus seizin dan sepengetahuan negara Khilafah. Izin pendirian stasiun televisi diberikan secara cuma-cuma, tanpa ditarik biaya sepeserpun. Ini ditujukan agar televisi ber- peran secara maksimal dalam memberikan informasi dan tayangan yang bermanfaat bagi rakyat, serta khususnya bagi pihak- pihak yang membutuhkan informasi- informasi secara khusus, seperti lembaga- lembaga negara Khilafah Islamiyah. Kemudahan dalam perizinan juga akan memudahkan tugas negara Khilafah dalam konteks penyebaran dakwah Islamiyah, edukasi umat, serta propaganda Islam ke luarnegeri.  Stasiun televisi yang didirikan oleh orang-orang kafir diawasi secara ketat agar tidak digunakan kecuali pada perkara- perkara yang memang disetujui oleh sya- riat Islam. Oleh karena itu, mereka dilarang mendirikan televisi untuk mendakwahkan atau mempropagandakan agama mereka; lebih-lebih lagi untuk menyerang, mera- gukan, dan mengkritik Islam. Negara Khila- fah bisa mencabut izin pendirian stasiun televisi, dan menjatuhkan sanksi yang sangat keras kepada mereka, jika terbukti melakukanpenyimpangan.  Setiap warga negara, baik Muslim maupun non Muslim, dilarang bekerja sama dengan warga negara Daar al-Kufr dalam pendirian sebuah stasiun televisi di dalam negara Khilafah, kecuali mendapat- kan izin secara khusus dari Khalifah. Ada- pun pendirian stasiun televisi di Daar al- Kufr, maka, jika hal itu bermanfaat untuk kepentingan penyebaran dakwah Islami- yah, maka, negara Khilafah akan memberi- kanizin,bahkan,mendukungsecaramaksi- mal.  Negara Khilafah Islamiyah mendiri- kan stasiun televisi di pusat pemerintahan dan wilayah negeri Khilafah yang dileng- kapi dengan teknologi canggih dan muta- khir. Penggunaan satelit yang diorbitkan di angkasa luar merupakan bagian integral dan penting untuk mendukung teknologi informasi di negeri Khilafah Islamiyah. Program-program siaran tertentu, bisa saja diwajibkan untuk direlay di seluruh stasiun televisi,dengantetapmemberikankelelua- saan bagi tv-tv daerah dan swasta untuk membuat program-program siaran yang bermututinggi. Adapun berkaitan dengan penga- turan frekuensi dan gelombang, maka Khilafah Islamiyah akan merumuskan kebijakan-kebijakansebagaiberikut:  Setiap stasiun televisi hanya diizin- kan menggunakan frekuensi dan gelom- bang yang telah diintetapkan oleh negara. Selain untuk memudahkan pengontrolan, pengaturan tersebut juga ditujukan untuk menghindari gangguan-gangguan pada stasiun lain, atau gangguan pada instansi- instansi lain yang menggunakan frekuensi dan gelombang suara tertentu, seperti alat navigasi pesawat terbang, radar, dan lain sebagainya. Siapa saja yang melanggar batas-batas yang sudah ditetapkan, akan dikenai sanksi sekadar dengan tingkat pelanggarannya.  Barangsiapa dengan sengaja meng- ganggu, atau menggunakan frekuensi yangbukan frekuensi yangditetapkan oleh negara, dikenai sanksi ta'zir berdasarkan ijtihad seorang qadliy. Memang benar, frekuensi dan gelombang suara adalah ke- pemilikan umum, yang setiap orang memiliki hak dan andil yang sama. Hanya saja, ketika penggunaannya oleh orang banyak bisa menimbulkan kericuhan dan perselisihan di antara mereka, maka, Kha- lifah wajib mengatur pemanfaatannya untuk menghilangkan perselisihan dan kekacauan.  Penggunaan frekuensi dan gelom- bang harus mengacu kepada kepentingan IslamdankaumMuslim. Sedangkanpengaturanwaktutayang dan program siaran, maka ketentuannya adalahsebagaiberikut:  Setiap stasiun diberi keleluasaan untuk mengatur waktu tayang dan prog- ram siaran. Hanya saja, dalam kaitannya dengan program siaran, setiap stasiun televisi hanya diperbolehkan membuat program-program siaran yang dibolehkan oleh syariat, seperti olah raga, hiburan- hiburan mubah, talk show, dan lain-lain. Negara Khilafah dilarang secara syar'i mengharamkan perkara-perkara yang mubah, kecuali jika perkara-perkara yang mubah tersebut mengandung bahaya (dlarar) atau bisa mengantarkan kepada bahaya.  Khalifah boleh saja menetapkan program-program siaran yang wajib disiar- kan atau ditayangkan di seluruh stasiun televisi, seperti adzan di setiap waktu sha- lat, edukasi untuk jihad, kebijakan dan perkembangan politik luar negeri Khilafah Islamiyahdanlainsebagainya.  Program siaran televisi dilarang me- nayangkan hal-hal yang diharamkan oleh Islam, seperti infotainmen ghibah, pemuja an terhadap materi, penonjolan hal-hal yang berbau seksualitas, tabarruj, serta siaran-siaran yang merendahkan akhlak manusia, dan lain sebagainya. Siapa saja yang membuat program-program siaran yang bertentangan dengan syariat dan akhlakIslam,akandikenaisanksita'zir.  Program-program siaran yang me- ngandungunsur-unsuryangbertentangan dengan akidah dan syariah, dibekukan dan dilarang seketika, tanpa menunggu-nung- gu waktu lagi. Begitu juga program- program yang menjajakan pemikiran- pemikiran kufur, seperti demokrasi, liberal- isme, pluralism, nasionalisme, dan lain sebagainya, semuanya dilarang ada dalam program-program siaran televisi. Begitu juga program-program siaran yang dituju- kan untuk meragukan kesempurnaan Islam,semuanyadilarangtanpakomentar.  Semua program siaran televisi yang ada di dalam Khilafah Islamiyah, diarahkan kepada penguatan masyarakat Islam, pen- jauhan masyarakat dari unsur-unsur yang bisa merusak sendi-sendi masyarakat Is- lam, serta penonjolan ketinggian Islam di tengah-tengahmasyarakat.  Khalifah tidak melarang peng- gunaan televisi sebagai sarana untuk per- niagaan, pemasaran produk dagang dan jasa, serta untuk kepentingan-kepentingan bisnis lainnya. Rakyat juga tidak dilarang membuat TV berlangganan; asalkan prog- ram-program siarannya tidak berten- tangandenganakidahdansyariah.  Adapun program-program siaranTV yangberasaldarinegara-negarakafir,maka hal ini perlu dilihat. Jika negara kafir terse- but statusnya adalah negara kafir harbiy fi'lan, maka seluruh produk mereka dila- rang beredar di negara Khilafah. Hu- bungan dengan mereka adalah perang secara langsung. Adapun terhadap negara- negara kafir yang menjalin perjanjian de- ngan negara Khilafah, maka program- program siaran TV boleh saja dibeli, atau ditayangkan di dalam negara Khilafah, asalkan tidak bertentangan dengan akidah dansyariatIslam. Pasalnya,negaraKhilafah boleh melakukan transaksi jual beli, atau transaksi-transaksilain dengan negara kafir harbiy yang membuat perjanjian dengan Khilafah Islamiyah. Hanya saja, jika prog- ram-program siaran itu dikhawatirkan bisa melemahkan sendi-sendi masyarakat Islam, maka Khilafah bisa saja membuat kebijakan larangan merelay program- programTVmereka. Inilah kebijakan pertelevisian Khila- fah Islamiyah. Dengan kebijakan-kebijakan di atas, televisi menjadi sarana membentuk dan memperkuat masyarakat islami, serta menyebarkan dakwah Islam ke seluruh penjuru dunia. Kebijakan di atas tentu saja bertentangan secara diametrikal dengan kebijakan pertelevisian dalam sistem kapitalis-sekuler yang tegak di atas kapi- talisme-sekulerisme. Wallahu a'lam bish shawab.[] Media Umat | Edisi 104, 22 Jumadil Akhir - 6 Rajab 1434 H/ 3 - 16 Mei 2013
    • 16 Muktamar Khilafah 2013 Media Umat | Edisi 104, 22 Jumadil Akhir - 6 Rajab 1434 H/ 3 - 16 Mei 2013
    • 17Muktamar Khilafah 2013Media Umat | Edisi 104, 22 Jumadil Akhir - 6 Rajab 1434 H/ 3 - 16 Mei 2013
    • 18 Fokus 1. Skenario kapitalisme Gigihnya pemerintah menaikkan BBM dengan alasan menjadi beban berat APBN tidak lepas dari skenario kapitalisme. Bermula dengan lahirnya UU Migas, pemerintah berupaya menghapus subsidi BBM. Padahal kenaikan BBM tersebut akan menggiring rakyat menuju neokolonialisme (penjajahan gaya baru) melalui liberalisasi BBM. Dengan demikian BBM akan dikuasai perusahaan asing mulai dari hulu (eksplorasi minyak) sampai hilir (pom bensin/SPBU). Kenaikan harga BBM hanya menguntungkan mafia BBM asing dan anteknya. Bahkan mantan Menteri Perekonomian, Rizal Ramli memperkirakan, mafia migas tersebut memperoleh fee sedikitnya 2 dolar AS/barel dari minyak mentah (400.000 barel/hari) dan minyak jadi yang diimpor (500.000 barrel). Fee 2 dolar AS/barel ini saat harga minyak masih sekitar 60 dolar AS/barel. Kini, setelah harganya di atas 90 dolar AS/barel, keuntungannya sudahpastimelangit. 2. Rakyat kian menderita Sudah pasti kenaikan/penghapusan subsidi BBM bakal memicu harga kebutuhan pokok dan biaya hidup rakyat. Sebab kenaikan BBM sudah pasti akan makin menyusahkan kehidupan rakyat. Apalagi hasil perhitungan Badan Pusat Statistik (BPS), jika BBM bersubsidi naik Rp 500/liter, secara langsungakanmenaikkanjumlahpendudukmiskin0,25persen. Belum lagi dampak tidak langsung dengan naiknya biaya angkutan yang mempengaruhi harga barang dan jasa, maka pertambahan penduduk miskin akan makin besar. Menaikkan harga BBM subsidi sebagai bentuk mendzalimi dan diskriminatif terhadap rakyat. Padahal mendzalimi hukumnya haram. Jadi apapun bentuknya, pembatasan konsumsi BBM bersubsidiataumenaikkanhargaBBM,rakyatmemangharusmenolak. 3. Akal-akalan Pemerintah Pemerintah beralasan subsidi BBM selama ini tidak tepat sasaran karena yang menikmati adalah orang-orang yang mampu (kaya). Alasan lainya, subsidi menjadi beban berart APBN. Karena itu, pemerintah berniat mencabut subsidi BBM. Pendapat ini hanya akal-akalan pemerintah. Selama ini yang menjadi beban APBN bukan subsidi, tapi utang negara yang hanya dinikmati segelintirorang,ditambahlagibungautangtersebut. Jika dikatakan subsidi hanya dinikmati orang kaya? Alasan itu juga tak masuk akal. Orang kaya di Indonesia yang memiliki mobil mewah kurang dari 5 persen. Faktanya yang banyak menggunakan BBM adalah supir bis, metromini, mikrolet,supirtruk,nelayan,danpengendaramotor.[]joelian Dalam pertemuan dengan Presiden Susilo Bambang Yudhoyono, Senin (29/4), Menteri ESDM Jero Wacik menyatakan, pemerintah akan menaikkan harga BBM secara pukul rata (satu harga). M asih ingat saat p e m e r i n t a h berusaha 'mera- yu' Majelis Ula- ma Indonesia (MUI) mengeluarkan fatwa haram bahan bakar minyak (BBM) subsidi untuk orang yang mampu alias kaya? Itu terjadi sekitar pertengahan tahun 2011 lalu. Namun rencana mengeluarkan fatwa tersebut kandas di tengah jalan. Itu salah satu saja yang pemerintah lakukan untuk me- wujudkan rencana menaikkan harga BBM subsidi. Selain ber- kampanye di berbagai media, termasuk mamasang spanduk bertuliskan 'Premium adalah BBM Bersubsidi Hanya Untuk Golong- an Tidak Mampu' di setiap sudut Stasiun Pengisian Bahan Bakar Umum (SPBU). Namun keinginan pemerintah membatasi pembe- lian BBM subsidi pada tahun 2011 batal. Bukanberartirencanaterse- but berhenti. Niat pemerintah membatasi pembelian atau me- naikkan harga BBM subsidi tidak pernahberhenti. Pada Jumat, 30 Maret 2012, Pemerintah bersama DPR RI menggelar rapat paripurna untuk memutuskan kenaikan harga BBMsubsidi. Rapat yang berlangsung alot hingga berakhir pada dini harinya (Sabtu, 31 Maret 2012) akhirnya memutuskan penunda- an kenaikan BBM per 1 April 2013. Saat itu pemerintah sudah menyi- apkan skenario kenaikan BBM subsidi sebesar Rp 1.500/kg dari Rp4.500/kg. Pembatalan penaikan BBM bukanberartirakyatbisabernafas lega. Pasalnya dalam Rapat ParipurnaDPRRIyangmembahas Undang-undang (UU) Anggaran Pendapatan Belanja Negara Per- ubahan (APBN-P) 2012 itu tetap memberikanlampuhijaubagipe- merintah menaikkan harga BBM sewaktu-waktu. Terlihat dari ke- sepakatan Pasal 7 Ayat 6a UU APBNP2012. Pasal tersebut menyebut- kan, “Dalam hal harga rata-rata minyakIndonesia(IndonesiaCrude Oil Price/ICP) dalam kurun waktu berjalan mengalami kenaikan atau penurunan rata-rata sebesar 15 persen dalam 6 bulan terakhir dari harga minyak internasional yang diasumsikan dalam APBN-P TahunAnggaran2012,pemerintah berwenang untuk melakukan pe- nyesuaian harga BBM bersubsidi dankebijakanpendukung.” Batal menaikkan BBM sub- sidi, pemerintah lalu menyiapkan opsi baru pembatasan pembelian BBM subsidi yakni mobil di atas 1.500 cc wajib membeli BBM non subsidi. Alasan pemerintah, stok BBM subsidi makin menipis. Na- mun rencana tersebut pun batal terlaksana. Gagal di tahun 2012, peme- rintah kembali menggelontorkan isu penaikan BBM subsidi. Kali ini dengan skenario yang lebih 'ma- tang' lagi. Misalnya, menetapkan dua harga BBM subsidi yakni BBM untuk kendaraan motor dan ang- kutanumumRp4.500/liter(tetap) dan BBM untuk mobil pribadi Rp 6.500/liter(naikRp2.000/liter). Namun rencana itu seper- tinya batal. Dalam pertemuan dengan Presiden Susilo Bambang Yudhoyono, Senin (29/4), Menteri ESDM Jero Wacik menyatakan, pemerintah akan menaikkan har- ga BBM secara pukul rata (satu harga). Jero menjelaskan, angka kenaikan masih dibahas. Namun, harga baru BBM dipastikan di bawahRp6.500perliter. Untuk mengantisipasi dam- pak kenaikan BBM, pemerintah menyiapkan kompensasi yakni penambahan jatah beras untuk rakyat miskin (raskin) selama em- pat bulan, Program Keluarga Ha- rapan (PKH) dan Bantuan Sekolah RakyatMiskin. Melihatkronologistersebut, rencana pemerintah menaikkan hargaBBMsubsidisudahberlang- sung lama. Bahkan sejak Purno- moYusgiantoro menjabat Mente- ri Energi Sumber Daya Mineral (ESDM),pemerintahbersamaDPR RI telah melahirkan UU No. 22/2001 tentang Minyak dan Gas (Migas). Dengan UU tersebut, pe- merintah berharap bisa melepas penjualan BBM pada mekanisme pasarbebas. Beban APBN? Salah satu alasan pamung- kas yang pemerintah ungkapan untuk menaikkan BBM adalah beban APBN yang kian berat de- ngan adanya subsidi tersebut. Dalam APBN 2013, pemrintah memberikan pagu belanja sub- sidi energi sebesar Rp274,7 tril- yun dengan perincian subsidi lis- trik Rp 80,9 trilyun dan subsidi BBM Rp 193,8 trilyun dengan volumesebesar46jutakiloliter. Perhitungan pemerintah, dengan harga keekonomian pre- mium Rp 9.500/liter, maka de- ngan harga Rp 4.500/liter, peme- rintah memberikan subsidi Rp 5.000/liter. Jika melihat perhi- tunganbiayaproduksiBBM,maka sebenarnya istilah 'subsidi' justru menipurakyat. Pemerintah selalu menyam- paikan bahwaharga minyakbumi di dalam negeri sama dengan minyak dunia. Misalnya, dengan harga minyak dunia 120 dolar AS/barel dan biaya produksi sampai menjadi BBM 10 dolar AS/barrel, sehingga harga minyak menjadi 130 dolar AS/barrel. Dengan nilai rupiah terhadap dolar AS sekitar Rp 9.000/dolar AS, harga BBM Rp 7.358/liter (1 barel=159lt). Karena menjual dengan harga Rp 4.500/liter, pemerintah lalu mengaku rugi karena me- nyubsidi Rp 2.858/liter. Padahal pemerintah mengambil minyak bumi milik rakyat secara gratis. Jadi, harga minyak sebenarnya (0 dolar AS/barrel + 10 dolar AS/barel x Rp. 9000/ dolar AS) = Rp 566/ liter. Jelas rakyat yang justru menyubsidi pemerintah Rp 3.936/liter(Rp4.500-Rp566). Sebenarnya ada banyak cara yang bisa ditempuh peme- rintah untuk menyelamatkan APBN tanpa harus menaikkan harga BBM. Jika alasannya beban subsidi makin berat, maka sama artinya pemerintah tidak ingin lagi memberikan subsidi kepada rakyat. Padahal subsidi merupa- kan hak setiap warga negara baik kayamaupunyangmiskin. Padahal BBM merupakan kepemilikan umum yang wajib dikelola negara untuk kepenting- an rakyat. Artinya, rakyat berhak menikmati BBM dengan harga murah dan mudah. Jadi kalau ke- mudian pemerintah meng- anggap harga BBM di Indonesia sangat murah dibandingkan negara-negara lain. Itu juga bukan alasan yang masuk akal, karena memang sudah seharus- nya harga BBM murah. Lagi pula harga BBM memang tidak perlu naik.[]joelian Media Umat | Edisi 104, 22 Jumadil Akhir - 6 Rajab 1434 H/ 3 - 16 Mei 2013 Inilah AlasanInilah AlasanInilah Alasan Tolak BBM NaikTolak BBM NaikTolak BBM Naik Pemerintah kembali akan menaikkan harga BBM. Berbagai opsi dilempar ke masyarakat. Berbagai penolakan pun muncul. Kenaikan itu ditunda beberapa kali. Ada apa sebenarnya di balik rencana itu? Mengapa pemerintah ngotot menaikkan harga BBM? Fokus kali ini mengupas masalah tersebut. Tak Ada Alasan BBM NaikTak Ada Alasan BBM NaikTak Ada Alasan BBM Naik
    • 19Fokus Belum Naik Sudah Bikin Pelik Akibat rencanan kenaikan BBM akan dibarengi dengan kenaikan harga bahan pokok, ditambah dengan penyelundupan dan kelangkaan BBM S anternya rencana ke- naikan harga BBM de- ngan opsi dua harga, menimbulkan dampak sangat besar bagi ma- syarakat. Maju mundurnya rencana itu pun membuat tidak stabilnya harga bahan pokok yang notabene menjadi kebu- tuhanterpentingmasyarakat. Di Pasar Induk Argosari, Wonosari, Gunung Kidul misal- nya. Harga kebutuhan pokok di pasar tersebut mengalami ke- naikan sejak seminggu terakhir. Hal itu disebabkan kesulitan angkutan dalam mendapatkan solar dan rencana pemerintah menaikkanhargaBBM. Surip (50) seorang peda- gang di Pasar Argosari mengaku kenaikan harga dirasakan paling besar ada di komoditas telur yang melonjak Rp 3.000 per kilo- gramnya. Dari Rp 14.000 menjadi Rp 17.000. Bawang putih dari sebelumnya Rp 12.000 per kilo- gram menjadi Rp 15.000, semen- tara gula jawa dari Rp 15.000 menjadiRp17.000perkilogram. Kenaikan harga bahan po- kok itu karena pasokan tersendat, apalagi ditambah dengan kenaik- an harga pakan ternak. “Rencana pemerintah pusat menikkan har- ga BBM mejadi salah satu faktor- nya,”tuturSurip. Di Surakarta kenaikan harga bahan pokok juga terjadi, Puji salah seorang pedagang menu- turkan harga cabe rawit merah naiktajamdariRp24ribumenjadi Rp 35 ribu per kilogram. Puji me- ngatakan, jika pasokan semakin sedikit plus naiknya biaya trans- portasi akibat BBM naik, harga kebutuhan pokok akan makin mahal. “Naiknya sudah sejak 3-4 hari lalu. Saya tidak tahu kenapa bisa naik karena pasokan masih lancar,”ujarnya. Dia menduga naiknya harga cabai rawit merah karena men- jelang kenaikan harga BBM ber- subsidi, sehingga harga cabe sudah dinaikkan sejak dari petani. Kenaikan harga itu ditemukan di setiappasartradisionalSurakarta. Untuk bawang merah saat ini harganya menjadi Rp 9 ribu dari awalnya Rp 7.500 per kilo- gram. Kemudian bawang putih dari Rp 11 ribu menjadi Rp 12 ribu per kilogram. Harga gula pasir juga naik dari Rp 10.300 menjadi Rp10.600perkilogram. Selundupan dan Langka Kelangkaan solar yang ter- jadi akibat rencana kenaikan BBM pemerintah berdampak pada nasibnelayan.Merekatidakdapat melaut. Kelangkaan itu pun mengakibatkan para nelayan me- rugi, padahal saat ini sedang musimikan. Sapto salah seorang ne- layan pun berharap pemerintah menuntaskan dengan cepat per- soalanini. Hal yang sama juga dialami para petani akibat kelangkaan solar bersubsidi di Jawa Tengah, Jawa Timur, Kalimantan, dan Su- matera, semakin membuat nasib petani tak menentu. Pasalnya, kondisi itu membuat biaya pro- duksipertanianmeningkat. Kelangkaan BBM solar bersubsidi yang menimbulkan antrean panjang di SPBU berba- gai wilayah, diduga akibat aksi pencurian dan penyelundupan olehoknumaparatnegara. Ironis, pemerintah plin plan, akibatnya persoalan penyelun- dupan BBM bersubsidi itu pun terus bergerak. Di Manokwari aparat mengamankan 3.800 liter bahan bakar minyak (BBM) ber- subsidi jenis solar yang akan diselundupkan keluar Kota Ma- nokwari melalui jalan trans Papua Barat. Kelangkaan BBM saat ini dinilai janggal. Sebab, bukan ka- rena menipisnya stok kuota BBM bersubsidi akibat tingginya se- rapan dalam negeri melainkan karena pencurian dan penyelun- dupanolehaparatnegara. Anggota Komisi III DPR RI Bambang Soesatyo menuturkan, intensitas pencurian BBM bersub- sidi akhir-akhir ini karena peme- rintah tidak serius memerangi penyelundupan BBM bersubsidi. Alih-alih memperketat penga- wasan, pemerintah justru lebih memilih menambah kuota BBM bersubsidi. Dengan langkah instan se- perti itu, tandasnya, patut diduga ada oknum pemerintah yang berkepentingan dan menikmati hasil pencurian BBM bersubsidi tersebut.[]fatihmujahid Media Umat | Edisi 104, 22 Jumadil Akhir - 6 Rajab 1434 H/ 3 - 16 Mei 2013 R encana kenaikan harga BBM dengan opsi dua harga berpengaruh dengan naiknya harga bahan pokok dan kelangkaan BBM bersubsidi diakibatkan penyelundupan. Putusan dzalim pemerintah tentunya akan menjadipolemikdimasyarakatyangakanmerasakandampaknya. Apa sebenarnya persoalan utamanya? Temukan dalam wawancara wartawan Tabloid Media Umat Fatih Mujahid dengan Ketua Lajnah Maslahiyah DPP Hizbut Tahrir Indonesia (HTI) Arim Nasim. Berikut petikannya: Pemerintah berencana menaikkan BBM, dengan dua harga di bulan Mei, tanggapanAnda? Saya tidak setuju dan menolak kenaikan BBM apa pun bentuknya baik pembatasan subsidi, menaikan sebagian dengan ada dua harga, apalagi menaikkan seluruhnya karena semuanya akan berdampak kepada rakyat yang miskin semakin kelaparan, rakyat hampir miskin menjadi sangat miskin. Karena masalah BBM bukan karena subsidi tapi karena liberalisasi migas yang menyebabkan hampir 84 persen migas dikuasai oleh swasta baik lokal maupunasing. Menurut pemerintah, subsidi dinikmati orang kaya dan membebani APBN. BagaimanamenurutAnda? Alasan yang selalu diulang-ulang untuk menutupi alasan yang sebenarnya! Karena alasan sebenarnya adalah permintaan para kapitalis baik IMF, World Bank yang tertuang dalam konsensus Washington yang memaksa pemerintah untuk mencabut semua bentuk subsidi kepada rakyat! Tapi kenapa kalau subsidi itu dinikmati oleh sebagian kecil yaitu para konglomerat pemerintah tidakpernahmengeluh? Contoh, kenapa kalau pembayaran bunga utang dan pokoknya yang hampir tiap tahun mengerogoti APBN antara 25-30 persen pemerintah tidak pernah mengeluh. Misalnya, tahun ini saja bunga utang yang harus ditanggung APBN sebesar Rp 113 trilyun padahal bunga utang termasuk juga utangnya yang menikmati hanya segelintir konglomerat seperti Dana Rekapitulasi Perbankan, yang diberikan kepada beberapa orang konglomerat kemudianpembiayaandibebankankepadarakyat! Logika subsisdi juga ngaco karena menempatkan hubungan rakyat dengan penguasa sebagai hubungan bisnis yang selalu menghitung untung dan rugi dalam melayani rakyat. Selama sistem ekonomi neoliberal maka subsidi (yang seharusnya memang menjadi tugas pemerintah) ini akan terus dikurangi bahkan dihilangkan karena dianggap beban atau sesuatu yang terlarang. Maka pencabutan subsidi terus dilakukan dalam semua sektor. Pencabutan subsidi listrik dengan menaikkan TDL. Pencabutan subsidi kesehatan, sehingga layanan kesehatan menjadi barang bisnis yang dikomersialisasikan. Maka mulai tahun 2014 rakyat dipaksa bayar premi asuransi untuk mendapatkan pelayanan kesehatan yang akan dikelola oleh swasta dalambentukSJSNdanBPJS. Apasolusi dari problemini? Seperti yang saya katakan diatas problem utama BBM ini bukan subsidi tapi liberalisasi migas yang menyebabkan hampir 90 persen sumber migas kita dikuasai oleh swasta baik lokal maupun asing. Karena itu solusinya adalah kembalikan penguasaan migas oleh negara untuk digunakan sebesar- besarnya kemakmuran rakyat, tapi ini sulit kalau negaranya masih menggunakan sistemekonomineoliberal. Terbukti Pertamina tidak mau diserahi tugas ini. Pertamina hanya ingin ngurus bisnis saja. Karena itu harus diubah sistemnya yaitu sistem syariah dalam pengelolaan migas. Migas dalam pandangan syariah merupakan milik umum yang wajib dikelola oleh negara. Tapi selama sistem demokrasi bercokol maka syariah tidak bisa diterapkan secara sempurna maka kita harus gantisistemdemokrsaidengansystemsyariahdanKhilafah. Sistem demokrasi tetap akan bercokol kalau orang-orang atau rezim yang berkuasa adalah rezim demokrasi dan neolib. Karena itu yang menjadi solusi paripurna masalah BBM adalah ganti sistem dan ganti rezim, yaitu sistemnya kita ganti dengan syariah dan khilafah. Dan rezim sekarang kita ganti dengan orang yang menjalankan sistem syariah dan khilafah, yaitu khalifahyangdiangkatataudibaitolehumat.[] Arim Nasim, Ketua Lajnah Maslahiyah DPP HTI Pangkalnya Liberalisasi Migas
    • 20 Ketika Khalid “Pedang Allah” Dipecat oleh Umar Hj Irena Handono, Pakar Kristologi, Pendiri Irena Center Kristologi Cermin Kristen KTP Media Umat | Edisi 104, 22 Jumadil Akhir - 6 Rajab 1434 H/ 3 - 16 Mei 2013 halidbinal-Walid,diberigelarolehNabiSAWSaifu- KLlah al-Maslul (Pedang Allah yang terhunus). Nabi pun mendoakannya, agar senantiasa diberikan kemenangan dalam setiap peperangan. Saat Perang Mu'tah, ketika itu Nabi menunjuk Usamah bin Zaid, sebagai panglima. Jika dia gugur, maka 'Abdullah bin Rawwahahyangmenggantikannya.Jikadiagugur,makaJa'far bin Abi Thalib, yang menggantikannya. Begitulah akhirnya peperanganMu'tahituterjadi. Akhirnya, ketiga panglima yang ditunjuk oleh Nabi pun satu per satu gugur sebagai syuhada' saat Perang Mu'tah, namun perang belum usai, Khalid bin al-Walid tampil mengambil komando pasukan. Allah pun membuktikan mukjizat Nabi SAW. Doa Nabi untuk kemenangan Khalid pun, dengan izin dan pertolongan Allah, terbukti. Hingga sepanjang hayatnya, tidak kurang dari 100 peperangan dia lalui. Dan, tidak ada satu pun bagian tubuhnya yang tidak terkena sabetan pedang, tusukan panah dan tombak. Itulah Khalid. Ketika Abu Bakar as-Shiddiq menjadi Khalifah, Khalid pernah ditugaskan oleh Abu Bakar untuk menaklukkan Irak. Pada saat yang sama, Abu 'Ubaidah al-Jarrah, Syarahbil bin Hasanah, Yazid bin Abu Sufyan dan 'Amru bin al-'Ash ditugaskan oleh Abu Bakar untuk menaklukkan Syam. Panglima tertinggi dari keempat kelompok pasukan ini adalah Abu'Ubaidahal-Jarrah. Namun, pasukan ini tidak berhasil menembus pertahanan tentara Romawi. Mereka hanya sampai di Sungai Yarmuk, yang berbatasan dengan Yordania dan Suriah. Dalam waktu yang lama, mereka tertahan di sini. Padahal, di antara pasukan mereka ada 100 veteran Perang Badar, yang kedudukannya di sisi Allah dan Rasul-Nya sangat tinggi. Justru ini yang menjadi pertanyaan besar Khalifah Abu Bakar. Maka, Abu Bakar pun menulis suratkepada Khalid, yang saat itu telah berhasilmembebaskanIrak,agarsegeraberangkatkeYarmuk. Hanya dalam waktu lima hari, Khalid dan pasukannya pun sampai ke Yarmuk. Mereka tidak beristirahat, dan tidak melalui jalan yang biasa dilalui oleh orang. Sebelum sampai di sana, Khalid menulis surat kepada Abu 'Ubaidah, tentang pemberhentian Abu 'Ubaidah oleh Abu Bakar, dan pengangkatan Khalid untuk menggantikannya. Abu 'Ubaidah tidak marah, dan menerima keputusan ini dengan lapang dada. Maka, tampuk komando tertinggi pasukan Islam di Yarmukpun di tanganKhalid. PerangYarmukyangdahsyatitupunmeletuspadatahun 13 H. Di saat perang sedang berkecamuk, dan Khalid tengah mengaturpasukandanstrategiperang,tiba-tibautusan'Umar bin al-Khatthab, yang baru saja diangkat menjadi Khalifah, menggantikan Abu Bakar, datang menghadap Abu 'Ubaidah. Utusan itu menyampaikan surat pemberhentian Khalid, dan pengangkatan Abu 'Ubaidah sebagai panglima tertinggi di Yarmuk. Namun, dalam situasi seperti itu, Abu 'Ubaidah tidak langsung menyampaikan keputusan tersebut kepada Khalid, hingga Perang Yarmuk berakhir, dan kemenangan di pihak kaumMuslim. Begituperangusai,keputusanitupundisampaikanoleh Abu'UbaidahkepadaKhalid.Khalidtidakmarah.Meskijasanya dalamPerangYarmukbegituluarbiasa. Setelah Perang Yarmuk, Khalid diperintahkan oleh Abu 'Ubaidah untuk menerobos benteng Damaskus, yang tingginya mencapai 6 m, tebal 3 m, dikelilingi parit yang dialiri airselebar3m. Selama 4 bulan, ada yang mengatakan sampai 6 bulan, pasukan ini mengepung benteng Damaskus. Hingga akhirnya, Allah pun membuktikan kembali mukjizat Nabi, kemenangan di tangan Khalid. Dengan segala prestasinya itu, membuat kawan dan lawan menaruh hormat setinggi-tingginya kepada Khalid. Sehingga Ibn Qais memberikan sanjungan yangbegitu tinggi kepada Khalid. Merasa tersanjung dengan pujiannya, Khalid pun memberikan hadiah kepadanya. Ada yang mengatakan,500Dinar,adayangmengatakan5000Dinar,dan 10,000Dinar. Bagi Khalid, apa yang dilakukannya tidak salah, karena Rasul pun pernah memberikan hadiah Burdah (surban hijau) Nabi SAW kepada Ka'ab bin Zuhairi, karena sanjungannya kepada Nabi. Namun, Dinar sebanyak itu dinilai oleh 'Umar tidak pantas diberikan kepada seorang penyair. “Darimanadia mendapatkan uang sebanyak itu?” tanya 'Umar. Khalid pun diadili. Di depan Abu 'Ubaidah dan 'Umar, Khalid menegaskan, bahwahartaituadalahbagianghanimah-nya. ‘Umaryangdikenalzuhuddanwara'itupunkhawatir,jika ada pejabatnya yang melakukan tindakan yang tidak patut, baik sebagai pribadi maupun pejabat negara. Dia khawatir, bagaimana kelak akan memberikan pertanggungjawaban di hadapan Allah. Dalam riwayat yang lain dituturkan, bahwa 'Umar memecat Khalid bin al-Walid karena khawatir dikultuskan. Namun, 'Umar baru menyadari kekeliruannya tentang Khalid,saatKhalidtelahmenghadapkepadaAllah.Khalidtidak meninggalkan harta sedikit pun. Khalid ternyata miskin. 'Umar pun menyesal atas tindakannya kepada Khalid. “Kenapa Anda memecat dia, saat itu?” tanya 'Ali kepada 'Umar. “Iya, saya menyesal. Karena saya tidak tahu kondisi dia yang sesungguhnya.” Begitulah keikhlasan Khalid bin al-Walid, dan begitulahkezuhudandankewara'an'Umarbinal-Khatthab. Saat menjelang ajalnya tahun 21 H, Khalid berkata kepada Abu Darda ra, “Wahai Abu Darda, bila kelak 'Umar al- Khattabrawafat,akanmelihatsesuatuyangkamubenciterjadi.” Sambil mengelap air matanya, ia berkata lagi, “Aku memang merasa sedikit kecewa dengannya dalam bebarapa hal, tetapi setelah aku pikir di saat aku sakit ini, aku menyadari, bahwa 'Umar melakukannya dengan ikhlas dan hanya mengharapkan rahmatAllahdarisetiaptindakannya.”[]ronir/hardariberbagai sumber si Peraturan Bersama Menteri Agama Idan Menteri Dalam Negeri Nomor 8 dan 9 Tahun 2006 yang mengatur tentang tata cara pendirian dan perizinan pem- bangunan rumah ibadah adalah untuk membangun sebuah rumah ibadah harus ada pengajuan dari 90 umat beragama ber- sangkutan, dan persetujuan atau izin tertulis dari sedikitnya 60 orang di lingkungan ter- sebut. MasihingattentangAMANATAGUNG? Bagi yang pernah mengikuti Kajian Pembentengan Akidah (Kristologi yang diselenggarakan Irena Center secara online di internet maupun offline di majlis taklim, pasti ingat akan istilah ini). AMANAT AGUNG adalahperintahYesusyangterakhir. Markus 16:15 Lalu Ia berkata kepada mereka: "Pergilah ke seluruh dunia, beritakanlahInjilkepadasegalamakhluk. Matius 28:19 Karena itu pergilah, jadikanlah semua bangsa murid-Ku dan baptislah mereka dalam nama Bapa dan AnakdanRohKudus. Dua ayat ini menjadi pedoman umat Kristen dalam melakukan misinya. Tiga poin pentingdalamayatiniadalah: - Penyebaran agama Kristen keselu- ruhdunia. - Pemurtadan, menjadikan Kristen, seluruhbangsa di dunia. - Melakukan pembaptisan dalam rangkapemurtadan. Walaupun kedua ayat ini menurut keyakinan Kristen dikatakan bersumber dari 'Injil', yakni Injil yang diriwayatkan Markus dan Injil yang diriwayatkan Matius, Injil sebagaimana yang dimiliki umat Kristen bukanlah Injil yang diberikan Allah SWT kepada Nabi Isa as (Yesus). Injil yang dimiliki umat Kristen ini adalah perkataan Yesus yang dicatat dan diriwayatkan oleh Markus, Matius, Lukas atau Yohanes. Jadi kalau kita membuat persamaan dalam literatur Islam, maka Injil yang dimiliki umat Kristen ini setara dengan hadist. Tidak bisa disamakan dengan Kitab Suci Alquran. Maka Injil yang dimiliki umat Kristen sebenarnya cukup disebutKitabHadistKristen. Jika disebut hadist, maka ayat-ayat Amanat Agung di atas tentunya disampai- kan oleh seorang nabi, yakni Nabi Isa as atau yang mereka sebut Yesus. Apakah benar NabiIsaasmenyuruhmelakukansemuaitu? Tidak. Yesus tidak pernah menyuruh demikian. Ayat-ayat Amanat Agung adalah ayat-ayat palsu yang diciptakan berikutnya oleh pihak gereja demi kepentingan mere- ka. Buktinya di ayat yang lain Yesus malah bersikapsebaliknya: Matius 10:5-6 Kedua belas murid itu diutus oleh Yesus dan Ia berpesan kepada mereka: "Janganlah kamu menyimpang ke jalan bangsa lain atau masuk ke dalam kota orang Samaria, melainkan pergilah kepada domba-domba yanghilangdariumatIsrael. Matius15:24 Jawab Yesus: "Aku diutus hanya kepada domba-domba yang hilang dariumatIsrael." Yesus justru menyatakan dengan tegas bahwa dirinya hanya diutus untuk bangsa Israel saja, bukan Eropa, Cina atau Indonesia. Bahkan Yesus melarang murid- nya masuk ke kota bangsa lain di luar Israel. Dan tidak hanya dua ayat di atas aja yang menyatakanbahwaYesushanyauntukumat Israel, masih banyak dalam Perjanjian Baru ayat-ayat yang senada. Begitu juga dalam Alquran, surah Ali Imran ayat 49, “Sebagai RasulkepadabaniIsrael...” Jadi penyebaran agama Kristen yang dilakukan para misionaris adalah sebuah tindakan yang bertentangan dengan kitab sucimereka. Lalu bagaimana jika ada umat Kristen yang tidak melaksanakan Amanat Agung? Bagi yang tidak melaksanakan Amanat ini, makadiibaratkansebagaiMuslimyangtidak mau shalat, maka kita sering menyebutnya dengan istilah 'Islam KTP', maka demikian juga dalam Kristen. Orang yang tidak melakukan pemurtadan, minimal seorang majikan kepada pembantunya, maka statusnyadisebutsebagai'KristenKTP'. Jika dalam sebuah negara, Amanat Agung diibaratkan sebagai undang- undang, maka keppres nya adalah sebuah Instruksi Kristenisasi yang pernah dikeluar- kanolehPausYohanesII. Koran The Straits Time edisi 24 Januari 1991 memuat surat edaran Paus yang berisi seruan Paus Johanes Paulus II, kepada Kaum KatholikuntukmenyebarkanagamaKristen. Dalamsuratedaranataufatwagerejaniyang dikatakan sebagai ”Redemp-toris Missio” atau The Churchs Missionary Mandate itu, diserukan, agar umat Katholik mengambil tindakan untuk menyebarkan ajaran Katholik. Paus menegaskan pentingnya melakukan Kristenisasi terhadap semua bagiandunia(toevangeliseinallpartsofthe worlds), termasuk negeri-negeri dimana hukumIslammelarangperpindahanagama. Paus menekankan agar negara-negara Muslim demikian juga negara-negara lainnya, segera mencabut peraturan- peraturan yang melarang orang Islam masukagamalain. Bagaimana dengan Protestan? Ter- nyata Protestan juga memiliki Instruksi Gereja, dalam buku Sejarah Gereja, Dr. Berkhof,BPKGunungMulia,cet.ke-8th.1990 hal.321,disebutkan: “Boleh kita simpulkan bahwa Indo- nesia adalah suatu daerah pekabaran Injil yangdiberkatiTuhandenganhasilyangindah dan besar atas penaburan bibit firman Tuhan...” Lalu apa hubungannya dengan Peraturan Bersama Menteri Agama dan Menteri Dalam Negeri di awal tulisan ini? Kaitannya erat. Walaupun ada peraturan yang cukup untuk mencegah adanya tirani dalam kehidupan beragama dan untuk menjaga kerukunan hidup beragama. Ternyata Perber ini masih saja mereka langgar. Mereka tidak takut. Karena pelanggaran Perber ini pun tidak memiliki sanksi perdata maupun pidana. Dan justru mereka harus melanggar Perber ini karena mengikuti yang katanya “Perintah Tuhan”. Jika mereka patuh dengan Perber yang ditetapkan, artinya status iman Kristen merekahanyaKristenKTP.[]
    • 21Mercusuar Oleh: Prof Dr Ing Fahmi Amhar Satu Negeri Ikut UjianSatu Negeri Ikut UjianSatu Negeri Ikut Ujian Media Umat | Edisi 104, 22 Jumadil Akhir - 6 Rajab 1434 H/ 3 - 16 Mei 2013 B agaimana suasana Ujian Nasional (UN) tahun ini di daerah Anda? Semoga baik- baik saja. Tetapi diketahui luas bahwa tahun ini, pelaksanaan UN secara nasional sangat buruk. Soal ujian datang terlambat, tertukar, lembar jawaban terlalu tipis dan sobek bila dihapus, dan di atas itu semua kecurangan masih terjadi, sebagian bahkan sistemik, yakni justru didalangi oleh pejabat setempat. Ketika tahun 1984 dulu EBTANAS SMA dimulai, idenya memang sekadar untuk pemetaan standar pendidikan. Nilai EBTANAS Murni (NEM) tidak untuk standar kelulusan, tetapi hanya berpengaruh 33 persen hingga maksimum 60 persen. Saat itu sangat jarang siswa yang mendapat NEM rata-rata di atas 7. Ketika EBTANAS berganti nama menjadi UN, dan hasilnya dijadikan standar kelulusan, maka dimulailah kecurangan sistemik itu. Para kepala sekolah atau kepala dinas pendidikan takut kehilangan jabatannya bila nilai UN siswa di bawah tanggung jawabnya jelek. Mereka lalu melakukan segala cara. Sekarang ini, kalau anak kita mendapat angka 8 sebagai nilai rata-rata UN, boleh jadi dia akan sulit mendapatkan sekolah lanjutan, karena yang angkanya 9 banyak sekali. Tetapi tetaplah bersyukur bila itu didapat dengan jujur. Prof Dr Indra Djati Sidi (mantan Dirjen Dikdasmen) mengatakan, hasil UN yang jujur hanya 20 persen. Tak heran bahwa banyak dugaan UN ini bukanlah usaha serius memetakan dan meningkatkan kualitas pendidikan di tanah air, tetapi lebih pada proyek bernilai trilyunan rupiah yang sayang jika dihapuskan. Salah satu buktinya, sekolah dengan hasil UN bagus justru dikembangkan menjadi RSBI dan mendapat dukungan finansial lebih besar. Sementara sekolah di daerah terpencil dengan guru terbatas dan murid yang setiap hari harus berjibaku mempertaruhkan nyawa untuk sampai ke sekolah, hanya mendapat perhatian ala kadarnya. Sebenarnyalah memang naif untuk menilai proses belajar hanya dari beberapa hari UN dan juga dengan soal yang amat terbatas. Terlalu banyak hal yang tidak bisa dinilai dengan cara seperti itu. Bagaimana kita akan menilai keberhasilan siswa dalam menaklukkan rasa takutnya? Kedalaman imannya? Kepekaan nuraninya? Kepedulian sosialnya? Kreativitas karyanya? Daripada nilai UN, masih banyak parameter yang lebih menentukan masa depan seorang anak. Sangat disayangkan bahwa kita jarang menengok bagaimana dulu Negara Khilafah mampu mengangkat peradabannya menjadi mercusuar dunia melalui jalur pendidikan (dakwah). Pendidikan itu kunci kebangkitan peradaban, juga kunci untuk mempertahankan tingkat kemajuan yang telah diraih. Rahasia mundurnya peradaban Islam juga terletak ketika pendidikan makin diabaikan, sehingga generasi muda makin jauh dari Islam, dan akhirnya ketika mereka menduduki pos-pos penting, penerapan Islam menjadi semakin buruk. Paradigma pendidikan Islam adalah menanamkan pada anak kecintaannya kepada ilmu agar dia menjadi Muslim yang lebih baik. Iman dan ilmu adalah saudara kembar. Iman tanpa ilmu itu laksana benih yang tidak tumbuh menjadi pohon. Ilmu tanpa amal itu laksana pohon yang tidak berbuah. Sedang amal tanpa ihlas itu laksana buah yang tidak enak dimakan. Karena itu setiap Muslim wajib mampu membaca Alquran. Di sinilah jurang antara Timur dan Barat. Untuk kitab suci Nasrani, hanya pendeta yang memiliki akses, membaca dan mengerti bahasa kitab suci. Namun sejak 800 M, para pengkhutbah dalam bahasa Latin sudah susah dimengerti orang kebanyakan, karena yang menikmati sekolah (berbahasa Latin) hanya selapis tipis rohaniwan. Ini berbeda dengan Daulah Khilafah yang sangat berkepentingan agar rakyatnya cerdas. Pendidikan benar-benar menjadi urusannya. Anak-anak semua kelas sosial mengunjungi pendidikan dasar, yang terjangkau semua orang. Mereka harus menguasai semua hal yang fardhu diketahuinya sebelum memasuki usia baligh. Negara membayar cukup para gurunya. Para guru ini juga orang-orang pilihan yang berdedikasi tinggi, orang-orang yang ingin meninggalkan ilmu yang manfaat dan mencetak anak-anak shalih sebagai investasi amal yang tak akan terputus oleh kematian. Di banyak tempat, sekolah sama sekali gratis. Di Spanyol misalnya, selain 80 sekolah umum Cordoba yang didirikan al-Hakam-II pada 965 M, masih ada 27 sekolah khusus untuk anak-anak miskin. Di Kairo, al- Mansur Qalawun mendirikan sekolah untuk anak yatim, dan menganggarkan setiap hari ransum makanan yang cukup dan satu stel baju untuk musim dingin dan satu stel baju untuk musim panas. Bahkan untuk orang-orang Badui yang berpindah-pindah, dikirim guru yang juga siap berpindah-pindah mengikuti tempat tinggal muridnya. Tak ada lagi celah dalam jejaring sekolah seperti ini. Namun pendidikan di Daulah Khilafah tidak terbatas pada pendidikan dasar. Rakyat di seluruh kota besar menikmati pendidikan tinggi! Para mahasiswa tinggal di kamar- kamar lantai atas gedung kampus. Mereka juga mendapat makanan lengkap cuma-cuma, bahkan uang saku. Di bawah tanah terdapat dapur, gudang dan tempat mandi. Di lantai dasar ada ruang-ruang belajar dan perpustakaan. Di situlah dipelajari Quran, Hadits, Bahasa Arab, Sejarah, Sosiologi, Geografi, Logika, Matematika dan Astronomi. Pada pelajaran yang terkait ketrampilan teknologi, disediakan laboratorium yang cukup untuk menguji kemampuan siswa memecahkan masalah. Ini kemampuan psikomotorik, bukan sekadar kognitif (hafalan). Para aghniya juga berlomba- lomba (fastabiqul khairat) untuk berwakaf membantu fasilitas pendidikan dengan perpustakaan atau observatorium bintang. Mereka ingin meninggalkan amal jariyah, yang pahalanya juga tidak akan terputus oleh kematian. Melalui pertanyaan dan debat, mahasiswa dilibatkan dalam proses pembelajaran. Para mahasiswa tingkat lanjut dan alumni membantu mereka belajar. Mereka seperti“lebah yang sedang meracik madu ilmu dari ribuan bunga pengetahuan”, tulis Sigrid Hunke, sejarawan Jerman dalam Allah Sonne ueber dem Abendland. Sebagian ayah memanggil guru ke rumah, biasanya untuk anak berbakat, seperti misalnya Ibnu Sina yang di usia 10 sudah hafal Alquran dan kitab-kitab kuno. dan usai 16 tahun sultan memanggilnya untuk menjadi ilmuwan istana. Dia menambah ilmunya lagi dengan belajar di perpustakaan sultan dan di rumah sakit. Di usia 18, dia benar-benar menamatkan semua yang dapat dipelajarinya. Tentu yang seperti Ibnu Sina ini memang luar biasa. Namun jalan umum untuk belajar adalah di masjid-masjid. Siapa saja boleh datang dan pergi, laki ataupun perempuan. Dan siapa saja boleh menginterupsi para guru untuk bertanya atau membantah. Ini memaksa para guru untuk mempersiapkan materinya dengan seksama. Sebenarnya, siapapun yang merasa mampu boleh mengajar. Namun audiensnya yang selalu siap mengkritik, mencegah orang- orang yang belum matang atau baru setengah matang dalam ilmu untuk memimpin kalimat. Di masjid-masjid juga biasa didengarkan kalimat dari para ulama yang sedang dalam perjalanan yang singgah di kota itu, terutama ketika musim haji. Dengan demikian para mahasiswa selalu mendapatkan masukan. Bahkan juga cepat tahu bila ada karya yang“dicuri” mentah-mentah (plagiarism). Untuk mengungkap karya orang lain, sanad atau rawi wajib disebutkan. Dan untuk itu perlu ada ijazah (lisensi) tertulis dari gurunya, bahwa dia layak untuk menjadi sanad dari pengetahuan tersebut. Inilah mengapa gelar sarjana di timur tengah adalah Lc. dari kata Licentiate – berlisensi untuk menyampaikan. Sedang untuk profesi tertentu, misalnya tabib, ada suatu komisi yang ditunjuk Khalifah untuk menguji kompetensi orang-orang yang mengklaim memiliki kemampuan pengobatan. Mereka akan ditanya, pada siapa mereka belajar, kitab apa yang telah mereka baca dan bagaimana mereka menghadapi suatu kasus. Kadang, meski orang mengklaim mampu mengobati segala penyakit, oleh komisi dia hanya diberi lisensi untuk mengobati sakit kulit, karena terbukti kompetensinya cuma itu. Ini sudah lebih maju 1000 tahun daripada dunia pengobatan alternatif di Indonesia saat ini yang tak jelas standarnya ! Pada masa itu siapapun boleh kapan saja mengujikan kompetensinya. Anak-anak rajin seperti Ibnu Sina atau Muhammad bin Idris asy-Syafi'i bisa menjadi ilmuwan sekaligus ulama top di usia amat muda karena pendidikan Islam berhasil menanamkan pada mereka cinta ilmu, sehingga mereka belajar tiga kali lipat orang normal, dan sistem juga memberi mereka kesempatan mengujikan kompetensinya, tanpa harus menunggu UN.[] Ilustrasi pembelajaran di abad pertengahanIlustrasi pembelajaran di abad pertengahanIlustrasi pembelajaran di abad pertengahan
    • Sosok Media Umat | Edisi 104, 22 Jumadil Akhir - 6 Rajab 1434 H/ 3 - 16 Mei 2013 KH Nasrudin Aktivis HTI Semarang Rela DiboikotRela Diboikot DemiDemi Keridhaan AllahKeridhaan Allah Rela Diboikot Demi Keridhaan Allah i teras rumahnya Dyang cukup luas, Kyai Nasrudin mengupas kitab Bunga Rampai Pemikirian Islam atau Fikrul Islam karya Syeikh Muhammad Ismail, Jumat (26/4) menjelang Ashar. “Sistem harus diubah dengan Islam, di samping itu umat juga harus dibuat shalih dengan Islam,”tegasnya kepada sekitar dua puluh santrinya yang merupakan pemuda dan bapak- bapak warga Kecamatan Tembalang, Semarang dan sekitarnya. Begitulah suasana ketika Media Umat mendatangi kyai muda dari kalangan Nahdliyin yang kini disibukkan dengan kegiatan dakwah untuk menyeru penegakan syariah Islam kaaffah dalam bingkai khilafah. Menurutnya kajian kitab yang membentuk pola pikir dan pola sikap islami karya salah satu tokoh Hizbut Tahrir itu diajarkannya setiap Jumat pukul 14.00 WIB. Sedangkan setiap Jumat ba'da Shubuh, ia pun memberikan kajian tafsir Alquran yaitu dengan Tafsir Al Ibris di masjid besar yang tepat berada di depan rumahnya. Santrinya pun sekitar 20 orang. Sebelumnya, ungkap lulusan tiga pesantren salafiyah di Tembalang (Semarang), Brabu (Grobogan) dan Kaliwungu (Kendal) ini, tiap kali dirinya mengisi kajian Al Ibris, jamaah pengajiannya yang datang minimal dua truk uyel-uyelan ditambah dengan yang datang sendiri membawa sepeda motor. Namun sejak 2008, lelaki kelahiran Semarang, 2 Maret 1975 diboikot hingga saat itu santrinya tersisa dua orang saja. Jadwal khutbah Jumat di berbagai masjid di Tembalang dan sekitarnya pun dibatalkan sepihak oleh pihak masjid. “Bahkan Taman Pendidikan Quran yang kami rintis bubar karena RT-RW menginstruksikan pada semua wali santri yang berjumlah 80 orang itu untuk mengeluarkan anaknya dan memindahkannya ke TPQ lain,” kenangnya. Itu semua terjadi lantaran tokoh-tokoh berpengaruh di tengah masyarakat belum memahami Hizbut Tahrir dan belum memahami kewajiban menegakkan kembali khilafah. Sehingga dirinya yang sejak 2007 aktif menyerukan kewajiban mendirikan kembali khilafah disambut negatif yang pada puncaknya umat dilarang lagi mengikuti kajian ulama yang sampai saat ini pun tetap aktif memimpin kegiatan yasinan dan tahlilan tersebut. Meski ia sudah menjelaskan dengan berbagai cara dan berbagai dalil dikemukakan, Nasrudin tidaklah memiliki kuasa untuk menyadarkan mereka. Itu sangat disadarinya. Apalagi dirinya pun sebelum akhirnya tersadar dan tercerahkan selama lima tahun selalu mengerahkan segala daya untuk menolak kedatangan aktivis Hizbut Tahrir Indonesia (HTI) Semarang. Serta menolak argumentasi sang aktivis yang menyatakan menegakkan kembali syariah dalam bingkai khilafah adalah kewajiban seluruh kaum Muslim, bukan hanya aktivis HTI. Mengenal HT Nasrudin pertama kali mendengar nama Hizbut Tahrir pada 2002. Saat itu ia belum diboikot untuk mengisi kajian rutin Al Hikam, di salah satu masjid di Jalan Durian Semarang. “Sebagian yang hadir memang ada anggota Hizbut Tahrir. Kemudian mereka suka menanyakan persoalan umat, yang mereka sering tidak puas ketika saya jawab dengan cara menentramkan hati, keshalihan (individu-red),”ungkapnya. Rupanya beberapa aktivis HTI yang mengikuti kajian Al Hikam tersebut bermain ke rumahnya untuk berdiskusi terkait persoalan umat. Kemudian mereka mengutus seseorang untuk datang sendiri ke rumah. Meski Nasrudin tidak berminat, ia tidak enak juga bila menolak utusan tersebut akan datang pada waktu tertentu, yang merupakan waktu kosong Nasrudin. Betapa senangnya, Nasrudin ternyata pada hari H dan menjelang jamnya, hujan lebat turun bahkan disertai angin kencang. Pasti, orang itu tidak akan datang, sangkanya dalam hati. Namun dugaannya meleset. Ternyata aktivis HTI Semarang tersebut datang tepat waktu.“Ustadz dari HTI ini datang tepat waktu sebagaimana janjinya, tapi sengaja tidak saya temui,” kenang Nasrudin. Kemudian si aktivis pun pulang, dan di hari lain masih tetap juga mengabari akan datang lagi, dan memang datang tepat waktu lagi. Tapi kali itu, ia temui, itupun hanya 15 menit saja.“Akan tetapi yang disampaikan begitu mendalam yaitu pembuktian keberadaan Allah,”ungkapnya yang saat itu hatinya hampir goyah. Namun ia menguatkan diri lagi dengan menghibur diri bahwa yang dilakukannya saat ini sudah cukup baik sehingga tidak perlu lagi disibukkan untuk mengkritik pemerintah apalagi sampai turut memperjuangkan tegaknya kembali khilafah. Di kesempatan lain dirinya pun dihadiahi kitab Nidzamul Islam karya pendiri Hizbut Tahrir, Syeikh Taqiyuddin An Nabhani, yang membahas Islam secara tuntas dari mulai akidah sampai membandingkan tiga ideologi dunia yakni Islam, kapitalisme dan komunisme. “Kemudian saya bandingkan dengan kitab lain seperti Ahkamul Sulthan li Mawardi. Dan selama lima tahun pula anggota Hizbut Tahrir tadi tidak ada menyerah untuk mengontak dan berusaha memahamkan saya dan selama lima tahun pula saya berusaha menolaknya,”bebernya. Gengsi bila harus menyerah, Nasrudin akhirnya berkontemplasi. Ia turunkan semua kitab yang pernah dipelajari selama nyantri di tiga pesantren.“Semakin saya baca lagi, semakin saya tidak menemukan hal yang salah dari pemikiran dan metode dakwah Hizbut Tahrir,”ungkapnya. Ia pun tersadar. Tidak ada alasan lagi bagi dirinya untuk menolak kebenaran. Maka pada 2007, dengan ikhlas ia mengikuti kajian rutin kitab-kitab Hizbut Tahrir dan mendakwahkannya. “Tolong catat ya, ini penting. Hal yang paling berkesan mengapa saya memutuskan untuk bergabung dalam dakwah Hizbut Tahrir,” desaknya kepada Media Umat. Pertama, jika mengkaji kitab Fatkhul Mu'in, Fatkhul Qarib, dan juga Fatkhul Hab, sampai sepertiga bab terakhir kitab-kitab tadi, maka akan menemui persoalan uqubat, hudud, juga jinayat. “Tetapi ketiga persoalan ini pada faktanya tidak dapat dilaksanakan tanpa institusi khilafah,”tegasnya. Padahal, ungkapnya, bahwa seluruh hukum diajarkan untuk diamalkan.“Hizbut Tahrir, menawarkan konsep itu, juga mengajarkan metode untuk menjalankan konsepnya,”tegas Nasrudin. Kedua, “Saya sudah mencari organisasi dakwah, dan yang paling cocok dengan ilmu yang saya pelajari adalah fikrah dan thariqah dakwah Hizbut Tahrir dalam menegakkan khilafah. Hizbut Tahrir juga sudah memberikan panduan bagaimana jika khilafah berdiri,” ungkapnya. Diboikot Sejak saat itu, dalam berbagai kesempatan, baik dalam setiap undangan pengajian, atau pun kajian di berbagai masjid termasuk dalam khutbah Jumat, ia pun mendakwahkan wajibnya menegakkan kembali negara dan sistem pemerintahan yang diwariskan Nabi Muhammad SAW tersebut. Keleluasaannya berdakwah di berbagai tempat hanya berjalan setahun saja. Karena pada 2008, ia pun diboikot. “Sampai-sampai saya juga diboikot tidak diperbolehkan lagi mengisi kajian-kajian di masjid, khutbah Jumat dan lain- lain. Juga beredar fitnah perihal dakwah saya,”ujarnya. Jamaah meninggalkan dirinya yang tersisa hanya dua orang saja. Namun, bagi lelaki dengan satu istri dan tiga anak ini, berprinsip cahaya kebenaran sudah kadung menerangi hatinya, tak boleh ada yang memadamkannya.“Ya, itu adalah konsekuensi terhadap dakwah yang kita lakukan,”tegasnya. Menurutnya, menyitir Kitab Daulah Islam karya Syeikh Taqiyuddin An Nabhani, pertentangan dalam masyarakat terhadap dakwah yang ideologis bisa terjadi dalam tiga kategori yaitu propaganda negatif, pemboikotan juga kekerasan fisik.“Dua hal pertama sudah saya alami, yang ketiga dialami saudara-saudari kita di Uzbekistan, Pakistan dan lain- lainnya,”lirihnya berkaca-kaca. Alhamdulillah justru dengan itu, jamaah jadi terfilter dengan sendirinya.“Yang ikhlas, terbuka hati dan pikirannya, jadi mengkaji lagi, dan malah dengan kekuatan semangat yang lebih besar,”katanya. Media Umat pun sempat mewawancarai salah satu jamaah yang sempat berhenti mengikuti kajian KH Nasrudin, yaitu Bapak Hambali. Ia menyampaikan sebab kembali mengkaji yaitu karena menemukan jawaban atas pertanyaan dari mana hidup, untuk apa dan ke mana setelah mati dengan konsekuensinya. Ketika ditanya, mengapa tidak menghentikan saja dakwah tentang wajibnya menegakkan khilafah agar jamaahnya kembali banyak, Nasrudin pun menjawab:“Jika kita mempunyai jamaah yang banyak yang dapat mengangkat derajat kita di masyarakat, apakah titik ini sajakah tujuan kita? Ataukah seruan Allah yang lebih tinggi? Karena bagaimanapun yang tertinggi adalah mendapatkan keridhaan Allah.”[] brojo p laksono/joy
    • 23Anjangsana Cetak SDM CermatCetak SDM CermatCetak SDM Cermat Media Umat | Edisi 104, 22 Jumadil Akhir - 6 Rajab 1434 H/ 3 - 16 Mei 2013 Pondok Pesantren Teknologi, Pekanbaru, RiauPondok Pesantren Teknologi, Pekanbaru, RiauPondok Pesantren Teknologi, Pekanbaru, Riau D ari kejauhan sudah terlihat menara Masjid El Madrasi yang megah dengan suasana yang jauh dari hiruk pikuk perkotaan. Masjid yang berlokasi di kompleks Yayasan Ummatan Wasathan Pesantren Teknologi, menjadi landk mark Pesantren Teknologi yang didirikan oleh beberapa menteri di era Presiden KH Abdurrahman Wahid. Ya, dalam rangka memenuhi kebutuhan nasional akan sumber daya manusia yang berkualitas tinggi dalam penguasaan IPTEK, memiliki iman dan takwa yang kuat, serta terdepan di kawasan ASEAN, beberapa menteri rezim Gus Dur, seperti Menteri Agama KH Tholchah Hasan dan Menteri Negara Riset dan Teknologi Muhammad AS Hikam, serta beberapa tokoh nasional lainnya mendirikan Yayasan Ummatan Wasathan pada April 2000. Atas prakarsa mereka pulalah maka pada Tahun Pelajaran 2003/2004 dibuka Madrasah Aliyah Ummatan Wasathan Pondok Pesantren Teknologi Riau di atas tanah seluas 100,5 hektar di Jalan Lintas Timur Km 22 Pekanbaru. Visi dan Misi Visi Pesantren Teknologi adalah “Menjadikan Pondok Pesantren Teknologi Riau sebagai pesantren yang memosisikan diri menjadi pusat pembinaan dan pemberdayaan sumber daya manusia yang CERMAT (Cerdas, Efisien, Rasional, Mandiri, Agamis dan Teknokrat).” Sedangkan misinya ada tiga. Pertama, menyiapkan pemimpin masa depan yang menguasai ilmu pengetahuan dan teknologi, mempunyai daya juang tinggi, kreatif, inovatif, proaktif dan mempunyai landasan iman dan takwa yang kuat. Kedua, mengaplikasikan ilmu-ilmu dasar dalam teknologi terapan. Ketiga, menjadikan Pondok Pesantren Teknologi Riau sebagai pesantren terdepan dan unggul dalam pengembangan teknologi terapan. Selain masjid yang megah, pesantren yang bermoto think globally, act locally tersebut pun memiliki fasilitas yang cukup memadai untuk menampung dan membina sekitar 230 santri yang saat ini mondok di sana, seperti: gedung untuk asrama putra dan gedung asrama putri; laboratorium komputer; laboratorium bahasa; internet; workshop otomotif roda 2 dan 4; workshop las; lahan pertanian; lahan olahraga dan labor praktikum menjahit. Kurikulum madrasah diadopsi dari Kementerian Agama sedangkan kurikulum kepesantrenan dan kurikulum teknologi dirumuskan oleh Tim Teknologi Madrasah Aliyah Ummatan Wasathan Pondok Pesantren Teknologi Riau yang masing-masing terdiri dari: teknologi komputer; teknologi elektro; teknologi otomotif dan teknologi pertanian. Pagi dan siang santri belajar di madrasah sedangkan malam dan shubur belajar di pesantren. Proses pembelajaran Pondok Pesantren Teknologi Riau diarahkan kepada penyiapan pemimpin yang unggul di bidang IPTEK dan memiliki IMTAQ yang kuat dengan target kelulusan berakhlak mulia; menguasai prinsip- prinsip dasar keislaman; menguasai Bahasa Inggris – Bahasa Arab; memiliki keahlian dan ketrampilan di bidang teknologi terapan dan diterima di perguruan tinggi favorit. Prestasi Santri Prestasi santri di antaranya adalah Juara Umum POSPEDA III Kota Pekanbaru (2005); juara Umum III POSPEDA IV Kota Pekanbaru (2007); juara Umum II POSPEDA V Kota Pekanbaru (2009); juara I, II, III dan Harapan I Lomba Matematika FKIP UIR (2007) serta juara II Lomba Musikalisasi Matematika Olimpiade Matematika II se Riau di UNRI (2012). Di samping itu, banyak pula alumni yang mendapatkan beasiswa full biaya hidup dan biaya kuliah dari Kementerian Agama. Di antaranya. Pada 2007, delapan alumni ke UIN Jakarta, UNAIR dan UGM. Pada 2008, dua alumni ke ITS dan IPB. Pada 2009, tiga alumni ke ITS dan IPB. Pada 2010, dua alumni ke ITS dan Universitas Maulana Malik Ibrahim. Pada 2011 dan 2012, dua alumni ke IPB. Dalam rangka meningkatkan kelestarian lingkungan, pada 21 Maret 2013 pihak pondok bersama Dinas Kehutanan Provinsi Riau mengadakan kegiatan penanaman pohon yang bertemakan menanam 1 milyar pohon yang dipusatkan di Pondok Pesantren Teknologi Riau.[] apri siswanto/joy KH Yusuf Ahmad, Pimpinan Ponpes Teknologi Riau Harus Kembalikan Kejayaan Islam P impinan Ponpes Teknologi Riau KH Yusuf Ahmad menyatakan bahwa kaum Muslim harus mengembalikan masa kejayaan Islam di waktu lalu yang telah dimenangkan oleh pasukan Islam. “Saat ini kita masih tertidur dalam waktu yang lama,” ungkap pensiunan Depag di Rengat tersebut. Alumnus Ponpes Al Adiyah Sulawesi Selatan ini kemudian membacakan semboyan ulama dahulu: "Almukhafadlotu al-qhadimus shalih wa al-ahdzu bil jadidil al-aslah" berusaha memelihara statemen-statemen yang dahulu masih dianggap relevan dan tidak ketinggalan teknologi. Makanya, Sarjana IAIN Makassar ini pun mendukung perjuangan Hizbut Tahrir untuk melanjutkan kembali kehidupan Islam. “Otomatis semua kaum Muslimin harus mendukung perjuangan syariah dan khilafah yang telah dimulai oleh Hizbut Tahrir,” ungkap anggota Komisi Fatwa MUI Riau tersebut. Ia pun berazam akan turut menyukseskan Dauroh Khusus Ulama yang diselenggarakan LKU HTI Riau pada 9 Mei 2013. [] apri siswanto/joy
    • Muslimah24 Menjadi manajer di rumah sendiri, jauh lebih terhormat Media Umat | Edisi 104, 22 Jumadil Akhir - 6 Rajab 1434 H/ 3 - 16 Mei 2013 PotretBuruhPerempuan P erempuan bekerja bukan lagi pemandangan langka. Ada yang bergaji tinggi sebagaimana karyawan kantoran yang berbekal titel, ada pula pegawai rendahan yang mendapat julukan buruh. Nah, tulisan ini menyoroti para perempuan bergaji minim ini, berkenaan dengan Hari Buruh 1 Mei. Ya, fenomena buruh perempuan menarik dikaji. Mereka mengeluarkan tenaga dan menghabiskan sebagian besar waktunya di pabrik, mal atau outlet penjaja komoditas. Pendapatannya tak seberapa, tapi risikonya luar biasa. Mulai diskriminasi, kekerasan hingga pelecehan seksual. Ambil contoh di ibukota Jakarta. Dari 80.000 orang buruh, 90 persennya merupakan wanita. Dari jumlah itu, 75 persen buruh wanita mengalami kekerasan seksual. Dari catatan tahunan yang dikeluarkan Komnas Perempuan 2012, terdapat 216.156 kasus kekerasan seksual. Di antaranya diterima oleh buruh wanita sebanyak 2.521. Angka itu berdasar kepada buruh wanita yang melaporkan kejadian yang dialaminya. Menurut Ketua Komunitas Buruh tingkat pabrik Jumingsih, kasus pelecehan seksual itu sering diterima di dalam pabrik. Pelakunya mulai atasan hingga teman pria.“Biasanya buruh diperkosa dengan ancaman tidak akan diperpanjang kontraknya. Ini sudah biasa dilakukan di pabrik di Jakarta Utara,”ujarnya di kantor Kontras, Jakarta Pusat, belum lama ini seperti dilansir tribunnews.com. Di luar pabrik, peluang pelecehan terjadi saat pulang lembur. Pasalnya, jika pulang lebih dari pukul 22:00, tidak disediakan sarana transportasi yang aman. Fakta ini mencuatkan keprihatinan. Misalnya yang dipelopori Barisan Maju Buruh (BAMBU) Perempuan. Untuk mengantisipasi pelecehan seksual dan pemerkosaan yang makin marak, BAMBU mengimbau buruh perempuan agar membawa sebilah bambu berukuran 40 cm dalam kesehariannya (Okezone,19/4/2013). Problem Sistemik Keberadaan buruh perempuan tak lepas dari ketidakberdayaan sebuah keluarga dalam mencukupi kebutuhan hidup yang makin tak terjangkau. Jika ia masih gadis, terpaksa bekerja karena orang tuanya tak mampu (atau tak mau) lagi mencukupi kebutuhannya. Jika ia istri yang bekerja, bisa jadi karena suami—yang rata-rata juga buruh—mendapat gaji minim dan tak sebanding dengan kebutuhan keluarga. Jadi, mereka ini bukanlah kelompok pengejar materi demi gengsi, melainkan sekadar bertahan hidup. Kemiskinan telah mendorong mereka untuk ikut bekrontribusi menjemput rezeki. Sistem sekuler-kapitalisme memanfaatkan kondisi ini dengan menggiring perempuan ke ruang publik. Ya, para pengusaha lebih suka mempekerjakan kaum perempuan karena dianggap lebih rajin, teliti, telaten dan tidak berani menuntut. Pengusaha juga tak perlu memberikan tunjangan tetek-bengek, berbeda dengan buruh pria. Gerakan emansipasi dengan kesetaraan dan keadilan gender, semakin memperparah nasib perempuan. Bukannya mengentaskan mereka agar berhenti bekerja dan memuliakannya dengan jaminan kesejahteraan, justru meningkatkan volume buruh perempuan. Sejak dini, anak- anak perempuan sudah dicekoki pemahaman bahwa kelak ketika lulus sekolah harus bekerja agar mandiri secara ekonomi. Ironisnya, berduyun- duyunnya perempuan ke dunia kerja tidak dibarengi dengan penerapan sistem yang kondusif. Sistem sekuler-kapitalisme yang diterapkan saat ini, sama sekali tidak menjamin keamanan, kenyamanan dan kesejahteraan para buruh perempuan ini. Lemahnya sistem hukum terhadap pelaku pelecehan seksual, makin menyuburkan tindak kriminal. Bayangkan jika pemerkosa tidak dihukum berat, ia bebas berkeliaran memangsa korbannya, lagi dan lagi. Buruknya sistem kerja dan pengupahan, menjauhkan buruh perempuan dari kesejahteraan. Seperti jam kerja yang panjang hingga mengabaikan tugas utama perempuan, upah yang tak layak dan jenis pekerjaan yang menyalahi kodrat. Situasi atau lingkungan kerja yang eksploitatif, semakin menambah derita perempuan. Seperti tidak adanya pemisahan pekerja lelaki dan perempuan, minimnya jam istirahat, larangan mengenakan pakaian takwa, dan sejenisnya. Jelaslah, pengorbanan waktu dan tenaga kaum hawa ini sangat tidak setimpal dengan upah yang tak seberapa. Kerugian Non Materi Ideologi sekuler-kapitalis melalui gagasan keadilan dan kesetaraan gendernya berpandangan, perempuan yang hanya tinggal di rumah dan tak bekerja adalah beban pembangunan. Mereka menjadi beban laki-laki (ayah atau suaminya) dan beban negara. Karena itu, keberadaan perempuan bekerja akan mengurangi beban ini, sehingga pembangunan jauh lebih cepat mencapai kesejahteraan. Padahal, justru keberadaan buruh perempuan ini, mengecilkan peluang laki-laki untuk mengakses sumber- sumber ekonomi. Ketika lowongan pekerjaan disabet kaum hawa, pengangguran dari kalangan kaum adampun merajalela. Jika para pria ini menganggur, bukankah berdampak pada tidak berjalannya mekanisme pernafkahan? Inilah beban sesungguhnya. Merambahnya perempuaan di berbagai sektor, akhirnya mengabaikan tugas kodratinya di rumah. Fungsi ibu dalam keluarga beralih ke tangan pihak yang tak kompeten dan kapable. Seperti pembantu, baby sitter, atau alat elektronik (televisi, internet, game). Ini harus dibayar mahal dengan munculnya fenomena kenakalan anak dan remaja, pergaulan bebas, bunuh diri anak, perceraian, narkoba, kriminalitas dan problem keluarga lainnya. Semua itu merupakan kerugian nonmateri yang jauh lebih dahsyat dibandingkan materi yang mampu dikumpulkan kaum buruh perempuan ini. Karena itu, seharusnya negara cemas dengan semakin meningkatnya jumlah buruh perempuan, termasuk para tenaga kerja wanita (TKW), dan bukan malah bangga. Dijamin Negara Kesejahteraan bersumber dari terpenuhinya kebutuhan pokok berupa sandang, pangan, papan, pendidikan dan kesehatan. Semua itu seharusnya dijamin negara sebagai penanggungjawab rakyatnya. Sayang, negara sekuler tak memiliki paradigma seperti itu. Rakyat dipaksa mencari penghidupan dan menyejahterakan diri sendiri. Berlakulah hukum rimba, siapa yang kuat, berduit atau berkuasa, maka dialah yang memenangkan kehidupan ini. Berbeda dengan sistem Islam. Negara yang menerapkan sistem Islam, memberi jaminan kesejahteraan pada seluruh warganya, termasuk perempuan. Negara wajib menyediakan lapangan kerja seluas-luasnya bagi kaum laki-laki agar mekanisme pernafkahan di pundaknya bisa ditunaikan dengan sempurna. Sandang, pangan, papan, pendidikan dan kesehatan tersedia dengan mudah dan murah. Semestinya kaum bapak bekerja ¨hanya¨ untuk mencukupi kebutuhan makan sehari-hari, sehingga mampu mencukupi kebutuhan sekunder bahkan tersier. Dengan demikian, perempuan akan dengan senang hati di rumah, tak bersusah-payah memeras keringat. Perempuan tinggal menerima, dari ayah atau suaminya. Perempuan, khususnya kaum ibu, didudukkan pada posisinya sebagai pendamping laki-laki. Mengambil peran mengurus rumah tangga, mengatur keuangan, mendidik anak dan mendidik kaum perempuan di masyarakat. Tanpa bermaksud merendahkan para buruh perempuan, menjadi manajer di rumah sendiri, niscaya akan jauh lebih terhormat dan mulia. Meski begitu, jikapun perempuan ingin tetap bekerja dengan alasan syar´i, negara akan mengayomi. Negara wajib membuat regulasi pengupahan yang manusiawi, dan menegakkan hukuman berat bagi pelaku kriminal, baik berupa kekerasan maupun pelecehan seksual terhadap pekerja perempuan. Negara wajib memaksa perusahaan yang mempekerjakan perempuan untuk memberikan hak-haknya, seperti masalah cuti, ibadah, jam kerja yang manusiawi, tata cara berpakaian dan pergaulan yang islami. Dengan demikian perempuan akan merasa aman dan nyaman menunaikan akad kerjanya di ruang publik. Negara seperti inilah yang layak diperjuangkan, termasuk oleh kaum perempuan. Dialah Khilafah Islamiyah. Wallahuálam.[] kholda
    • Muslimah 25 Konsultasi Agar Anak Terbiasa BerdakwahDiasuh oleh: Dra (Psi) Zulia Ilmawati Menjadi Perempuan Produktif Media Umat | Edisi 104, 22 Jumadil Akhir - 6 Rajab 1434 H/ 3 - 16 Mei 2013 T erbukanya akses pendidikan, berhasil memproduksi banyak perempuan cerdas. Kiprah mereka di lapangan pekerjaan pun tak diragukan. Dokter, guru, karyawan kantor, pekerja pabrik, bahkan pebisnis banyak digeluti kaum hawa. Tak sedikit dari mereka yang paham betul bekerja itu mubah alias tidak wajib. Tapi, mereka memang tipikal perempuan yang tak bisa diam. Perempuan kreatif yang ingin terus berkarya dan produktif. Mereka ingin menyumbangkan tenaga, ilmu, pikiran dan ketrampilannya demi kemaslahatan diri, keluarga atau bahkan umat. Bukankah ada investasi pahala pula atas kontribusi positif mereka? Walhasil, bekerja bagi para perempuan ini bukan sekadar ikhtiar menjemput rezeki, tapi sarana berbagi atau mengabdi. Terlebih, banyak profesi yang membutuhkan ketekunan, kelembutan, atau ketelitian yang lebih mumpuni jika dikendalikan perempuan. Selama menaati rambu- rambu syariat Islam, tak ada yang bisa melarang aktivitas para perempuan aktif ini. Seperti tetap menutup aurat, menjaga kehormatan, menjaga pergaulan, dan tidak menelantarkan tugas pokoknya di rumah. Pasalnya, tugas utama sebagai ummu wa robbatul bayt (ibu dan pengurus rumah) dan melayani suami tak dapat digantikan orang lain. Lantas aktivitas apa saja yang memungkinkan perempuan tetap berkontribusi positif bagi umat tanpa melalaikan tugas utamanya sebagai ibu rumah tangga? Berikut beberapa yang bisa dijadikan alternatif bagi yang ingin tetap kreatif dan produktif: 1. Mengembangkan Hobi danTalenta Hobi selain mengibur diri, juga bisa menghasilkan rezeki. Coba kembangkan hobi atau talenta Anda, tentunya yang syar´i tanpa menghabiskan energi. Memasak, menjahit, merajut, mendaur-ulang, dan sejenisnya. Kalau bukan dikomersialisasi, siapa tahu bisa memenuhi kebutuhan sendiri. Daripada membeli mukena misalnya, bisa membuat sendiri sehingga lebih hemat misalnya. 2. Menjadi Pendidik Sebagai ibu, mendidik adalah keahlian wajib. Kembangkan tak hanya mendidik anak, juga anak orang lain. Mungkin dengan mengajar formal atau nonformal. Ya, menjadi guru adalah pilihan tepat banyak perempuan. Bisa dipilih, apakah mengajar paruh waktu, sekolah yang tidak full day, atau memberikan les privat di rumah. 3. Menjadi Penulis, Editor, atau Penerjemah Menulis bisa dilakukan di mana saja dan kapan saja. Sangat cocok untuk ibu rumah tangga sekalipun. Selain mencerdaskan, juga menebarkan inspirasi, ilmu dan pemahaman. Demikian pula jika ada yang ahli bahasa asing, bisa menjadi penerjemah. Siapa tahu dari tangan kaum ibu lahir karya- karya fenomenal tentang tips kerumahtanggaan, mendidik anak (parenting), kitab fikih keperempuanan atau fikih anak dan sejenisnya. 4. MenjadiTrainer, Inspirator, atau Public Speaker Umat perempuan juga butuh motivasi dalam menjalankan hidup ini. Apalagi banyak ilmu di luar bangku sekolah yang tak dimiliki kaum perempuan. Seperti ilmu kerumahtanggaan, teknik mendidik anak, dll. Tak sedikit mereka memperolehnya dari seminar, workshop, dan sejenisnya. Banyak yang bisa digali dari profesi ini, karena belum banyak pula perempuan yang menggeluti. 5. Menjadi Desainer Umumnya perempuan suka keindahan dengan detail. Tak sedikit yang suka berimajinasi tentang interior rumah, desain fashion, desain furnitur, dll. Kembangkanlah jika memiliki minat di bidang ini, karena kelak masyarakat membutuhkan sentuhan desain-desain yang islami dan syar'í.[] kholda Assalaamu'alaikumWr.Wb IbuPengasuhRubrikKonsultasiKeluargayang dirahmati Allah, kalau kita memperhatikan kondisi kehidupan masyarakat saat ini, semakin mempri- hatinkan. Semakin jauh dari syariat Allah. Rasanya miris dan khawatir bagaimana keadaan generasi mendatangjikamerekaterusdikelilingikemaksiatan dimana-mana.SebagaiMuslimtentukitatidakboleh tinggal diam. Harus ada upaya keras untuk meng- ubahnya. Sudah semestinya juga anak-anak kita dipersiapkan untuk peduli dengan persoalan ini. Mereka harus bisa melanjutkan perjuangan dengan melakukan amar ma'ruf nahi mungkar (dakwah). Karena hanya dengan cara itu sajalah kehidupan Islam akan kembali tegak dan terjaga. Untuk mempersiapkan anak-anak agar terbiasa dengan kehidupan dakwah, dan supaya kelak mereka menjadipengembandakwahyangtangguh,apasaja yangperlusayaajarkankepadamereka.Terimakasih untuksaran-sarannya. Wassalaamu'alaikumWr.Wb FDL - Bogor Wa'alaikumsalamWr.Wb. IbuFDLyangbaik, Alhamdulillah, saya bangga dengan Anda yang begitu peduli dengan kondisi umat, dan keinginannya untuk mengenalkan kehidupan dakwah sejak dini kepada anak-anak. Dakwah Islam sesungguhnya memang membutuhkan para pengembanyangtangguh.Danseorangpengemban dakwah yang tangguh tidak akan lahir begitu saja. Tapi harus melalui proses dan upaya terus menerus, bahkan sejak dari masa kanak-kanak. Maka, meng- ajak anak“berdakwah”sedari dini sangatlah penting agar anak-anak terbiasa dengan kegiatan dakwah dan akhirnya mereka juga bercita-cita menjadi pe- ngembandakwahyangtangguh. IbuFDLyangbaik, Mengenalkan kehidupan dakwah pada anak- anak dapat dimulai dengan melibatkan anak dalam aktivitas dakwah secara langsung. Hal ini penting untuk memberikan contoh dan lingkungan yang kondusif, sehingga suasana dakwah sudah bisa dirasakan anak sejak dini. Ajaklah anak turut serta ketika Anda menjadi peserta atau pembicara dalam pengajian, diskusi, seminar atau aksi-aksi protes di jalanan. Sesampai di rumah, anak bisa diminta pendapatnya tentang kegiatan yang baru saja ia ikuti. Sebelum memutuskan untuk mengajak anak pergi berdakwah tentu harus dipertimbangkan kondisi kesiapan anak. Maka, lakukan persiapan seperlunya agaranakbisa merasanyamandantidak malah menimbulkanmasalah. IbuFDLyangbaik, Mengajak anak terlibat dakwah bisa juga dilakukan secara tidak langsung. Ketika Anda harus bergegas pergi pagi-pagi untuk urusan dakwah misalnya, ajaklah anak yang besar membantu adiknya menyiapkan keperluan sekolah, atau membantu membereskan rumah. Sehingga ketika Anda kembali rumah sudah rapi. Dengan cara itu, anak akan melihat langsung kesibukan Anda dalam dakwah. Dan anak juga bisa merasakan langsung bagaimana ia ternyata bisa membantu mendukung dakwah meski hanya dengan melakukan sebagian kecil pekerjaan Anda di rumah. Cara lain yang juga penting untuk mengajak anak berdakwah adalah dengan menciptakan suasana dakwah di rumah. Misalnya dengan mengembangkan kebiasaan saling nasihat menasihati atau seringnya rumah dijadikan sebagaitempataktivitasdakwah. IbuFDLyangbaik, Untukmenumbuhkansemangatdanmotivasi, Anda bisa menceritakan kepada anak-anak bagaimana kehidupan Rasulullah dan para sahabat. Sampaikan kepada mereka bahwa kehidupan Rasulullah dan para sahabat yang tidak pernah lepas dari kehidupan dakwah. Ceritakan bagaimana perjuangan Rasulullah dan para sahabat menye- barkan Islam ke seluruh dunia. Mulai dari Bilal yang begitu istiqamah mempertahankan akidahnya, ThariqBinZiadpenaklukSpanyolatauMuhammadal Fatih penakluk Konstantinopel. Cerita-cerita seperti inipastiakanmelekateratdanmemberikanmotivasi pada anak untuk bersemangat dan berani ber- dakwah. Sesekali, penting untuk disampaikan kepada anakjanji-janjiAllahuntukparapengembandakwah. Tidak ada salahnya jika anak juga diberikan penjelasanyangbenartentangjihadmisalnya.Ketika tengahmelihattelevisiataumembacakoranbiasanya ada topik yang menarik. Bagus bila anak sudah langsung bisa berkomentar dan memberikan pendapat. Anda tinggal menambahi atau memberikan arahan serta solusi menurut Islam. Kalau anak-anak belum memberikan respon, Anda bisa memancing- nya dengan bertanya kepada mereka, apa tangga- pannya setelah melihat itu semua. Jangan lupa biasakan juga anak-anak diajak berdoa untuk kese- lamatan dan kejayaan umat Islam di seluruh dunia. Mudah-mudahankelakanak-anakbenar-benarmen- jadipengembandakwahyangtangguh.Aamiin...[]
    • 26 Ustadz Menjawab Diasuh Oleh: Ust M Shiddiq Al Jawi Hukum Royalti Buku Media Umat | Edisi 104, 22 Jumadil Akhir - 6 Rajab 1434 H/ 3 - 16 Mei 2013 Tanya: Ustadz, bagaimanakah hukum royalti buku? (Rosyid Aziz,Bogor) Jawab: Royaltibuku adalah pembayaranyangdiberikan oleh penerbit kepada penulis buku berupa persentase tertentu dari harga jual buku dalam periode tertentu. Sebagai contoh, penerbit bersepakat memberi royalti sebesar 10 persendari hargajualbuku sebesarRp30ribu yangdicetak sebanyak 5.000 eksemplar untuk cetakan pertama. Maka royalti yang diterima penulis buku besarnya adalah 10 persen (besaran royalti) dikalikan Rp 30 ribu (harga jual buku) = Rp 3.000 per eksemplar buku, kemudian dikalikan 5000 eksemplar (jumlah cetak) sehingga hasilnya adalah Rp 15 juta (lima belas juta rupiah). Jumlah ini dikurangi pajak sebesar 15 persen, sehingga royalti bersih yang diterima penulis sebesar Rp 12.750.000 (dua belas juta tujuhratuslimapuluhriburupiah). Menurutkami,sistemroyaltibukusepertiinitidaksah (fasad) secara syar'i. Sebab bertentangan dengan cara bagi hasil dalam hukum syirkah Islami, khususnya syirkah mudharabah, dalam dua aspek. Pertama, dalam sistem royalti buku, pembayaran yang diterima penulis buku sudah diketahui nominalnya dalam jumlah rupiah yang tertentu, walaupun dinyatakan dalam persentase. Bagi hasil yang demikian ini dalam hukum syirkah Islami tidak dibolehkan dan mengakibatkan syirkah menjadi fasad. Wahbah Zuhaili dalam kitabnya Al Fiqh Al Islami wa Adillatuhu, mengutip Imam Ibnul Mundzir yang menyebutkan adanya kesepakatan ulama (ijma') bahwa akad qiradh (mudharabah) hukumnya tidak sah jika salah satu atau atau kedua belah pihak dalam akad mudharabah mensyaratkan bagi hasil dalam jumlah dirham yang tertentu. (Wahbah Zuhaili, Al Fiqh Al Islami wa Adillatuhu, 4/851; Ibnul Mundzir, Al Ijma', no 529, hlm. 40; Ibnu Hazm, Maratibul Ijma', hlm. 90, Abdul Aziz Al Khayyath, Al Syarikat fiAlSyari'ahAlIslamiyyahwaAlQanunAlWadh'i,1/169). Kedua,dalamsistemroyaltibuku jumlahpembayaran yang diterima penulis buku dinyatakan dalam persentase dari harga jual buku, misalnya 10 persen dari harga jual buku sebesar Rp 30.000. Ini bertentangan dengan hukum syirkah dalam Islam, sebab jumlah pembayaran yang diterima dalam syirkah mudharabah seharusnya dinyatakan dalam persentase dari laba (profit), bukan persentase dari harga barang dagangan (dalam hal ini buku). (Wahbah Zuhaili, Al Fiqh Al Islami wa Adillatuhu, 4/850; Abdul Aziz Al Khayyath, Al Syarikat fi Al Syari'ah Al Islamiyyah wa Al Qanun Al Wadh'i, 1/169 dan 2/65; AAOIFI, Shari'aStandards,2002,hlm.233). Berdasarkan dua alasan di atas, maka jelaslah bahwa secara syar'i royalti buku hukumnya tidak sah (fasad) dan termasuk mudharabah yang fasad. Jika mudharabah fasad ini sudah telanjur terjadi dan menghasilkan laba, maka keseluruhan labanya menjadi hak penerbit buku saja. Sebaliknya jika rugi maka seluruh kerugiannya ditanggung hanya oleh penerbit buku. Adapun penulis buku, berhak mendapatkan ajrul mitsil, tanpa melihat lagi apakah muamalah ini rugi atau untung. Ajrul mitsil merupakan kompensasi yang semisal, yaitu pembayaran yang umumnya diterima penulis buku untuk semisal buku yang dia tulis. (Wahbah Zuhaili, Al Fiqh Al Islami wa Adillatuhu, babHukmAlMudharabahAlFasidah,4/851-852). Alternatif syar'i untuk royalti buku adalah mengamal- kan mudharabah yang sah, yaitu menjadikan buku sebagai modal syirkah dan bagi hasil bagi penulis buku dinyatakan dalam persentase dari profit, bukan persentase dari harga jual buku, berdasarkan kesepakatan dengan penerbit, misalnya 30 persen laba bagi penulis buku dan 70 persen laba bagi penerbit. Buku sebagai barang dagangan ('uruudh)padadasarnyatidakbolehdijadikanmodaldalam mudharabah, kecuali jika buku itu dinilai dulu ke dalam sejumlah nominal uang (taqwiim) pada saat akad maka hukumnya boleh. Kerugian ditanggung berdasarkan porsi modal masing-masing. (Taqiyuddin An Nabhani, An NizhamAlIqtishadifiAlIslam,hlm.150&154). Alternatif syar'i lainnya adalah sistem jual-putus (disebut juga flat atau outright), yaitu penerbit membayar penulis buku berdasarkan negosiasi dengan penerbit, dengan satu kali pembayaran yang tidak dikaitkan dengan hargajualbukuataucetakulang.Wallahua'lam.[]
    • 27Opini Menghadang Para ‘Paulus’ Akhir Zaman (Road To Muktamar Khilafah 2013) Oleh: Budi Kristyanto, Mantan Penganut Katholik tinggal di Perumnas Klender, JakartaTimur Media Umat | Edisi 104, 22 Jumadil Akhir - 6 Rajab 1434 H/ 3 - 16 Mei 2013 Badan Wakaf Zakat Infaq & Shodaqoh okoh awal dan yang Tpaling terkenal dalam melakukan praktek sinkretisme kekristen- an adalah Paulus. Paulus berasal dari Tarsus yang merupakan pusat penyembahan DewaMithra(Matahari).Penetrasi ajaran Kristen yang luar biasa dan menekan ajaran pagan, hal ini memaksa Paulus harus berpikir keras agar paham pagan yang dianutnya tetap eksis atau bah- kan bisa tersebar luas, bagaimana caranya?Yaitudenganmelakukan sinkretisme akidah, tentunya antara agama Kristen dan paga- nismeyangdianutnya. Berita tentang Yesus mati disalib dan kemudian bangkit kembali, membuat ide cemerlang Paulus muncul untuk mencam- purkankannya dengan paham pagan Mithraisme yang ia anut, sehingga muncullah ajaran baru dalam Kristen seperti dosa waris, penebusan dosa, dan juru se- lamat yang kemudian diadopsi olehumatKristenhinggakini. Modus operandi Paulus tersebut kemudian dilanjutkan oleh Kaisar Konstantin untuk mempertahankan dan melebar- kan kekuasaan bangsa Romawi. Pengangkatan Yesus sebagai Dewa/Tuhan pemersatu bangsa Romawi pada Konsili Nicea tahun 325M serta sinkretisme yang memosisikan Yesus sebagai anak Dewa Matahari dengan cara me- nyamakan tanggal kelahiran Yesus dengan kelahiran Dewa Matahari, itulah proses-proses sinkretisme yang ajarannya masih diadopsiumatKristenhinggakini. Sinkretismeantarayanghaq danbathilhanyaakanmemuncul- kan kebathilan baru yang bersifat laten. Sehingga paham baru hasil sinktretisme ini akan jauh lebih berbahayadaripadapahambathil yangmenjadiinduknya. “Dan janganlah kamu cam- pur adukkan yang haq dengan yang bathil dan janganlah kamu sembunyikan yang haq itu, sedang kamuMengetahui.”(TQS2:42) Bilal bin Rabah Al Habasyi ketika disiksa majikannya, Umay- yah bin Khalaf, agar bersedia menyembah berhala, tetapi de- ngan teguhnya ia selalu menja- wab, “Ahad…Ahad”. Walaupun siksaan yang sedemikian pedih- nya, dicambuk dan ditindih batu di tengah terik matahari berhari- hari tetapi tetap tidak mengubah pendiriannya untuk memperta- hankan akidahnya, hingga sang majikan hampir putus asa dan mencoba menawarkan sebuah kompromi dengan berkata kepa- da Bilal, “Anda tidak perlu me- ninggalkan iman Anda, tetapi katakanlah bahwa agamamu tidak bertentangan dengan agamaku.” Jawaban Bilal sungguh sangat diluar dugaan Umayyah, ia berkata, “tidak ada sesuatu di antarayanghaqdanbathilkecuali sesuatu yang bathil. Ketika kebe- naran bergeser walupun sedikit, maka ia kehilangan statusnya sebagaikebenaran.” Bilal bin Rabah memilih teguh dalam mempertahankan akidahnya daripada melakukan kompromi yang bisa menyebab- kan titik awal terjadinya sin- kretisme antara akidah Islam dan ajaranpaganQuraisy. Paulus Baru Bagaimana dengan yang terjadi pada saat ini? Sebagian orang yang memosisikan dirinya sebagai ulama tetapi dengan entengnya mengatakan bahwa paham paganisme modern (de- mokrasi) sejalan dengan Islam untuk mendapatkan dukungan dari masyarakat yang masih awam tentang kebathilan de- mokrasi, mereka rela menyama- kan yang haq dengan kebathilan. Padahal tubuh mereka tidak di- tindih batu, dicambuk, ataupun dijemur di terik matahari, padahal nyawa mereka tidak terancam sama sekali seperti yang terjadi padaBilalbinRabah. Malah sebaliknya, ketika mau berkompromi dengan de- mokrasi, kenikmatan duniawi dengan segera mereka raih, po- pularitas naik, harta melimpah, titel orang“bijak”ataupun“mode- rat” didapatkan. Tetapi ingatlah bahwa itu semua terlalu murah dibandingkan dengan jatuhnya kemurnian Islam. Tanpa sadar mereka menjadi para 'Paulus' akhir zaman. Mereka tidak belajar dari 'kepunahan' ajaran Kristen akibatsinkretisme. Momentum Muktamar Khi- lafah yang akan diselenggarakan HTI di berbagai kota di Indonesia Selama Mei - awal Juni 2013, insya Allah akan menjadi sebuah 'tena- ga' besar untuk menghadang seruan sinkretisme para 'Paulus' akhir zaman. Seruan personal tentunya sangat lemah, maka momentum tersebut adalah se- buah kesempatan bagi Anda menggabungkan energi yang Anda miliki untuk menciptakan energi seruan yang jauh lebih dahsyat. Semoga amal tersebut dicatat sebagai amal jariyah, bukan hanya sekedar memba- ngun masjid, tetapi membangun peradaban Islam agar hukum Allahtegakkembali.[]
    • 28 Mancanegara Beberapa foto yang diklaim sebagai ransel yang menjadi sumber bom berwarna hitam. Sementara ransel pelaku kedua versia FBI, Dzhokhar, berwarna putih. Amerika SerikatAmerika SerikatAmerika Serikat Bom Boston, Menyisakan MisteriBom Boston, Menyisakan MisteriBom Boston, Menyisakan Misteri S eperti serangan WTC, bom Boston menyisa- kan berbagai misteri. Meskipun FBI telah me- netapkan Tamerlan dan Dzhokhar Tsarnaev sebagai pelaku, beberapa pihak memper- tanyakan fakta-fakta lain yang berbeda dengan versi resmi pe- merintahAmerika. Keberadaan orang-orang yang memakai seragam berlogo “The Craft International” -kon- traktor militer swasta AS—yang terungkap dalam beberapa foto hingga kini belum terjawab. Dalam rangka apa militer swasta ini berada di tempat kejadian de- ngan peralatan yang cukup leng- kap. Dari foto-foto yang ditutup- tutupi media mainstream, gerak- gerik militer swasta ini dianggap mencurigakan. Termasuk mem- bawa ransel yang mirip dengan pelaku versi FBI. Hingga kini FBI tidak menjelaskan dan meng- abaikanhalini. Ransel mana yang meledak juga menjadi bahan perdebatan. Beberapa foto yang diklaim seba- gai ransel yang menjadi sumber bom berwarna hitam. Sementara ransel pelaku kedua versia FBI, Dzhokhar, berwarna putih. Se- mentarasangkakakyangdituduh sebagai pelaku utama tampak memakai ransel berwarna abu- abu.Ranselberwarnahitamjustru dibawa oleh orang-orang yang diduga dari militer swasta “The CraftInternational”. FBI juga dituding melaku- kan kebohongan dengan kondisi tersangka pelaku. Kondisi mayat terakhir Tamerlan yang sangat mengenaskan dipertanyakan. Mengingat dari beberapa video yang ada menunjukkan Tamerlan ditangkap dan dimasukkan ke dalam mobil dalam keadaan tidak terluka. Pemerintah AS berusaha untukmengklaimbahwapemuda yang terlihat dalam video itu bukan Tamerlan, tetapi orang lain yang ditangkap, tapi kemudian dibebaskan lagi. Meskipun demi- kian, FBI tidak menjelaskan siapa orangyangsalahtangkapitu? Ibu Tamarlan, Zubeidat sendiri dengan yakin membantah klaim pemerintah tersebut. Ia meyakini bahwa pemuda itu ada- lah anaknya, “Anak saya ada di video itu. Ia masih hidup. Apa yang mereka lakukan padanya setelahitu?” “Saya mengenal anak-anak saya, saya tahu tubuh anak saya, saya tahu setiap titik pada tubuh anak saya. Yang ada di video, itu Tamerlan. Ia dipindahkan dari satu mobil dan dimasukkan ke mobil yang lain, begitulah. Saya hanya mendengar teriakan: Ang- kat tangan! – Keluar dengan ang- kat tangan! Dan berjalan seperti ini … telanjang! Tidak ada sabuk peledak yang ia kenakan, seperti yang mereka klaim. Setelah mere- ka mengumumkan bahwa mere- ka telah membunuh seorang “teroris”, mereka menunjukkan jasadnya. Saya melihat dan meyakininya, itu anak saya, ia masih hidup sebelumnya dan di- tangkap dengan telanjang! Pe- muda itu, saya yakini adalah anak saya!Apakahkalianmengerti?” Kebenaran cerita versi FBI kondisi Dzhokhar juga menjadi misteri. Dua pejabat Amerika Serikat (AS) menyebut, tersangka bom Boston yang selamat, Dzho- khar Tsarnaev ditangkap dalam keadaan tak bersenjata. Ia ditang- kap polisi ketika bersembunyi di dalam sebuah perahu yang dipar- kirkan di halaman belakang se- buah rumah. Ini membantah pernyataan resmi sebelumnya yang mengatakan kalau ada baku tembakselamalebihdari satujam sebelumakhirnyaiaditangkap. Dalam wawancara dengan media, Zubeidat mengatakan bangga kepada kedua putranya, Tamerlan dan Dzhokhar – yang ayahnya adalah seorang Chech- nya. Dia juga tidak percaya bahwa mereka bersalah atas serangan yang dikabarkan menewaskan tiga orang dan melukai lebih dari 170 pada tanggal 15 April itu. Menurutnya orang tua tersangka, keduaanaknya dijebakolehFBI. Zubeidat terus memikirkan Dzhokhar, putranya yang masih hidup. Ia menambahkan: “Ini rasa sakit saya. Mereka adalah anak- anak yang saya besarkan dengan martabat dan saya emban dalam pelukan saya. Dan saya bangga dengan mereka, dan… juga Dzhokhar, karena saya percaya mereka tidak bersalah. Saya tidak malu dan saya siap meneriak- kannya ke seluruh dunia.”[] af dari berbagaisumber Ragukan Cerita Versi Pemerintah C raig Murray, Mantan Duta Besar Inggris untuk Uzbekistan, membuat analisis menarik dalam blognya. Menurutnya, ada celah yang mengangadalamkisahresmitentang pembomanBoston. Dia mempertanyakan, kenapa pada tahun 2012, Tamerlan Tsarnaev, yang telah membuat khawatir pihak keamanan Rusia, mampu terbang ke Rusia dan melewati pemeriksaan keamanan bandara dengan layanan keamanan paling ketat, menyeluruh dan brutal di dunia tanpa bisa ditangkap. Dia kemudian dapat melanjutkan perjalanannya ke Dagestan–yang terletak tepat di jantung pendudukan militer terketat di dunia dan terlepas dari pengawasan polisi rahasia yang terjauh jangkauannya di dunia – tanpa bisa dicegat, dan dia bisa ada sana untuk menjalankan beberapa bentuk 'pelatihan teror' atau 'indoktrinasi Islam' lebih lanjut. Dia kemudian terbang lagi keluar dariRusiatanpaadanyaintervensidaribadankeamananRusia. Menurutnya, FBI memiliki pengalaman dalam menjalankan operasi- operasi agen provokator untuk menjebak orang Islam yang mudah tertipu melakukan tindakan terorisme. Dinas keamanan Rusia juga dikenal kerap membuattuduhan palsupengebomankepadaorangChechnya.[] Pukul 07.30-08.00 WIB Media Umat | Edisi 104, 22 Jumadil Akhir - 6 Rajab 1434 H/ 3 - 16 Mei 2013 Untuk apa orang-orang yang diduga militer swasta ini ada ditempat kejadian?Untuk apa orang-orang yang diduga militer swasta ini ada ditempat kejadian?Untuk apa orang-orang yang diduga militer swasta ini ada ditempat kejadian? Kenapa FBI mengabaikan orang-orang denganKenapa FBI mengabaikan orang-orang dengan gerak-gerak yang mencurigakan ini ?gerak-gerak yang mencurigakan ini ? Kenapa FBI mengabaikan orang-orang dengan gerak-gerak yang mencurigakan ini ? Ransel mana yang menjadi sumber bom ?Ransel mana yang menjadi sumber bom ?Ransel mana yang menjadi sumber bom ?
    • 29Mancanegara K r o n i k M a n c a n e g a r a TakutKhilafahTegak,YordaniaLarangSeminarBelaSuriah Pemerintah Yordania tiba-tiba melarang tanpa alasan Konferensi Musli-mah Hizbut Tahrir untuk Membela Muslim Suriah yang seyogyanya dilaksanakan pada Sabtu, (27/4) pukul 13.00 WIB (GMT+7)diAmman. “Seminar ini diadakan untuk mengatasi kondisi yang mengerikan di Suriah, namun pemerintah Yordania melarangnya tanpa alasan,” ungkap Fika Monika Komara, Representasi Kantor Media Pusat (CMO) Muslimah Hizbut Tahrir Asia Fasifik,Sabtu(27/4). Meski gagal menggelar seminar yang bertema Bersegera Menegakkan Khilafah untuk Melindungi Para Perempuan Mulia Syam, namun ratusan Muslimah yang sudah terlanjur datang ke lokasi, menggelar protes. Dengan tertib mereka mendengarkanorasidipinggir jalan. “Dan apa yang telah dilakukan pemerintah Yordania hanya memperlihatkan wajah sesungguhnya dalam krisis Suriah ini. Pemerintah Yordania (tidak langsung tapi blak-blakan) mengakui bahwa ia memiliki hubungan dengan rezim Bashar,” tegas Nazreen Nawaz, Representasi CMOMuslimahHizbut TahrirPusat.[] MualafAmerika:'OtakKamiTidak Dicuci!' Sejak kasus bom Boston heboh dan nama Katherine Russell mencuat, stereotip dan tuduhan kembali dikaitkan dengan para mualaf wanita di Amerika. Media mengungkapkan, mereka digambarkan sebagai orang-orang yang telah dicuci otaknya. “Siapapun yang memakai kerudung, orang di Amerika menanggap bahwa ia telah kehilangan kebebasan,” kata Lauren Schreiber kepada NBC News Jumat,(26/4). Schreiber menjadi mualaf pada tahun 2010, dan sejak itu sering kali ia mendengar komentar miring tentang mualaf dan kerudung, mulai dari teroris sampai padapencucianotaksepertimediaungkapkan. Schreiber mengungkapkan banyak orang yang tidak percaya atas dirinya. Mana mungkin, seorang kulit putih dan berlogat khas Amerika memakai kerudung, namundiamenghargai ketikaorang-orangbertanyatentang dirinya. “Saya hanya ingin orang tahu bahwa ada perempuan Muslim Amerika yang mengenakan kerudung dan itu adalah keyakinan dan pilihannya sendiri, bukan karena ada orang yang memaksa merekaapalagidicuciotaknya,”katanya.[]joydariberbagaisumber G erak dakwah Hizbut Tahrir Inggris di berbagai kampus mendapat tempat di hati mahasiswa. Namun dalam waktu yang bersamaan membuat resah para pengusung demokrasi dan liberalisme. Keresahaan tersebut tercermin dalam tulisan kolumnis surat kabar PakistaniDawn HumaYusuf dalam artikel yangdimuatsitusblog-nyaNYTimes,Latitude,Jumat(19/4). “Radical Islamist groups have more and more clout on campuses (kelompok Islam radikal semakin berpengaruh di kampus-kampus),” keluhnya dalam artikel yang berjudul TheLawofExtremes. Salah satubuktinya,ungkap Huma, University of Leicester baru-baru ini menjadi tuan rumah dialog yang merupakan bagian dari kegiatan mingguan untuk kesadaran Islam, dengan tema Does God Exist? (ApakahTuhan itu ada?) dengan menghadirkan narasumber Hamza Tzortzis, yang dideskripsikan sebagai pembicara kontroversi, anti-Semit, menentanggay(homoseksual)danmenolaksistemdemokrasi. Di tempat acara itu, para peserta akan melihat spanduk dengan tulisan tangan yang menyerukan peserta laki-laki dan perempuan agar menggunakan pintu masuk yang terpisah. Dan selama berlangsungnya dialog, peserta laki-laki dan perempuan duduk di tempatmasing-masingyangterpisah. Penulis artikel tersebut berusaha mengalihkan fakta bahwa universitas kini tengah menyelidiki untuk mengetahui apakah mahasiswa laki-laki dan perempuan terpaksa duduk terpisah, yang dianggapnya sebagai perilaku yang dilarang. Ia mengutip jawaban narasumber yang menilai bahwa spanduk dibuat untuk memudahkan proses pemisahan antarajeniskelamin,dantidakuntukmemaksakannya. Namun penulis artikel di blog tersebut menilai bahwa pernyataan “untuk memudahkan”ituadalahsesuatuyangdipaksakan. Ia menyimpulkan bahwa perdebatan di University of Leicester merupakan bukti yang meyakinkan bahwa kelompok Islam radikal memiliki pengaruh yang lebih di sejumlah per-guruan tinggi. Sementara para pejabat tinggi akademik tengah berjuang untukmencaritahubagaimanauntukmeresponnya. Keresahan serupa sebelumnya ditunjukkan oleh seorang editor senior di Inggris. “Para eks-tremis Islam terlibat di lebih dari 200 kegiatan universitas pada tahun lalu. Sehingga hal ini memicu kekhawatiran baru tentang radikalisi di kampus,” ungkap Tom Whitehead dalam artikelnya yang berjudul Extremists Attend More than 200 University Events(paraekstrimisterlibatdilebihdari200kegiatanuniversitas). Dalam artikel yang dimuat situs surat kabar Inggris The Telegraph, Sabtu (12/1), editor rubrik keamanan (security editor) harian The Daily Telegraph tersebut menyimpulkan situasi di universitas-universitas Inggris dengan mengatakan: “Telah berlangsung puluhan kegiatan dengan menghadirkan para pembicara dari HizbutTahrir, yang disebutnya sebagai kelompok fanatik dan intoleransi, serta kontroversial dan dilarangolehFederasiKemahasiswaanatauNationalUnionofStudents(NUS).” Whitehead menambahkan bahwa para eks-trimis diundang di sejumlah kegiatan, meskipun Menteri Dalam Negeri Theresa May mengkritik cara universitas dalam menanggulangibahayaradikalisasidanekstremisme. Ia menegaskan, terkait banyaknya tersebar kegiatan Hizbut Tahrir pada sejumlah universitas di Inggris melalui penelitian yang dilakukan oleh kelompok kampanye hak-hak mahasiswa (campaigngroup Student Rights), yang menemukan total 214 kegiatan universitas yang menampilkan pembicara ekstrimis pada tahun lalu. Dan dikatakan bahwa pembicara yang paling terkenal adalah HamzaTzortzis, yang telah dihadirkan di lebih dari 48kegiatan. Whitehead menambahkan, Hamza Tzortzis dalam setiap kesempatan terus menyerukan pembentukan sebuah negara Islam, dan juga menyatakan permusuhannya terhadapnilai-nilaiBarat. Redaktur seniortersebutmembuktikanba-nyaknyakegiatanHizbutTahrir,meskipun sejumlah hambatan dan rintangan diletakkan di depannya. Ia mengatakan bahwa kegiatan HizbutTahrir adalah 6 persen dari total kegiatan di universitas. Padahal, kebijakan NUS adalah tidak memberikan platform pada Hizbut Tahrir. Seperti yang diungkap dari hasil penelitian bahwa ada delapan kegiatan yang dipindahkan dan sepuluh dibatalkan setelahadanyakeberatan. Sampai di situ tulisannya terbilang propor-sional. Namun pada paragraf berikutnya, entah berniat atau tidak untuk mengacaukan masalah dan menyesatkan pembaca, maka ditemukansesuatuyangtidakadahubungannyasamasekalidenganHizbutTahrirdengan mengaitkaitkanHTdenganteroris. Begitulah curangnya para pengusung demokrasi, bila secara intelektual kalah, maka dilancarkanlahfitnah.NamunakanefektifkahmenjauhkanmahasiswadariideIslam?Insya Allahtidak.[]bajuri/joy Media Umat | Edisi 104, 22 Jumadil Akhir - 6 Rajab 1434 H/ 3 - 16 Mei 2013 InggrisInggrisInggris Di Kampus Marak Seruan KhilafahDi Kampus Marak Seruan KhilafahDi Kampus Marak Seruan Khilafah Pengusung Demokrasi ResahPengusung Demokrasi ResahPengusung Demokrasi Resah
    • Kematian: Penghancur Segala KenikmatanKematian: Penghancur Segala KenikmatanKematian: Penghancur Segala Kenikmatan 30 Hikmah Media Umat | Edisi 104, 22 Jumadil Akhir - 6 Rajab 1434 H/ 3 - 16 Mei 2013 idup itu nikmat. Panjang umur itu nikmat. HSehat itu nikmat. Memiliki tubuh sempurna serta wajah yang tampan atau cantik itu nikmat. Mempunyai harta banyak itu nikmat. Memiliki rumah indah, mobil mewah, tanah yang luas dan segala kekayaan itu nikmat. Mempunyai anak dan istri itu nikmat. Memiliki waktu luangpunnikmat. Namun, hendaklah setiap Muslim ingat, bahwa seluruh nikmat itu pada akhirnya akan hancur dan lenyap. Kematianlah yang menghancurkan dan melumat habis seluruh nikmat di dunia ini. Karena itulah seorang Muslim hendaknya banyak mengingat-ingat penghancur nikmat tersebut, sebagaimana sabda Baginda Rasulullah SAW “Perbanyaklah mengingat penghancur kenikmatan (yakni kematian,pen.).”(HRat-Tirmidzi). Mengapa kita harus banyak mengingat kematian sebagai penghancur segala kenikmatan duniawi? Tidak lain agar kita tidak terlalu disibukkan oleh perburuan atas segala kenikmatan duniawi yang bakal lenyap itu sehingga melupakan mengejar kenikmatan hakiki di akhiratnanti,yaknisurgayangabadi. Setiap manusia pasti bakal mati. Tentu, ini sudah sama-sama disadari. Kematian adalah pintu manusia menuju akhirat dengan meninggalkan dunia yang fana dan penuh dengan tipudaya ini. Demikianlah sebagaimana firman Allah SWT (yang artinya): Setiap yang berjiwa pasti bakal merasakan kematian. Sesungguhnya pada Hari Kiamat sajalah pahala kalian disempurnakan. Siapa saja yang dijauhkan dari neraka dan dimasukkan ke dalam surga telah beruntung. Kehidupan dunia itu tidak lain hanyalah kesenangan yang menipu (TQS Ali Imran [3]: 185). Saat ajal datang tiba, tentu manusia manapun tak bisa mengelak. Tak bisa kematian dimajukan atau dimundurkan. Karena itu bunuh diri, misalnya, bukanlah sebab kematian karena banyak orang bunuh diri—jika belum tiba ajalnya—tak mengalami kematian. Kecelakaan motor atau mobil juga bukan sebab kematian. Sebabnya, banyak orang mengalami kecelakaan—bahkan sangat parah—tidak otomatis mengalami kematian jika ajalnya belum datang. Sebaliknya, betapa banyak orang mati justru saat di tempat pembaringan. Karena itu, sebab kematian hanyalah satu: datangnya ajal. Ajal, jika datang, tak bisa ditawar-tawar. Demikianlah sebagaimana firman Allah SWT (yang artinya): Jika ajal mereka telah datang maka mereka tidak akan bisa menundanya dan tidak pula bisamemajukannyasesaatpun(TQSan-Nahl[16]:61). Bagi seorang Mukmin atau Muslim yang bertakwa, kematian tentu tak perlu dikhawatirkan. Yang pantas dan layak ditakutkan adalah sejauh mana amal shalih yang dilakukan saat di dunia sebagai bekal menghadap Allah SWT pada Hari Kiamat nanti. Inilah seharusnya yang mesti selalu menjadi bahan muhasabah setiap Mukmin. Dalam hal ini, Allah SWT berfirman (yang artinya): Hai orang- orangyangberiman,bertakwalahkaliankepadaAllah,dan hendaknya setiap diri memperhatikan apa yang telah dia perbuat untuk hari esok (Hari Kiamat) (TQS al-Hasyr [59]: 18) Mengapa kita perlu selalu memikirkan tentang sejauh mana kita telah melakukan amal shalih untuk bekal menghadapi Hari Kiamat? Sebabnya, di akhirat nanti akan banyak manusia yang menyesali dirinya sendiri karena kurangnya amal shalih yang dia lakukan saat di dunia. Allah SWT menggambarkan keadaan manusia seperti ini melalui firman-Nya (yang artinya): (Demikianlah) hingga apabila datang kematian kepada seseorang dari mereka, dia berkata, "Tuhanku kembalikanlah aku (ke dunia) agar aku bisa berbuat amal shalih yang telah aku tinggalkan.” Sekali-kali tidak. Sesungguhnyaitu adalah perkataanyang diaucapkansaja(TQSal-Mu'minun[23]:99-100). Karena itulah, seorang Mukmin sejatinya tidak boleh dilalaikan oleh harta dan anak-anaknya dari beramal shalih, termasuk di dalamnya membelanjakan harta di jalan Allah SWT. Dalam hal ini, Allah SWT pun mengingatkan kita (yang artinya): Hai orang-orang beriman,janganlahhartadananak-anakkalianmelalaikan kalian dari mengingat Allah. Siapa saja yang berbuat demikian, mereka itulah orang-orang yang merugi. Belanjakanlah sebagian (harta) dari apa yang telah Kami berikan kepada kalian sebelum datang kematian kepada salah seorang di antara kalian, lalu ia berkata, "Tuhanku, mengapa Engkau tidak menangguhkan (kematian)-ku sampai waktu yang dekat hingga aku dapat bersedekah dan aku termasuk orang-orang yang shalih?" Allah sekali- kali tidak akan menangguhkan (kematian) seseorang apabila telah datang waktu kematiannya. Allah Maha Mengenal apa yang kalian kerjakan (TQS al-Munafiqun [63]:9-11). Karena itu, Baginda Nabi Muhammad SAW mengingatkan kita, “Jadilah kamu di dunia ini seperti orang asing atau seperti orang yang berada dalam perjalanan.”(HRal-Bukharidanat-Tirmidzi). Ya, bagi seorang Muslim, hidup di dunia ini hakikatnya ia seperti orang asing. Sebab, 'tanah air'-nya yang hakiki adalah surga. Surgalah, insya Allah, tempat ia berpulang. Manusia di dunia ini, dengan demikian, seperti seorang musafir yang meninggalkan negerinya untuk sementara, kemudian ia akan kembali. Karena itu ia tentu tidak akan mengambil bagian dari kenikmatan dunia ini, kecuali sekadarnya saja untuk bekal kembali (ke akhirat) (Muhammad bin'Alan,Dalilal-FalihinliThuruqRiyadhash- Shalihin,III/7). WamatawfiqiillabilLah.[]abi
    • 31Media Umat | Edisi 104, 22 Jumadil Akhir - 6 Rajab 1434 H/ 3 - 16 Mei 2013