Media Umat _ 104

1,740 views

Published on

Media Umat _ 104

Published in: Education
0 Comments
1 Like
Statistics
Notes
  • Be the first to comment

No Downloads
Views
Total views
1,740
On SlideShare
0
From Embeds
0
Number of Embeds
3
Actions
Shares
0
Downloads
46
Comments
0
Likes
1
Embeds 0
No embeds

No notes for slide

Media Umat _ 104

  1. 1. HargaRp.000,-LuarjawaRp.500,-HargaRp.000,-LuarjawaRp.500,-6767HargaRp.000,-LuarjawaRp.500,-67 Edisi 104, 22 Jumadil Akhir - 6 Rajab 1434 H/ 3 - 16 Mei 2013 MERUSAKMERUSAKMERUSAK A Q I D A HA Q I D A HA Q I D A H SINETRONSINETRONSINETRON Caleg“Indonesia Idol”2014Caleg“Indonesia Idol”2014Caleg“Indonesia Idol”2014 Media NasionalMedia NasionalMedia Nasional Mereka Ingin UmatTakMereka Ingin UmatTak Percaya SyariatPercaya Syariat Mereka Ingin UmatTak Percaya Syariat Wawancara: Iwan JanuarWawancara: Iwan Januar Lajnah Siyasiyah DPP HTILajnah Siyasiyah DPP HTI Wawancara: Iwan Januar Lajnah Siyasiyah DPP HTI Bom Boston, Menyisakan MisteriBom Boston, Menyisakan MisteriBom Boston, Menyisakan Misteri MancanegaraMancanegaraMancanegara Tak Ada Alasan BBM NaikTak Ada Alasan BBM NaikTak Ada Alasan BBM Naik Hukum Royalti BukuHukum Royalti BukuHukum Royalti Buku Ustadz MenjawabUstadz MenjawabUstadz Menjawab FokusFokusFokus www.mediaumat.comwww.mediaumat.comwww.mediaumat.com
  2. 2. Salam Media Pembaca2 S a l a m R e d a k s i Assalamu’alaikumwarahmatullahiwabarakatuhu Salam Perjuangan! Alhamdulillah, Allah masih memberikan kenikmatan kepada kita semua sehingga kita bisa menjadi bagian dari perjuangan menegakkan kembali syariah Islam. Sungguh, tidak banyak orang yang diberi kenikmatan sebagai pejuang. Sebaliknya, banyak orang yang menjadi hamba-hamba dunia, terpedaya oleh fatamorgana. Pembaca yang dirahmati Allah, jika kita sadar posisi kita sebagai makhluk ciptaan Allah, tentu kita akan senang melaksanakan ketentuan Allah. Soalnya, pasti aturan Allah itu pas dengan manusia. Allah Maha Mengetahui apa yang manusia butuhkan dan apa yang harus manusia tinggalkan. Dan pasti, aturan Allah akan membuat manusia bahagia di dunia dan akhirat. Sayangnya, banyak orang yang mengingkari aturan Allah ini dengan banyak dalih. Padahal mereka itu mengaku dirinya orang- orang yang beriman. Lantas di mana logikanya? Apakah aturan manusia itu jauh lebih bagus dari aturan Allah? “Apakahhukum Jahiliyahyangmerekakehendaki,dan(hukum)siapakahyanglebih baikdaripada(hukum)Allahbagiorang-orangyangyakin?”(TQSAl Maidah:50) Pembaca yang dirahmati Allah, akibat kita menjauh dari Alquran dan Sunnah, negeri ini kian terpuruk dalam segala bidang. Masalah demi masalah menghinggapi kita dari waktu ke waktu. Keberkahan hidup hanya tinggal impian. Setelah tarif listrik naik pada awal April lalu, kini pemerintah berencana menaikkan harga bahan bakar minyak (BBM). Jelas, kenaikan ini akan memberatkan masyarakat, meski tidak semua jenis kendaraan merasakan kenaikan tersebut.Tapi dapat dipastikan, angka inflasi akan naik. Dampaknya, ya kepada rakyat semuanya, bukan hanya sekelompok pemilik mobil saja. Lalu kenapa pemerintah ngotot menaikkan harga BBM?Tidak adakah cara lain untuk mengatasi apa yang disebut pemerintah sebagai 'kenaikan subsidi'? Masalah ini akan kami kupas di rubrik Fokus. Di Media Utama, kami menyoroti bagaimana bahayanya siaran televisi khususnya acara sinetron bagi umat ini. Memang, acara tersebut kesannya hanya sekadar hiburan, tapi sebenarnya isi di dalamnya sarat dengan pesan-pesan yang bisa merusak akidah. Kalau Anda jeli menonton acara sinetron, belakangan banyak sinetron berlatar belakang kehidupan Islam, mulai dari pesantren, sekolah, sampai rumah tangga.Tapi, apa yang digambarkan, banyak hal-hal yang menyimpang. Apa saja? Apakah para produser sinetron ini sengaja membuat tontonan seperti itu dengan maksud tertentu? Mengapa pemerintah diam saja? Ada pengalaman menarik ketika kami meminta tanggapan MenkominfoTifatul Sembiring soal sinetron ini. Ia langsung merespon sms yang kami kirimkan dengan menelopon balik dalam waktu 1,5 jam kemudian. Ini di luar dugaan kami sebelumnya. Isinya? Silakan Anda baca di rubrik Media Utama dan Aspirasi. Pembaca yang dirahmati Allah, di rubrik lain Anda tetap akan mendapatkan suguhan kami yang uptodate, menarik, dan berisi. Semoga sajian kami ini senantiasa menambah cakrawala berpikir Anda. Akhirnya, kami sampaikan selamat membaca! Sebarkan pengetahuan Anda—dan juga media ini—kepada saudara-saudara kita yang lain! Semoga Allah melimpahkan pahala. Aamiin. Wassalamu’alaikumwarahmatullahiwabarakatuhu Penerbit: Pusat Kajian Islam dan Peradaban. Dewan Penasihat : KH Ma'ruf Amien, KH Nazri Adlani, KH Amrullah Ahmad, KH Syukron Makmun, KH Muhammad Arifin Ilham , KH Athian Ali M Dai, AchmadMichdanSH,HAzwir,KHdrMuhammadUtsman, HHariMoekti,UstadzAbuBakarBaa'syir,AGHSanusiBaco,Lc,KHDRMiftahFaridl,DraHjNurdiatiAkmaM.Si,DraHjNurniAkma,ProfDrIr Zoer’aini Djamal Irwan MS, KH Husin Naparin, Lc, MA. Penasihat Hukum: Achmad Michdan SH. Pemimpin Umum/Pemimpin Redaksi: Farid Wadjdi. Pemimpin Perusahaan: Anwar Iman. SidangRedaksi:HafidzAbdurrahman,MRKurnia,HaristAbuUlya,MuhammadIsmailYusanto,RochmatS.Labib.RedakturPelaksana:Mujiyanto.Redaksi:Walmaroky,Zulkifli,JokoPrasetyo,Iwan Setiawan, Zulia Ilmawati, NanikWijayati, Febrianti Abbasuni, Kholda. Kontributor Daerah: Rifan (Jatim), Fakhruddin (Babel), Apri Siswanto (Riau), Rikhwan Hadi (Sumbar), Kurdiyono & Ahmad Sudrajat (DIY), Eko (Sultra), Nazar Ali& Handani (Jabar), BahrulUlum (Sulsel), Abduh(Kalsel), Budianto Haris (Sumsel), Dani Umbara Lubis (Sumut), Dadan Hudaya (Banten) Desain dan Pracetak: KholidMawardi.Keuangan:BudiDarmawan.Marketing:MuhammadIhsan.Sirkulasi: WWahyudi.Iklan:ArisRudito,MRosyidAziz.AlamatRedaksi:Jl.Prof.SoepomoNo.231,JakartaSelatan 12790. Email: pembaca.tabloidmu@gmail.com. Iklan Pemasaran: Jl. Prof. Soepomo No. 231, Jakarta Selatan 12790. Email Iklan: iklan.tabloidmu@gmail.com . Email Marketing: marketing.tabloidmu@gmail.comHuntingPemasaran:085711044000,sms:089650202478. HuntingIklan: 085780137043.Rekening:BankMuamalatNoRek9064150699a.nBudiDarmawan. www.mediaumat.comwww.mediaumat.comwww.mediaumat.com J E L A J A H I SMS Redaksi: 081288020261. Sertakan Nama dan Asal SMS Media Pembaca/Komentar untuk MU: 08998206844. Sertakan Nama dan Asal daerah. SMS Berlangganan: 0857 8013 7043 Media Umat | Edisi 104, 22 Jumadil Akhir - 6 Rajab 1434 H/ 3 - 16 Mei 2013 DPP HizbutTahrir Indonesia (HTI) berkunjung ke Kantor Media Grup dalam rangka silaturahmiDPP HizbutTahrir Indonesia (HTI) berkunjung ke Kantor Media Grup dalam rangka silaturahmi bersama pimpinan Media Indonesia dan MetroTV, Senin (29/4) Kedoya, Kebon Jeruk, Jakarta.bersama pimpinan Media Indonesia dan MetroTV, Senin (29/4) Kedoya, Kebon Jeruk, Jakarta. DPP HizbutTahrir Indonesia (HTI) berkunjung ke Kantor Media Grup dalam rangka silaturahmi bersama pimpinan Media Indonesia dan MetroTV, Senin (29/4) Kedoya, Kebon Jeruk, Jakarta. M e d i a Pe m b a c a Demokrasi Cacat Demokrasi membuat negara cacat dan masyarakatnya juga cacat, karena menjadikan hukum buatan tangan manusia yang diterapkan dalam kehidupan. Demokrasi menghancurkan umat Muslim di dunia. Untung saya berada dalam dakwah pembebasan sistem kapitalis dan tahu busuk dari sistem demokrasi. Insya Allah perjuangan saya dalam dakwah ini tetap terus tegar dan istiqamah untuk "Perubahan besar dunia menuju Khilafah". Allah swt berfirman: "Kemudian kami jadikan kamu berada diatas suatu syariat (peraturan) dari urusan (Agama) itu, maka ikutilah syariat itu dan janganlah kamu ikuti hawa nafsu orang-orang yang tidak mengetahui (QS. Al-Jaatsiyah : 18) Demokrasilah hukum yang mengikuti hawa nafsu manusia. Sebagai manusia kita harus berjuang untuk menegakkan hukum Allah di muka bumi ini yaitu syariah dan khilafah. Wallah a'lam bi ash-shawab. Maria Ulfa. Ternate-Maluku Utara. +6285712079xxx Perbedaan Demokrasi Perbedaan antara demokrasi dan khilafah; demokrasi bersumber dari kafir Barat. Khilafah bersumber dari Allah. Demokrasi belum 1 abad sudah diambang kehancuran dan jutaan kasus kriminal diadili, khilafah tegak selama 14 abad hanya sekitar 200 kasus yang diadili. Demokrasi menciptakan jutaan orang miskin bahkan orang kaya pun ikut-ikutan antri raskin. Khilafah menyejahterakan bahkan hampir tidak ada orang yang mau menerima zakat. Demokrasi itu crazy, khilafah itu perfect. Pilihan di tangan anda, mau hadap sengsara atau sejahtera. mau jadi pendukung, pemain, atau penonton. Muslimin al-Fatih. Sangatta-Kutai Timur. +6281355495xxx Tiada Kemuliaan Assalamualaikum. Wahai saudara seakidah, tiada kemuliaan tanpa Islam, karena Islam agama yang sempurna. Insya Allah Islam yang kita rindukan akan ditegakkan ditengah-tengah kita. Semoga tangan- tangan kita syabab di Indonesia kelak juga ikut bersaksi di hadapan Allah SWT atas ikhtiar kita. So do the best for Islam. Zahra. Magelang. +6287834167xxx Aturan yang Benar Assalamu'alaikum. Umat Islam paham dan tahu bahwa aturan hidup yang tepat dan benar adalah dari Allah dan Rasul-Nya yaitu Alquran dan hadits. Akan tetapi mengapa mereka enggan untuk melaksanakan atau menjadikan aturan tersebut menjadi aturan universal kehidupan? Dan kita jika tahu bahwa aturan manusia adalah banyak yang salah dan selalu menimbulkan permasalahan yang rumit dan bertambah kacau. Buktinya di negeri kita ini, walaupun presiden ganti sampai hari kiamat pun, tapi sistemnya tak diubah dengan aturan Allah yaitu sistem khilafah ala minhajin nubuwwah, negeri ini tetap menjadi negeri yang bobrok yang penuh dengan penyakit yang ganas dan menjijikkan. Oleh karena itu wahai saudaraku seiman dan seislam sambutlah dengan semangat jihad untuk gigih memperjuangkan khilafah tegak di bumi Allah SWT. Agar Allah menurunkan berkahnya dari langit. Samsul. Mojokerto. +6285748396xxx BhinnekaTunggal Ika Di manakah bhineka tunggal ika?? Hal ini patut dipertanyakan. Karena dengan konsep bhineka tunggal ika negeri kita itu menganggap bahwa meski Indonesia terdiri dari berbagai suku, agama dan budaya, namun, mereka tetap bisa bersatu. Akan tetapi faktanya kita bisa melihat dengan meningkatnya konflik sosial yang ada di masyarakat baik konflik yang bersifat individual maupun kelompok. Dengan kondisi ini kita bisa menilai bahwa konsep bhineka tunggal ika telah gagal menyatukan masyarakat Indonesia. Sebenarnya kalau kita mau membuka mata hati dan pikiran kita ada satu ikatan yang mampu menyatukan tidak hanya masyarakat Indonesia bahkan masyarakat dunia yaitu ikatan akidah Islam.
  3. 3. Editorial 3 arut marut negeri ini sungguh menyesakkan dada kita. Sungguh sulit diterima nalar, bagaimana Kseorang bocah kecil yang berusia 8 tahun – kalau kemudian memang terbukti benar—tega membunuh teman sepermainannya sendiri, yang usianya baru 6 tahun. Sampai sekarang polisi belum bisa memastikan apa motif sebenarnya tersangka pelaku. Diduga karena korban memiliki utangseriburupiahkepadapelaku.Bagaimanamungkinanaksekecilitusudahmenjadipembunuh? Maraknyapencabulan,pemerkosaan,sampaipembunuhansangatmengkhawatirkankita. Pelakunyapun tak jarang masih berusia sangat muda. Seperti yang terjadi di Gowa Sulawesi Selatan, lima orang siswa SD memerkosatemannyasendiri,akibatkecanduannontonfilmporno. Marakhyapulapencabulanyangdilakukan justru oleh ayah sendiri yang seharusnya menjadi pelindung, atau oleh guru sendiri yang seharusnya menjadi teladan. Kita juga bersedih melihat lima orang siswa SMA 2 Tolitoli mempermainkan shalat, seperti yang kita saksikan dalam laman Youtube. Apakah begitu buramnya kondisi pendidikan kita, sehingga mereka tega mempermainkanibadahsuciumatIslam? Kita juga sulit mencari prestasi dari negara ini yang bisa kita banggakan. Hampir semua perkara, negara tidak becus mengurusnya. Mengurus Ujian Negara (UN), yang sudah puluhan tahun dilakukan, tidak becus. Banjir dan kemacetan, seolah menjadi masalah yang tidak bisa diselesaikan, terus terjadi dan berulang. Harga- hargapunseringkalisulitdikontrolsepertibawangdandaging. Masalahkorupsipunmembuatkitamiris.Meskipunsudahbanyakkoruptor yangditangkap,dihukumdan dipenjarakan, namun masih saja koruptor-koruptor baru bermunculan. Saat media marak membicarakan korupsi proyek pembangunan pusat sarana olahraga nasional Hambalang, Bogor, KPK menangkap ketua DPRD Bogor,IyusJuhersebagaitersangkakasuspembangunanmakamyangjugaadadiBogor. Sulitnyamemberantaskorupsiinisampai-sampaiPresidenSBYmengungkapkanrasafrustasi,kejengkelan, dan kegeramannya. Di depan peserta dialog Forum Pasar Global di Singapura (23/4), Presiden SBY menyatakan betapasulitnyamemberantaskorupsidiIndonesia. Tidak hanya itu, pemerintah pun kembali dengan teganya menyusahkan rakyatnya sendiri. Pemerintah bersikukuh untuk menaikkan harga BBM. Apapun ceritanya, pengalaman menunjukkan kenaikan BBM pasti akanmenambahbebanhidupmasyarakat. Menurut pengamat ekonomi Komite Ekonomi Nasional (KEN) Nina Septi Triaswati, dengan menaikkan harga BBM menjadi Rp 6.500 per liter per Mei 2013, pemerintah hanya akan menghemat Rp 16 trilyun hingga akhir tahun. Sementara sebenarnya masih banyak cara lain untuk mendapatkan Rp 16 trilyun itu, tanpa menaikkanBBMyangsudahdidugakuatakanmemberikandampakyangmenyulitkanmasyarakat. UntukmendapatkanRp16trilyun,kenapatidakdihematdaribelanjabirokrasidiAPBN2013yangbesarnya mencapai Rp 400,3 trilyun. Kenapa pula pemerintah selalu menjadikan rakyat sebagai tumbal kebijakannya? Padahal di sisi lain kita akan punya pendapatan yang sangat besar hingga ratusan trilyun kalau kekayaan alam berupa tambang-tambang yang dikuasai asing itu diambil alih, dikembalikan sebagai pemilikan rakyat, yang dikelola oleh negara dengan baik, dan hasilnya untuk kepentingan rakyat. Lagi-lagi kenapa selalu rakyat yang dijadikantumbal? Kita kembali tegaskan inilah potret negara demokrasi yang kita anut. Semua karut marut yang kita hadapi sekarang pangkalnya adalah sistem demokrasi. Demokrasi, bukan hanya sistem kufur, namun juga telah melahirkan berbagai banyak persoalan. Demokrasi, telah melahirkan sistem politik transaksional, yang menumbuhsuburkankorupsidankolusi. Liberalisme (kebebasan) yang menjadi nilai penting dari sistem demokrasi telah benar-benar merusak. Kebebasan bertingkah laku, memarakkan kemaksiatan dan kejahatan seksual. Kebebasan pemilikan telah melahirkan sistem ekonomi kapitalisme yang rakus. Ekonomi yang memiskinkan rakyat dan memberikan jalan pada negara-negara imperialis untuk merampok kekayaan alam kita. Perlu kembali kita garis bawahi, semua ini merupakanpenyakitbawaandarisistemdemokrasi.Bukanpenyimpangandarisistemdemokrasi. Maka, demokrasi tak perlu diluruskan karena sistem ini telah sakit sejak lahir dan mengandung dan memproduksivirusberbahayadaritubuhnyasendiri.Yangharuskitalakukanadalahmencampakkandemokrasi ketongsampahperadaban. Tidak berhenti di sana, kita menggantikannya dengan sistem yang dijamin kebenarannya karena berasal dari Allah SWT, yaitu sistem Islam. Sistem inilah yang akan menerapkan syariah Islam secara menyeluruh, denganKhilafahsebagaiinstitusinegaranya. Siapapun yang berpikir sehat, apalagi didasarkan kepada akidah Islam, akan menyimpulkan, kita tidak butuh sistem demokrasi yang kufur dan merusak ini! Yang kita butuhkan adalah sistem Khilafah yang akan menerapkan syariah Islam. Dengan itu kita akan mendapatkan keridhaan Allah SWT, kebaikan di dunia maupun diakhirat.[]faridwadjdi K o m e n t a r u n t u k M U Siapa ButuhSiapa Butuh Negara Demokrasi ?Negara Demokrasi ? Siapa Butuh Negara Demokrasi ? Media Umat | Edisi 104, 22 Jumadil Akhir - 6 Rajab 1434 H/ 3 - 16 Mei 2013 Rubrik tentang Mahasiswa Assalamualaikum. Semoga MU semakin jeger, mau usul, gimana kalo MU, membuat artikel tentang dunia kampus, atau lebih bagus kalau HT membuat majalah untuk mahasiswa, sebagai bahan dakwah untuk mahasiswa, pengusaha udah ada, remaja sudah ada, mahasiswa? Syukron. Mursalin. Riau. +6285376920xxx Keterangan Lengkap Assalamu'alaikum. Subhanallah penjelasan yang dimuat di dalam MU sangat lugas dan revolutif, sehingga membuat para pembaca bersemangat untuk membaca. Saya memberi saran sedikit agar setiap sumber atau kutipan disertakan dengan keterangan lengkap, contoh: pada bagian editorial, edisi 101 "Dua Tahun Revolusi Suriah", kitab Ishabah karya al asqalani yang lengkapnya adalah Al Ishabah fi Tamyiz ash Shahabah. Husein. Pekanbaru-Riau. +6282392163xxx Profil Amir HT Assalamualaikum. Kalau bisa MU juga muat profi-profil amir dan syabab Hizbut Tahrir yang tengah berjuang menegakan khilafah, supaya bisa jadi contoh bagi para pejuang khilafah Islam yang lain. Abu Ammar. Bukittinggi. +6285664000xxx Terima Kasih MU Assalamualaikum. Pertama saya ucapkan kepada MU yang telah banyak membantu saya, keluarga saya, dan teman-teman saya. Yang tadinya tidak tahu khilafah sekarang jadi tahu. Dan apa itu demokrasi, demokrasi hanya menyengsarakan rakyat. Sekali lagi terima kasih buat MU. Karenamu aku jadi tahu, teruskan perjuangkan agama Allah. Aku mendukungmu. Allahu Akbar. Acep Ali. Singaparna-Tasikmalaya. +6282317508xxx Wassalamualaikum wr wb. Alhamdulillah, terima kasih atas saran dan masukan para pembaca semua. Semoga kami bisa memberikan yang terbaik kepada Anda. Beberapa usulan tambahan rubrik, tampaknya sulit karena keterbatasan ruang. Tapi tetap akan tampilkan tentang aktivitas kampus secara temporal. Profil singkat Amir HT sudah kami tampilkan edisi lalu. Redaksi. Ketika ikatan akidah ini telah terpatri dalam diri masyarakat tidak hanya konflik sosial yang dapat teratasi juga masalah lain yang sedang melanda seperti kemiskinan, korupsi dan kriminal sebab ketika masyarakat sudah menanamkan ikatan akidah pasti mereka punya satu tujuan yang sama yaitu mendirikan daulah Islam yang nyata. Ummu Ghozy. Magelang. +6285725914xxx Bertentangan dengan Islam Demokrasi bertentangan dengan Islam. Inti dari demokrasi adalah kedaulatan rakyat, menyerahkan hak membuat hukum kepada manusia. Sedangkan dalam Islam yang berhak membuat hukum hanyalah Allah, selain itu demokrasi adalah salah satu bentuk kesyirikan karena menjadikan manusia sebagai tandingan bagi Allah. Wahai saudaraku umat Islam layakkah kita menjadi pemuja demokrasi? Safar Abu Anam. Aceh. +6281260713xxx Hukum Sekuler Dalam sistem kapitalis yang jelas akidahnya adalah sekuler, maka seluruh kehidupan umat akan diatur dengan hukum- hukum yang sekuler. Hukum-hukum yang meniadakan campur tangan Allah dalam kehidupan. Lingkup pendidikan yang notabene sebagai wadah untuk mencetak generasi juga tak luput dari tatanan kurikulum yang sekuler. Akhirnya banyak sekali pemahaman-pemahaman yang bertentangan dengan Islam. Sebagai contoh kecil saja teori evolusi Darwin, manusia purba dan pendapat orang-orang atheis dicekokkan kepada para siswa untuk menerima mentah- mentah pemahaman tersebut yang akhirnya membekas di benak pelajar, dan menjadikan mereka sedikit ragu akan keimanannya pada Allah bahwa manusia diciptakan oleh Allah. Dari situ saja, sebenarnya jka kita mau dengan ikhlas membuka mata, dan hati akan sangat terlihat jelas bagaimana upaya kaum kafir menghancurkan akidat umat. Sungguh tak kan kita dapatkan pemurnian akidah yang semurni-murninya kecuali dalam sistem yang menjamin kemurnian ketaatan kepada Allah. Itulah khilafah ala minhaj an- nubuwwah. Aruum-Tuban. +6285731299xxx
  4. 4. 4 Media Utama Islam disodok lewat sinetron-sinetron konyol dan bodor, tapi negara mendiamkannya. Kok bisa? S etiap hari pemirsa televisi di Indonesia di- suguhi tontonan sine- tron. Bukannya sine- tron yang membuat orang tambah pintar, tapi justru tambah bodoh alias blo'on. Bagai- mana tidak, sinetron-sinetron itu jauh dari realitas sosial, meng- awang-awangtakkaruan. Anehnya, yang kini banyak tayangdanmendapatratingting- gi itu adalah sinetron-sinetron yang digambarkan berlatar bela- kang kehidupan umat Islam. Mulai pribadi Muslim, keluarga Muslim, dan komunitas Muslim (pesantren). Tapi bukannya keba- ikan yang ditonjolkan, sebaliknya adalah karakter buruk para to- kohnya. Lihat saja sinetron Ustad Fotocopy, Islam KTP, Haji Medit (SCTV), Tukang Bubur Naik Haji (RCTI), Berkah (RCTI) dan Oesman 77 (Trans TV). Sinetron-sinetron tersebutmemperolehratingyang tinggi. Lama kelamaan muncul ke- san ada unsur kesengajaan untuk melecehkan simbol-simbol Islam. Bagaimanadigambarkanseorang haji yang tidak mencerminkan sama sekali sikapnya sebagai seorang haji. Juga seorang us- tadzah juga yang digambarkan sangat narsis. Ada pula santri se- buah pesantren yang digam- barkan sangat gaul dan dengan mudahnyapacaran. Pantas saja, penggambaran yang buruk simbol-simbol Islam itu menuai protes masyarakat. Mereka mendesak pemerintah menghentikan tayangan-ta- yanganyangtidakmendidikini. Di luar itu, banyak tayangan televisi —termasuk sebagian sinetron— yang membahayakan akidah umat. Tayangan itu meng- gambarkan ketakhayulan dan juga klenik-klenik. Bagaimana tokoh-tokohnya sakti mandra- gunaakibatbantuan'jimat'dalam berbagai bentuknya. Juga ada tayangan yang mengeksploitasi 'dunia lain' sehingga membuat pemirsanya takut terhadap setan, dan jin—sikap yang dilarang oleh agama. Bisnis Besar Di balik sinetron-sinetron berating tinggi itu ternyata ada bisnis besar. Para kapitalis pemilik televisi diuntungkan sangatbesar dengan keberadaan sinetron ter- sebut. Dengan sinetron yang ratingnya tinggi maka pemasang iklan akan berbondong-bondong memasang iklan, kendati harga iklanselangit. Bagi stasiun televisi itu sen- diri, tayangan sinetron tak me- merlukan banyak kerja. Tak perlu susah-susah menyiapkan sumber daya manusia dan peralatan yang mahal. Penggarapannya dilaku- kan oleh pihak lain, dalam hal ini rumah produksi. Begitu sinetron sudah jadi, stasiun televisi tinggal menayangkannya. Di sinilah terjadi simbiosis mutualisma (kerja sama saling menguntungkan) antara stasiun televisi dan rumah produksi. Tujuan kerja sama ini semata- mata hanya urusan untung, bis- nis, dan uang. Sama sekali bukan masalahedukasiataulainnya. Maka wajar jika banyak sinetron yang secara muatannya sebenarnya sangat tidak bermutu tapi mendapat tempat yang baik di stasiun televisi. Bagi stasiun televisi, mutu tidak penting. Yang penting, duit mengalir melalui iklan. Dan itu sangat mungkin dilakukan dengan merekayasa rating. Sangat berat membuat sinetron yang bermutu di tengah tuntutan tayangan yang bersifat harian.Yangpalingmudahadalah memproduksi sinetron konyol dan bodor tapi menghibur. Inilah yangterjadisaatini. Bagi rumah produksi, ta- yangan sinetron ini merupakan ladang mencari penghasilan. De- mikian pula bagi aktor dan aktris, menjadi pekerja sinetron adalah sebuah kebanggaan karena penghasilan yang menggiurkan. Puluhan juta bisa mereka dapat- kandarisatuepisodesinetron. Walhasil, sinetron-sinetron tersebut adalah lahan bisnis ba- nyak kalangan. Satu sama lain saling menopang dan bergan- tung. Pantas jika dunia pertele- visian menjadi lahan basah untuk mengerukpendapatan. Negara tak Berdaya Ditengahserbuantayangan sinetron di televisi, sayangnya perannegarasangatminim,kalau tidak dibilang tidak ada. Peme- rintah seolah berlepas tangan terhadap dampak penayangan sinetron tersebut bagi masyara- kat. Menteri Komunikasi dan Informasi Tifatul Sembiring, me- ngaku dirinya tak punya kewe- nangan untuk menghentikan tayangan di televisi, kendati ia sendiri sangat tahu, banyak sine- tron dan tayangan televisi yang merusakakidahkaumMuslim. Ini gara-gara ada UU No 32 tahun 2002 tentang Penyiaran, yang mengubah kewenangan mengontrol konten siaran televisi dan radio itu ke Komisi Penyiaran Indonesia (KPI). KPI ini dipilih oleh wakil rakyat, sebagai kepanjang- an tangan rakyat dalam mengon- trol televisi. Pemerintah merasa tak perlu cawe-cawe (ikut cam- pur)karenasudahadaKPI. Sementara itu KPI sendiri merasa kewenangan yang ada padanya juga dikebiri. KPI tidak bisa mencabut izin siaran stasiun televisi yang melanggar aturan. Soalnya, keberadaan izin itu jus- truadadipemerintah. Walhasil, KPI paling-paling hanya menyampaikan teguran dari mulai teguran satu, dua, dan tiga. Setelah itu memang ada pencabutan izin, tapi prosesnya membutuhkan waktu yang sa- ngat panjang dan harus melibat- kanpemerintah. Nah kalau sudah begini, siapa sebenarnya yang mengon- trol dan mengendalikan program pertelevisian di Indonesia? Masak rakyat setiap saat harus bertindak sendiri? Inilah negara liberal, di mana peran negara dikurangi, bahkan hilang sama sekali dalam halini. Pandangan Islam Islam memiliki seperangkat kebijakan yang jelas tentang per- televisian ini. Ada departemen yang menangani masalah ini yak- nidepartemenpenerangan. Kebijakan pertelevisian di- rancang untuk mewujudkan tiga hal; (1) membangun masyarakat Islam yang kokoh dan kuat, (2) melenyapkan unsur-unsur yang bisa menghancurkan sendi-sendi masyarakat Islam, serta (3) me- nonjolkan kebaikan dan keluhur- anIslam. Itukebijakankedalam. Sementara kebijakan ke luar negeri, ditujukan untuk mene- rangkan Islam, baik dalam keada- an damai maupun perang, de- ngan penerangan yang menam- pakkan keagungan dan keadilan Islam; kekuatan Daulah Islamiyah, baik militer, ekonomi, serta per- adabannya; serta menerangkan kerusakan sistem selain Islam, kedzaliman dan kerusakannya, serta kelemahan negara-negara kafir, baik militer, ekonomi, dan peradabannya. Maka program siaran tele- visi, dilarang menayangkan hal- hal yang diharamkan oleh Islam. Demikian pula program-program siaran yang mengandung unsur- unsuryangbertentangandengan akidah dan syariah, dibekukan dan dilarang seketika, tanpa menunggu-nunggu waktu lagi. Larangan ini pun ditujukan kepada program-program yang menjajakan pemikiran-pemikiran kufur, seperti demokrasi, libe- ralisme, pluralisme, nasionalisme, danlainsebagainya. Apakah kita tidak ingin semuaituterwujud?[]mujiyanto Media Umat | Edisi 104, 22 Jumadil Akhir - 6 Rajab 1434 H/ 3 - 16 Mei 2013 Sinetron Berbahaya,Sinetron Berbahaya, Negara tak BerdayaNegara tak Berdaya Sinetron Berbahaya, Negara tak Berdaya
  5. 5. Stop Sinetron Tak Layak Tonton Sinetron yang tak layak tonton bertebaran di berbagai stasiun televisi, selain tidak mendidik sinetron-sinetron tersebut berpotensi untuk merusak akidah dan akhlak penontonnya terutama remaja dan anak-anak. J amal, Halimah dan Mak- mur mendadak 'tobat'. Ketiga tokoh antagonis (penentang/jahat) dalam sinetron Ustad Fotocopy (SCTV) tersebutselalunaikpitam, bila warga Kelurahan Manis Asem tidak memanggilnya dengan julukanyangberbauIslam. Jamal misalnya, sumpah serapah akan meluncur bertubi- tubi dari mulut tokoh yang di- perankan Qubil AJ tersebut, bila warga tidak memanggilnya de- ngan sebutan Haji Jamal, HajiTiga Kali. Dalam sekali tayang bisa lebih dari lima adegan ia men- campur asma Allah dengan caci maki yang menghina orang yang lupa menyebutnya Haji Tiga Kali. Namun kini ia malah menolak dipanggil haji. “Panggil Cang Jamalaje,”ujarnya. Begitu juga dengan Hali- mah (Ranti Purnamasari).“Panggil aje gue Mpok Halimeh,” ujar pe- rempuan kerap kali marah dan menghina lawan mainnya bila tidak dipanggil dengan sebutan UstadzahHajaaah... Haaalimaah. Sedangkan Makmur (Julian Kunto) yang selalu mengaku sebagai “Ustadz yang dimuliakan Allah” dan meminta warga yang berpapasan di jalan agar men- ciumtangannya.Kinitidaklagi. Entah sudah diskenariokan sejak awal atau tidak, tetapi yang jelas episode 'tobat' tersebut tayang beberapa hari setelah warga yang diwakili Masyarakat TV Sehat Indonesia pada Senin (15/4) memprotes sinetron yang dianggap melecehkan simbol- simbol Islam itu ke Komisi Pe- nyiaranIndonesia(KPI). Bukan kali ini saja SCTV menayangkan sinetron yang me- lecehkan simbol Islam. Sebelum- nya, televisi tersebut, menayang- kan sinetron Islam KTP yang men- jadikan Madit (Qubil AJ) sebagai tokoh antagonis yang kerap ma- rah dan bersumpah serapah de- ngannamaAllah. Hingga akhirnya, KPI pun memberikan sanksi penundaan tayang Islam KTP.Tidak kehabisan akal, SCTV pun meluncurkan Ustad Fotocopy. Setelah Ustad Fotocopy tayang lebih dari dua ratus kali, namun KPI tidak juga menegur, maka salah satu stasiun televisi yang kerap menggelar konser musik ini menayangkan sinetron yang juga melecehkan simbolIslamyakniHajiMedit. Tokoh antagonis yang sa- ngat pelit ini diperankan pula oleh Qubil AJ. Namun baru saja beberapa kali tayang, langsung diproteswargadanHajiMeditpun olehKPI'di-IslamKTP-kan'. B er barengan dengan mengadukan kedua sinetron yang diperankan Qubil AJ terse- but, Masyarakat TV Sehat juga mengadukan sinetron Tukang Bubur Naik Haji (RCTI), Berkah (RCTI)danOesman77(TransTV). Koordinator Masyarakat TV Sehat Ardy Purnawan Sani me- nyatakan,sinetron-sinetronterse- but banyak menggunakan judul terminologi Islam, akan tetapi pesanyangdisampaikannyatidak mencerminkan nilai-nilai Islam. Selain itu, tayangannya juga di- nilai meresahkan masyarakat karena mendiskreditkan dan mendistorsiajaranIslam. Merusak Akidah Menurut Menteri Komuni- kasi dan Informatika Tifatul Sem- biring, keberatan masyarakat bukan pada sinetron di atas saja. “Banyak sinetron lain yang meru- sak bahkan mengganggu akidah. Model-model sihir begitu, mayat terbang, alam ghaib, itu semua menggangguitu!”tegasnyakepa- daMediaUmat. Sinetron dimaksud di anta- ranya Kian Santang (MNC TV) yang kerap menampilkan sihir serta siluman maung bodas, silu- man munding bodas dan tokoh- tokoh siluman lainnya, Oh Ter- nyata (Trans TV) menampilkan berbagaimacambentukhantu. Di RCTI ada Magic. Sinetron ini mengisahkan tiga anak SMA yang memiliki kemampuan sihir, seperti menggerakan benda- benda tanpa sentuhan fisik, me- reka pun mampu memindahkan bendadengantatapanmata. Sedangkan di Indosiar ada Tebe dan Kakak Cantik. Bila dulu di RCTI ada sinetron Jinny oh Jinny yang mengisahkan persahabatan antara jin cantik yang keluar dari lampu ajaib dengan seorang re- maja laki-laki, sekarang di Indo- siar mengisahkan jin cantik yang keluar dari cincin ajaib yang ber- sahabat dengan Tebe (Tubagus Indra) seorang anak kecil yang rajinbershalawat.Jin ini kerapkali membantu Tebe baik diminta ataupuntidak. Sebuah serial yang diper- untukkan bagi penonton anak- anak ini jelas berbahaya bagi per- kembangan pemahaman anak terhadap haramnya manusia ber- interaksi dengan jin apalagi me- mintatolongdenganjin. Oleh karena itu, Menteri Tifatul yang merasa tidak berwe- nang untuk menghentikan se- mua tayangan itu meminta agar NU, Muhammadiyah dan MUI mendesak KPI dan stasiun televisi menghentikan tayangan yang merusak akidah itu. “Jangan diam saja dong. Inikan sudah merusak akidah!”tegasnya. Merusak Akhlak Di negeri yang mayoritas penduduknya Muslim ini, ta- yangan televisi yang seharusnya mendidik masyarakat agar ber- akhlak mulia, malah dirusak de- ngan berbagai sinetron yang terkesan mengajari pergaulan bebas kepada penontonnya ter- utama pada ababil alias anak baru gede(remaja)yangmasihlabil. SCTV misalnya, selain setiap hari menayangkan beberapa sinetron lepas (FTV) yang tema sentralnya adalah pe-de-ka-te dan pacaran tersebut, menayangkan pula sinetron yang juga meng- inspirasi para ABG labil untuk menirunya. Sebut saja Love in Paris. Sinetron yang merupakan siaran ulang tahun lalu ini memang ingin menceritakan dua tokoh yang memiliki penyakit parah namun bisa bertahan hidup lan- taran masih adanya harapan dan cinta. Namun sayang, rambu- rambu pergaulan dalam Islam dilanggar semua, adegan khal- wat, berpelukan, berciuman dan mempertontonkan aurat hingga sampai ke paha kerap kali dita- yangkan. Filminijelassangatmerusak akhlak dan tidak mendidik lan- taran semua tokoh dalam sine- tron tersebut ceritanya beragama Islam. Namun tidak ada satu adegan pun yang menyatakan bahwaberduaan,berpelukandan sekamar dengan pacar adalah haram. Sedangkan di Indosiar ada sinetron Bukan Mawar tetapi Melati. Selain masalah percintaan, sinetron ini juga menonjol dalam aksitipumuslihat,ambisius,intrik, provokasi untuk menguasai harta yangbukanhaknya. Di RCTI ada Yang Muda Yang Bercinta. Meski sinetron ini ber- latar belakang sekolah SMA dan tokoh utamanya berseragam pu- tih abu-abu. Namun yangdibahas bukanlah bagaimana suka duka dalam belajar atau bersaing da- lam meraih nilai ujian terbesar. Tapi... sesuai dengan judulnya, sinetron ini malah menceritakan suka duga dan perjuangan anak SMAagardapatpacaran. Pengamat Sosial Iwan Janu- ar mengatakan sinetron-sinetron yangbertemakanpacaranituber- bahaya bagi penonton terutama yang ababil alias ABG labil. “Ya mereka akan langsung copy paste apa yang muncul di televisi dalam kehidupan sehari-hari, termasuk dalam hal pacaran. Akhirnya ada kesan kalau remaja gak pacaran ya bukan remaja namanya,”tegas- nya.[]jokoprasetyo Media Umat | Edisi 104, 22 Jumadil Akhir - 6 Rajab 1434 H/ 3 - 16 Mei 2013 S inetron anak dan remaja di TV banyak adegan ciuman. Begitu juga film kartun, banyak mengekspos pornografi. Contoh saja, kartun Popeye dan belum lagi lainnya yang lebih parah. Sebetulnya anak belum bisa membedakan bahaya atau tidak. Jadi, belum bisa mengambil keputusan begitu, juga dia belum bisa membuat perencanaan ke depan akan jadi apa. Dia juga belum bisa mengontrol emosinya. Karena di usia itu, dengan pendidikan dan pelatihan yang baik baru berkembangdiatasusia15tahun. Anak yang kena pornografi, perasaannya akan kacau balau. Orangtua pun nggak mengerti jika anaknya tiba-tiba suka marah-marah dan uring-uringan. Setidaknya prosesnya begitu. Ada hormon-hormon kenikmatan yang keluar dan berbagai hormon lainnya berlebihan mengeluarkannya, karena si anak harus berkonsentrasi merasakan kenikmatan yang dirasakannya. Maka, dengan sendirinya otak anak akan menciut. Kalau sudah begitu, apa lagi yang bisa diharapkan anak dari masa depannya. Sifat kemanusiaanya rusak dan bisa-bisa perilakunya berubah jadisepertibinatang. Ada empat langkah yang bisa dilakukan untuk menormalkan otak anak. Pertama, anak itu sadar jika dia kena adiksi (kecanduan). Kedua, dia mau keluar dari kecanduan itu dan harus ada dukungan keluarga. Ketiga, harus ada terapi. Keempat, harus hadirkan Allah di dalam dirinya. Sebab, baik anak maupun orang dewasa yang kecanduan pornografi otomatis telah melanggar perintah Allah. Allah mengatakan tahan pandanganmu dan jaga kemaluanmu. Tetapi, justru dilanggar dan tidak mau menahan pandangan. Islam harus diambil seluruhnya, tidak boleh setengah-setengah. Jadi, bila melakukan zina mata dalam keadaan yang luar biasa, maka Allah akan melebihkan hormon-hormon di otak sehingga dia banjir dan over produksi dari hormon tersebut. Dan, itu mudah sekalibagiAllah.[]hidayatullah.com/joy Elly Risman Musa, Psikolog Spesialis Parenting Dampak Sinetron Berbau Porno pada Anak
  6. 6. Media Utama6 H ampir tidak ada t e l e v i s i u m u m —bukan televisi berita— yang tidak menayangkan si- netron. Jika tidak sinetron baru, biasanya mereka menayangkan ulang sinetron lama yang pernah sukses. Dan, tayangan sinetron ini bagi sebagian stasiun televisi menjadi acara unggulan sehing- ga penayangannnya mengguna- kan jam tayang utama (prime time). Pertanyaannya, sebegitu pentingkah sinetron bagi stasiun televisi tersebut? Ternyata, sine- tron ini menghasilkan keuntung- an yang luar biasa bagi konglo- merat pemilik televisi. Hanya dalamhitunganmenit,merekabi- sa mengeruk uang ratusan juga rupiah. Bahkan saking nikmatnya mengeruk keuntungan dari sine- tron, ada stasiun televisi yang hampir sepanjang hari mena- yangkanprogramsinetron. Stasiun televisi ini pun tak harus repot-repot memproduksi program tersebut. Banyak rumah produksi (production house) yang siap menjual produk sinetronnya. Stasiun televisi tinggal membeli dan menayangkannya. Jadi tidak banyak kru televisi yang terlibat. Tinggalsetelsaja. Harga satu episode sinetron berbeda-beda. Ini sangat tergan- tung pada sejauh mana sinetron itu memikat pemirsa televisi atau tidak. Ukurannya adalah rating. Jika ratingnya rendah, meski mutu tayangan sinetron itu seba- gus apapun, harganya rendah. Pihak stasiun televisi tidak me- mentingkan mutu, tapi lebih kepadarating. Satu episode sinetron yang ratingnya tinggi, harga per episo- denya bisa mencapai Rp 300 juta bahkan lebih. Tapi tahukah Anda, berapa keuntungan yang dikeruk daritayanganitu?Berlipat-lipat. Jika sinetron itu ditayang- kan di prime time, maka harga iklan per 30 detik bisa mencapai Rp 20-Rp 60 juta. Padahal slot iklan dalam satu episode bisa sampai 20 menit. Maka dari iklan, stasiun televisi minimal menda- patkan Rp 20 juta x 20 menit x 2, yakni sebesar Rp 800 juta. Ke- untungan kotor mencapai Rp 500 juta. Coba jika harga iklannya Rp 50 juta/30 detik, maka Rp 1 milyar lebihadaditangan. Inilah mengapa stasiun tele- visi tak terlalu peduli dengan isi sinetron yang ditayangkan. Sela- ma masyarakat masih memfavo- ritkan channel sinetron, selama itu pula stasiun televisi terus memproduksi tayangan tersebut. Kapitalistelevisitinggalongkang- ongkang menunggu duit datang lewatiklan. Selain pihak stasiun televisi, keuntungan yang besar dinikmati oleh para kapitalis produsen sine- tron dan pekerjanya termasuk para artis. Para produser sinetron ini tidak banyak. Tapi mereka ini menguasaipasarsinetrondiIndo- nesia. Dengan kekuatan modal- nya, mereka inilah yang menam- pung para pekerja seni untuk ber- kreasi membuat produk sinetron yang bisa memikat pemirsa te- levisi.Tentu bukan tayangan yang berbobot, tapi tayangan yang memikat. Dan bukan tidak mung- kin,dibalikituadaniatburukpara produsen ini terhadap sinetron yangdiproduksinya. Soalnya sudah beberapa kali, sinetron yang tayang di televisi terkena semprit Komisi Penyiaran Indonesia (KPI) karena melanggar ketentuan dan mele- cehkan simbol-simbol Islam. Ti- dak bisa dipastikan ini disengaja atau tidak. Tapi melihat latar belakang para pemilik televisi penayang sinetron (MNC Grup, SCTV, Indosiar), yang bukan Mus- lim, bukan tidak mungkin, ada maksud di balik tayangan sine- tron yang melecehkan simbol- simbolIslamitu. Parahnya lagi, para pekerja seni ini juga mau saja 'berkarya' sesuai kemauan rumah produksi. Aktor dan aktris seolah tak memi- liki pikiran sama sekali terhadap peran yang dimainkannya. Bisa jadi ini karena pikirannya sudah tertutupidenganuang. Tahukah Anda, dalam satu episode sinetron unggulan, ak- tor/aktris pemeran utama gajinya bisa mencapai puluhan juta? Wow, bagaimana tidak nurut de- ngan kemauan produsen dan sutradara tanpa basa basi karena takut kontraknya diputus di te- ngahjalan. Kolaborasi para pengejar uang inilah yang menjadikan sinetron tak lagi memiliki misi edukasi kepada masyarakat pe- mirsa televisi. Sebaliknya, isinya justrumerusak. “Saya tidak tahu apakah para produser tayangan-ta- yangan yang merusak itu berniat untukmerusakakidah,akhlakdan gaya hidup penontonnya. Tetapi memproduksi itu semua untuk kepentingan komersial iya. Yang pentingkan duit masuk. Jadi di sini dia mengabaikan nilai-nilai edukatif, yang penting ada iklan, duit masuk. Jadi lebih mengejar ke komersialisasi,”kata Satrio Aris- munandar, dosen Newsmaking CriminologyFISIPUI. Ia menekankan, lepas apa- kah para produsen sinetron dan pekerjanya berniat mau merusak atau tidak merusak, dampaknya sama saja, merusak. “Kalau niat kan yang tahu hanya dia sama Tuhan, kita tidak tahu. Tetapi fak- tanya memang merusak,” tandas- nya. Ketua MUI KH Cholil Ridwan menilai, mereka yang secara sengaja mengolok-olok Islam dan simbol-simbolnya sebagai orang- orang munafik. “Itu tergolong golongan munafikin itu, baik sutradara, produser, pemain, itu kalau memang sengaja Islam di- jual sebagai komoditas,” katanya kepadaMediaUmat.[]mujiyanto A dzan menjadi tayangan 'wajib' bagi stasiun televisi, kendati tidak ada yang mewajibkannya. Hambar rasanya kalau sampai ada stasiun televisi yang tidak menayangkan adzan di tengah pemirsanya yang mayoritasMuslim. Tapi, hati-hati, kendati menayangkan adzan, stasiun televisi tetap bisa memasukkan pesannya melalui tayangan yang sebenarnya bagian dari ibadahini.Adayangcukupbagus,tapiadajugayangperludikritisi. Sebuah tayangan adzan di sebuah televisi swasta berita, dalam beberapa saat menayangkan kumandang adzan dengan latar belakang iklan komersial. Parahnya lagi, di dalamnya ada iklan leasing baik itu berupa rumah maupun kendaraan roda empat. Padahal, jelas leasing ini adalah muamalahyangtidaksesuaidengansyariat. Ada juga adzan yang menggambarkan bagaimana kehidupan kaum hedonis di kota besar. Mereka mengumbar auratnya, tapi begitu adzan tiba mereka mencari mushala untuk mereka shalat. Mereka laki dan perempuan. Usai shalat, mereka kembali membuka auratnya dan meneruskan aktivitasnya. Selain itu ada pula adzan yang berlatar belakang muda-mudi. Stasiun televisi ini tampaknya ingin menggugah kepedulian lewat tayangan itu. Memang itu baik, tapi menggambarkan sosok-sosok di dalamnya sebagai sosok Islam moderat. Mereka naik motor berboncengan laki perempuan, tanpamenutup auratlagi.Khasgaulanakgedongan. Nah tayangan background adzan ini bisa saja diikuti oleh pemirsanya. Tayangan itu seolah menjadi pembenar bagaimana sikap seorang Muslim: perempuan boleh membuka aurat, dan sikap sekuler lainnya. Waspadalah![] emje Media Umat | Edisi 104, 22 Jumadil Akhir - 6 Rajab 1434 H/ 3 - 16 Mei 2013 Tayangan Adzan pun Bisa Mengandung Racun Kapitalis dan Artis,Kapitalis dan Artis, Penikmat Sinetron LarisPenikmat Sinetron Laris Kapitalis dan Artis, Penikmat Sinetron Laris Bahkan saking nikmatnya mengeruk keuntungan dari sinetron, ada stasiun televisi yang hampir sepanjang hari menayangkan program sinetron.
  7. 7. 7 M araknya sine- tron dan ta- yangan televisi lainnya yang m e l e c e h k a n simbol-simbol Islam tak otomatis menggerakkan negara untuk berbuat. Aksi-aksi masyarakat yang memprotes beberapa jenis tayangan, seolah tak dipedulikan. Padahal, banyak di antara para pejabat negara adalah Muslim, bahkan sebagian dari mereka berasaldaripartaiIslam. Menteri Komunikasi dan Informasi Tifatul Sembiring, mengaku dirinya tak punya kewenangan untuk menghen- tikan tayangan di televisi, kendati ia sendiri sangat tahu, banyak sinetron dan tayangan televisi yang merusak akidah kaum Muslim. Menurutnya, UU No 32 tahun 2002 tentang Penyiaran, mengubah kewenangan me- ngontrol konten siaran televisi dan radio itu ke Komisi Penyiaran Indonesia (KPI). “Jadi kewenang- annya, mengontrol, menegur dan memberikan sanksi ada di KPI,” katanya. Tifatul mengingatkan KPI untuk bertanggung jawab. “KPI jugaperludibekaliagarmemberi- kan sanksi itu, jangan hanya tegur-teguran saja. Karena biasa- nyaakandiabaikan,”katanya. Sementara itu KPI sendiri merasa kewenangan yang ada padanya juga dikebiri. Menurut Nina Mutmainnah Armando, Komisioner KPI Bidang Isi Siaran, KPI tidak bisa mencabut izin siaran stasiun televisi yang melanggar aturan. Soalnya, ke- beradaan izin itu justru ada di pemerintah. Walhasil, KPI paling-paling hanya menyampaikan teguran dari mulai teguran satu, dua, dan tiga. Setelah itu memang ada pencabutan izin, tapi prosesnya membutuhkan waktu yang sa- ngat panjang dan harus melibat- kanpemerintah.“Danjanganlupa kewenangan KPI terbatas karena memang terjadi judicial review terhadap undang-undang penyi- aran yang menyebabkan kewe- nangan KPI terbatas tadi,” kata- nya. KPI sendiri, kata Nina, mem- butuhkan masyarakat untuk ber- gerak menolak berbagai tayang- anyangmerusak.“Karenaitukami membutuhkan publik sebenar- nya. Karena KPI itu adalah lemba- gayangmewakilipubliksehingga publik harus bersama-sama KPI memperbaikisiaran,”kataNina. Ia sendiri mengelak disebut diam saja terhadap berbagai pelanggaran yang dilakukan oleh stasiun televisi. Pihaknya meng- aku terus memantau siaran tele- visi 24 jam.“Tanpa tekanan publik punsanksiadministrasikamiakan jatuh bila tayangan memang me- langgar P3 SPN itu. Jadi kami in- dependen dalam hal ini,” tutur- nya. Di tengah karut marut pengawasan siaran televisi seper- ti ini Menkominfo memintarakyat untuk ikut bergerak menolak ta- yangan-tayangan yang merusak akidah itu langsung ke televisi yang menayangkannya. “Masya- rakat tidak ada salahnya juga datang ke SCTV-nya protes. Ja- ngan diam saja dong. Ini kan su- dah merusak akidah. Di Indonesia kan banyak lembaga masyarakat. Kan boleh protes. Kalau diam saja ya tidak berubah nasib kita,” kata Tifatul. Ia pun kemudian menyebut beberapa organisasi besar seperti NU dan Muhammadiyah serta MUI. “Masa kita mau cuek saja? Ayo bergerak, jangan pada diam juga pemimpin umat ini,”katanya seraya mengatakan, “Kalau saya punya kewenangan sudah saya tutupdaridulu.” Sementara itu, juru bicara Muslimah HTI Iffah Ainur Rohmah menyesalkan sikap pemerintah, termasuk di dalamnya KPI. “Se- mestinyanegaratidakmenunggu protes masyarakat. Ada atau tidak ada protes, mestinya tayangan semacamitudilarang,”katanya. Menurutnya, yang bisa menghentikan tayangan seperti ini hanyalah negara melalui lem- baga pengawas yang selalu me- mantau semua produk pemikiran ditengahmasyarakat,jugamemi- liki otoritas untuk mengajukan ke pengadilan, pembinaan, peng- arahan, penyetopan hingga pela- rangan berdiri media jika tidak memenuhi ketentuan syariat. “Karenanya standar yang dipakai oleh lembaga pengawas media dan peradilan harus sama, yakni rambu-rambu syariat Islam,” kata Iffah. Kebijakan Khilafah Khilafah pun memiliki se- perangkat kebijakan dalam per- televisian ini. Anggota Lajnah Tsaqafiyah DPP HTI Syamsuddin Ramadhan menjelaskan, kebijak- an program televisi negara khila- fah. Departemen penerangan adalah departemen yang memi- liki kewenangan untuk mengatur pertelevisian berdasarkan syariat Islam. Di dalam negeri, kebijakan pertelevisian dirancang untuk mewujudkan tiga hal; (1) mem- bangun masyarakat Islam yang kokoh dan kuat, (2) melenyapkan unsur-unsur yang bisa menghan- curkan sendi-sendi masyarakat Islam, serta (3) menonjolkan ke- baikandankeluhuranIslam. Adapun di luar negeri, ditu- jukan untuk menerangkan Islam, baik dalam keadaan damai mau- pun perang, dengan penerangan yang menampakkan keagungan dan keadilan Islam; kekuatan Daulah Islamiyah, baik militer, ekonomi, serta peradabannya; serta menerangkan kerusakan sistem selain Islam, kedzaliman dan kerusakannya, serta kele- mahan negara-negara kafir, baik militer, ekonomi, dan peradaban- nya. Program siaran televisi, me- nurut Syamsuddin, dilarang me- nayangkan hal-hal yang diharam- kan oleh Islam, seperti infotain- men ghibah, pemujaan terhadap materi, penonjolan hal-hal yang berbau seksualitas, tabarruj, serta siaran-siaran yang merendahkan akhlak manusia, dan lain sebagai- nya. Siapa saja yang membuat program-program siaran yang bertentangan dengan syariat dan akhlak Islam, akan dikenai sanksi ta'zir. Program-program siaran yang mengandung unsur-unsur yang bertentangan dengan akidah dan syariah, dibekukan dan dilarang seketika, tanpa menunggu-nunggu waktu lagi. Begitu juga program-program yang menjajakan pemikiran- pemikiran kufur, seperti demo- krasi, liberalisme, pluralism, na- sionalisme, dan lain sebagainya, semuanya dilarang ada dalam program-program siaran televisi. Begitu juga program-program siaran yang ditujukan untuk me- ragukan kesempurnaan Islam, se- muanyadilarangtanpakomentar. Menurutnya, semua prog- ram siaran televisi yang ada di dalam Khilafah Islamiyah, diarah- kan kepada penguatan masyara- kat Islam, penjauhan masyarakat dari unsur-unsur yang bisa meru- sak sendi-sendi masyarakat Islam, serta penonjolan ketinggian Islam di tengah-tengah masya- rakat. Dengan kebijakan seperti itu, siaran televisi akan menjadi kekuatan yang luar biasa untuk mendidik umat dan menyebar- kan dakwah Islam. Tidak seperti sekarang, siaran televisi justru menjadiduribagiumat.[]emje A nda penggemar acara 'Bukan Empat Mata'? Acara yang menampilkan host Tukul Arwanan itu sempat dihentikan penayangannya oleh KPI. Sebelum dihentikan pada 2008, tayangan ini sempat ditegur karena menampilkan adegan Sumanto pemakan manusia (2007). Setahun kemudian ketika di dalamnya adaacaramakankatakhidup-hidup, acarainidihentikan. Tapi bukan stasiun televisi kalau tidak pandai ngeles. Pihak Trans7, mengakali vonis tersebut dengan mengubah nama program tersebut menjadi “Bukan EmpatMata”dantetapmenayangkannya. KPI dibuat tak berkutik. Buktinya KPI tidak bereaksi terhadap tindakan Trans7 tersebut. KPI hanya mengimbau agar acara tidak membicarakan hal-hal yang vulgar,mesum,danberbauseks. Tidak ada yang berubah dari isi acara 'Bukan Empat Mata' ini. Semuanya sama. Walhasil, ya sama saja. Tak heran pasca itu, teguran demi teguran muncul lagi. Pada Tahun 2009, KPI memberikan teguran pertama karena tamu Tukul pada saat itu adalah Kangen Band, tidak sengaja menyebut nama alat kelamin karena latah saat menjatuhkan sesuatu dan pada Bulan Desember 2009, acara ini kembali ditegur karena Tukul mencolek Bella Saphiradengansengaja. Untuk kesekian kalinya, tepatnya pada bulan Juni Tahun 2010, Bukan Empat Mata kembali menerima teguran dari KPI karena Atika (tamu Tukul) membaca Basmalah saat akan minum wine (minuman haram).[] emje Akal Bulus Agar Tetap Mulus Media Umat | Edisi 104, 22 Jumadil Akhir - 6 Rajab 1434 H/ 3 - 16 Mei 2013 Negara tak BerdayaNegara tak BerdayaNegara tak Berdaya Menteri menyatakan ia tak memiliki kewenangan lagi, sementara KPI merasa lembaga itu pun dikebiri. Media Utama
  8. 8. Berbedadenganerasebelumnya,erareformasimemberikankebebasanseluas-luasnya kepadamediapenyiaranuntukmenayangkantayagannya.Sakingbebasnya,banyak tayanganyangmerusakakidahumat.Pemerintahsendiritakdiberikewenanganuntuk menghentikannya.SebagaigantinyaadaKomisiPenyiaranIndonesia(KPI).Tapinyatanya KPIsendiritakbisaberbuatbanyak.Mengapa?WartawanTabloidMediaUmatJokoPrasetyo mewawancaraiKomisionerKPINinaMutmainnahArmando.Berikutpetikannya. Tanggapan KPI terhadap aduan warga yang keberatan dengan sinetron Tukang Bubur Naik Haji (RCTI) dan Ustad Fotocopy (SCTV) karena dianggap melecehkan simbol Islam? Kami sudah menerima aduan masyarakat tentang ini dari kelompok Masyarakat Televisi Sehat Indonesia. Kami mempertemukan antara pihak pengadu dengan pihak stasiun televisinya. Kita undang mereka pada Senin (22/4) kemarin. Kami minta agar stasiun televisinya mendengarkan apa diadukan masyarakat sehingga tahu apa yang diprotes masyarakat apa. Kemudian kami minta stasiun televisi memperbaiki acaranya. Komitmen perbaikan itu kemudian disepakati oleh RCTI dan SCTV. Bahkan SCTV bukan hanya program Ustad Fotocopy yang diprotes, tetapi Haji Medit juga. Nah, Haji Medit sudah dihentikan penayangannya sejak Rabu lalu. Selain ketiga tayangan tersebut, program apa saja yang diprotes masyarakat? Pada 2012, ada empat aduan yang sangat besar. Pertama, kasus Rohis, kami menyebutnya kasus Rohis (Metro TV). Saat itu Metro TV menampilkan talkshow tentang terorisme yang dianggap menyudutkan kelompok Kerohanian Islam Siswa. Pengaduannya itu sampai hampir 30.000. Kedua, pengaduan tentang acara Indonesian Lawyers Club (tvOne). Saat itu hostnya dianggap melecehkan kaum Bonek (Bondo Nekad/suporter Persibaya). Komunitas Bonek marah mengirimkan aduan ke KPI. Ketiga, ada pengaduan publik tentang acara Super Trap (Trans TV). Saat itu Super Trap menampilkan toilet orang yang dipasang kamera tersembunyi di toilet umum. Itu dianggap sangat tidak pantas dan melanggar privasi. Keempat, ada juga pengaduan yang cukup besar tentang salah pasang foto terduga teroris (tvOne). Saat itu tvOne memajang foto Badri yang disebut teroris, padahal fotonya salah. Kalau di tahun ini? Untuk tahun 2013, sampai sekarang banyak yang mengadukan Metro TV yang memelesetkan kepanjangan nama Partai Keadilan Sejahtera terkait dijadikannya Presiden PKS, saat itu, sebagai tersangka penerima suap penambahan kuota impor daging sapi. Yang terakhir, sebelum Ustad Fotocopy, adalah program Khazanah (Trans 7). Tetapi untuk Khazanah pengaduan publiknya beragam. Tidak hanya yang memprotes saja, tetapi justru lebih banyak yang mendukung program tersebut. Mengapa dari tahun ke tahun selalu saja ada televisi mengulangi kesalahan yang sama? Bukan melakukan kesalahan yang sama. Karena pelanggarannya bisa sama bisa tidak. Yang jelas adalah ada hal- hal yang ditampilkan itu mengganggu kenyamanan masyarakat. Dan itu sudah diatur oleh undang-undang. Bahkan bisa jadi yang diprotes masyarakat itu, isinya tidak melanggar ketentuan lho! Kita kan patokannya KPI, Pedoman Prilaku Penyiaran (P3) dan Standar Program Penyiaran (SPN). Sehingga bisa jadi isinya tidak melanggar P3 dan SPN tetapi masyarakat merasa terganggu dengan itu. Masyarakat merasa tidak pantas kalau tayangan seperti itu ditampilkan. Apakah televisi tidak mengetahui patokan konten yang tidak boleh dilanggar? Harusnya mengetahui. Karena itu ada di undang- undang. Setelah ditegur KPI adakah televisi yang membangkang? Ya, ada yang membangkang, sehingga tidak mau menjalankan komitmennya. Tetapi mayoritas mau menjalankan ya. Yang membangkang siapa? Misalnya, Pesbukers (ANTV) tahun lalu kami memberikan sanksi. Baru setelah berganti tahun dia menjalankan sanksi tersebut. Jadi ada memang yang mencoba membangkang. Itu semua dikembalikan ke publik lah. Publik lah yang menilai dan berteriak juga. Karena itu kami membutuhkan publik sebenarnya. Karena KPI itu adalah lembaga yang mewakili publik sehingga publik harus bersama-sama KPI memperbaiki siaran. Jadi kalau publik diam, KPI tidak bisa bertindak? Enggak juga. Sanksinya tetap jalan. Kami memberikan sanksi teguran tidak semata- mata atas tekanan publik. Tanpa tekanan publik pun sanksi administrasi kami akan jatuh bila tayangan memang melanggar P3 SPN itu. Jadi kami independen dalam hal ini. Jadi kami bukannya diam dan tidak ngapa-ngapain, ya enggak lah. Kami melakukan pengawasan, monitoring dan pemantauan ke sebelas televisi yang disiarkan dari Jakarta. Pemantauannya langsung 24 jam. Full. Dan kami punya rekaman-rekamannya. Dan kami juga memfasilitasi pengaduan masyarakat. Dari pemantaun itu, banyak juga ya acara yang merusak akidah, akhlak dan gaya hidup penontonnya? Sebenarnya kalau di aturannya KPI kalau Anda baca, semuanya sudah diatur. Kami tidak menyebutnya akidah ya, karena itu diambil dari sudut pandang agama. Jadi semuanya, sebenarnya sudah dijaga. Sebenarnya kalau televisi mematuhi segala aturan KPI ini beres sudah. Tidak akan ada orang yang merasa akidahnya dirusak. Karena kan dalam aturannya KPI harus dijaga penghormatan terhadap nilai- nilai agama, tidak boleh melecehkan kelompok tertentu, aturan tentang pembatasan dan larangan muatan seks, muatan kekerasan. Itu semua sudah diatur. Jadi semestinya tidak ada lagi hal-hal yang dianggap merusak atau mengganggu kalau saja aturannya itu dipatuhi. Sanksi yang paling berat dari KPI terhadap penyelenggara siaran? Sebenarnya kalau di undang-undang itu sampai pencabutan siaran. Tetapi untuk menjatuhkan sanksi itu butuh proses yang sangat panjang. Dan jangan lupa kewenangan KPI terbatas karena memang terjadi judicial review terhadap undang- undang penyiaran yang menyebabkan kewenangan KPI terbatas tadi. Sejauh ini sanksi yang kami berikan adalah sanksi administratif. Yang umumnya kami berikan adalah teguran. Teguran I, Teguran II, ... kalau belum berubah juga sanksinya ditingkatkan menjadi penghentian tayangan sementara atau pembatasan durasi. Siapa yang melakukan judicial review? Asosiasi televisi swasta APPSI. Mereka ingin membatalkan UU Penyiaran ini, namun tidak dikabulkan. MK memutuskan ada satu pasal yang harus dihapus karena pasal tersebut menyebutkan bahwa PP aturan tentang UU ini dibuat oleh pemerintah. Jadi pemerintah terlibat, terutama soal perizinan. Ditambah lagi, PP-PP itu tidak melibatkan KPI dan banyak yang bertentangan dengan UU. Sehingga ini menyulitkan KPI untuk bertindak. Di Undang-Undang-nya disebutkan KPI bisa mencabut izin siaran. Lha, izinnya kan tidak di tangan KPI tetapi di tangan Kemenkominfo! Sehingga ini melewati proses yang sangat panjang. Mengapa tidak ada sanksi denda? Sanksi denda sebenarnya ada. Dan ini memang sangat efektif. Tetapi sanksi denda bisa dilaksanakan dalam bentuk PP yang dibuat oleh Kemenkominfo. Tetapi sayangnya, sanksi denda hanya bisa dilakukan untuk iklan rokok yang menyalahi aturan dan jumlah iklan yang melebih kuota 20 persen. Jadi sangat terbatas sanksi denda ini.[] UU-nya Menyulitkan KPI untuk Bertindak Nina Mutmainnah Armando, Komisioner KPI Bidang Isi Siaran Media Umat | Edisi 104, 22 Jumadil Akhir - 6 Rajab 1434 H/ 3 - 16 Mei 2013
  9. 9. Berulang-kaliKomisiPenyiaranIndonesia(KPI)menegurdanmemberikan sanksiadministrasikepadatelevisiyangmenyiarkantayanganyangdianggap melecehkansimbolIslam.Namunberulangkalipulatelevisimemproduksisinetron danberbagaitayanganyangmerusakakidah,akhlaksertagayahiduppenontonnya. Mengapainibisaterjadi?Apaakarmasalahdansolusimendasarnya?Temukan jawabannyadalamwawancarawartawanMediaUmatJokoprasetyodengan pengamatsosialIwanJanuaryangjugaanggotaLajnahSiyasiyahDPPHizbutTahrir Indonesia.Berikutpetikannya. Tanggapan Anda tentang teguran KPI kepada stasiun televisi yang menayangkan tokoh antagonis bergelar “Haji”dan“Ustadz”? Memang sudah seharusnya pihak pemerintah dalam hal ini KPI mengawasi dan memberikan teguran bahkan sanksi, bila perlu, kepada tayangan- tayangan yang bermuatan anti- sosial termasuk yang berisi pelecehan ajaran agama, atau menggiring opini publik kepada stigmatisasi ajaran-ajaran agama. Sekarang ini banyak program televisi baik itu sinetron, reality show termasuk iklan yang bermuatan anti sosial. Hanya saja dulu yang dominan adalah konten pornografi tapi kalau sekarang sudah mulai berani 'bermain' membawa- bawa simbol agama. Bila dibiarkan maka akan membuat tayangan-tayangan seperti ini menjamur dan dianggap biasa. Tapi bukankah sinetron tersebut hanya mengungkap realitas yang ada? Ya, sebagian ada benarnya. Kita bisa dengan mudah melihat orang bertitel haji tapi punya sifat hasud pada orang lain, atau ustadz dan ustadzah yang matre misalnya. Namun demikian jangan lupa, sinetron atau tayangan televisi yang mengungkap seperti secara berulang-ulang pada akhirnya bukan lagi mengungkap realita, tapi sudah bisa menggiring atau menciptakan opini negatif. Kan seharusnya tayangan itu memberikan edukasi bahwa haji yang hasad itu salah, ustadz yang matre itu nggak benar, lalu diberikan penjelasannya. Bukannya justru 'dipelihara', dijadikan ikon dan dibiarkan terus berulang-ulang. Selain itu, adakah sinetron lain yang Anda nilai merusak akhlak, tauhid, pergaulan, gaya hidup dan anti sosial lainnya? Wah banyak sekali, mulai dari iklan sampai sinetron atau film-film lepas. Iklan banyak yang mengeksploitasi wanita atau ikhtilat pria-wanita. Sinetron- sinetron kita banyak yang terlalu mendramatisir tokoh antagonis, jadi kalau tokoh jahat benar- benar dibuat aktingnya jahat bener. Mengumbar kebencian dan permusuhan. Ini kan sudah menyebarkan watak anti-sosial kepada publik. Sinetron kita juga banyak yang mengumbar mimpi, mengumbar kemewahan. Rumah dan kendaraan mewah hal yang sepertinya 'wajib' dipajang dalam sinetron- sinetron Indonesia. Nilai-nilai pergaulan bebas juga begitu kental dalam dunia sinetron tanah air. Meski tidak sampai ada adegan persetubuhan, tapi aktifitas seperti pacaran dan perselingkuhan jadi tema yang biasa. Bahayanya bagi penonton? Bahaya bagi penonton terutama yang ababil alias ABG labil ya mereka akan langsung copy paste apa yang muncul di televisi dalam kehidupan sehari- hari, termasuk dalam hal pacaran. Akhirnya ada kesan kalau remaja gak pacaran ya bukan remaja namanya. Melahirkan ikonisasi tokoh Muslim yang jahat dan matre. Seperti haji yang kerjanya menghasut melulu, atau ustadz yang centil dan matre. Sehingga menimbulkan ketidakpercayaan publik kepada ajaran Islam atau orang yang sedang menjalankan ajaran Islam. Orang awam akan mencibir 'haji' atau mencibir 'ustadz', karena biasanya publik sering melakukan generalisasi. Tayangan-tayangan yang mengandung khurafat dan takhayul juga sudah pasti merusak akidah. Karena tidak ada tuntunannya seorang Muslim harus memburu hantu. Mengapa? Kita hidup di alam yang berbeda, dan masing-masing ada taklif amal yang harus dijalankan. Mengurus manusia saja sudah susah ngapain juga mengurus makhluk halus. Lagipula kewajiban dakwah kita adalah memperbaiki kehidupan umat manusia, bukan bangsa jin. Apakah tayangan-tayangan tersebut memang sekadar dibuat untuk menghibur atau memang benar-benar dibuat untuk merusak pemahaman dan gaya hidup penonton? Ya ini bisa saling berkelindan, saling menumpangi. Ada produser atau sutradara yang awalnya membuat sinetron sekadar memenuhi permintaan pasar atau produser atau pihak televisi. Bangsa kita kan biasa copy paste, apa yang laku biasanya langsung ditiru. Hanya saja mungkin insan perfilman itu tidak menyadari kalau sinetron yang mereka buat itu sudah terkategori melecehkan ajaran- ajaran agama, stigmatisasi. Di sisi lain sangat mungkin ada pihak yang punya kepentingan untuk melakukan tindakan stigmatisasi. Siapa di balik ini semua? Para pengusung sekulerisme dan liberalisme. Mereka ingin khalayak berada dalam kondisi tidak percaya kepada syariat Islam. Digerogoti dulu dari persoalan akidah dan ibadah, dibuat ikonisasi tokoh- tokoh agama buruk akhlak seperti itu. Mengapa sinetron yang merusak itu bisa marak? Ada dua keping di sini. Pertama, bisnis perfilman yang memang menguntungkan bagi para pemilik modal, pemilik stasiun televisi dan insan perfilman. Dan mereka secara umum belum punya pemahaman yang benar serta kuat tentang ajaran Islam. Malah dunia televisi swasta yang besar kan dikuasai non Muslim. Bagi mereka sinetron- sinetron seperti ini seperti kata pepatah; sekali merengkuh dayung, dua tiga pulau terlampui. Uang dapat, perusakan terhadap umat Islam juga berhasil. Kedua, selama ini memang perhatian pemerintah terhadap pembinaan akidah dan akhlak umat minim. Film-film cabul, horor yang penuh takhayul bahkan yang bermuatan lesbian, gay, biseksual dan transeksual juga sudah beberapa kali tayang di layar bioskop. Mengapa pemerintah begitu? Negara ini kan pondasinya sekulerisme; persoalan akidah dan akhlak ya diserahkan kepada diri masing-masing. Mau jadi apa terserah kepada individu yang bersangkutan. Yang penting jangan mengganggu hak orang lain dan meresahkan umum. Negara sekuler tidak akan ikut campur dalam persoalan ini. Karenanya paham sekulerisme itu memang jahat dan merusak umat Islam. Apa yang harus dilakukan negara untuk menjaga umat dari sinetron atau pun konten media massa yang merusak lainnya? Harus ada standar hukum yang benar dan ajeg, tidak multitafsir. Sekarang batasan pornografi dan pornoaksi adalah pasal karet, bisa ditarik-ulur sesuka orang. Makanya sampai kapan pun bila kondisinya seperti sekarang tidak akan bisa mencegah maraknya tayangan atau konten media massa yang merusak. Seharusnya ada rambu- rambu tentang dunia seni dan budaya, sehingga dari awal insan seni sudah tahu mana yang boleh dan yang tidak. berikutnya ada lembaga sensor yang memang disiplin dan tidak kompromi dalam persoalan agama. Berikutnya harus ada sanksi tegas bagi mereka yang melanggar aturan ini. Menghambat seni dan kreativitas dong? Tidak. Dengan adanya aturan ini justru orang akan terpacu untuk menghasilkan karya seni yang bermoral dan bermutu. Bukankah dalam kehidupan sekulerisme dan liberalisme seperti sekarang, orang malah berlomba-lomba membuat karya seni dan budaya yang murahan. Film horor atau komedi kalau tidak ada paha dan dada perempuan seperti kurang lengkap. Itu norak! Nah, perlindungan umat dari konten media massa yang merusak hanya bisa efektif dan efisien bila negara berpondasikan Islam dengan sistem pemerintahan khilafah- nya. Mengapa harus khilafah, tidak cukupkah kita mencegah anak untuk menonton televisi? Memang, secara pribadi dan keluarga setiap Muslim sebenarnya bisa melindungi akidah dan akhlak dari tayangan- tayangan negatif televisi, tapi hanya sampai batas-batas tertentu. Hanya saja apa yang bisa dilakukan oleh keluarga dan komunitas ruang lingkupnya amat terbatas? Keluarga Muslim hanya bisa menyampaikan petisi dan melindungi secara lokal. Lantas, siapa yang bisa mencegah ditayangkannya karya seni yang tidak bermoral dan tidak bermutu? Pertanyaannya apakah sistem budaya dan hukum sekarang bisa melakukan itu semua? Ternyata tidak, malah semakin menjadi-jadi.[] Media Umat | Edisi 104, 22 Jumadil Akhir - 6 Rajab 1434 H/ 3 - 16 Mei 2013 Iwan Januar, anggota Lajnah Siyasiyah DPP HTI Mereka Ingin Umat Tak Percaya Syariat
  10. 10. 10 Aspirasi Media Umat | Edisi 104, 22 Jumadil Akhir - 6 Rajab 1434 H/ 3 - 16 Mei 2013 Mereka BicaraMereka BicaraMereka Bicara Tayangan yang MerusakTayangan yang MerusakTayangan yang Merusak TifatulSembiring, Menkominfo Bukan Kewenangan Menkominfo Keberatan masyarakat itu bukan hanyapadaTukangBuburNaikHaji(RCTI)dan UstadzFotokopy(SCTV)saja.Banyaksinetron lain yang merusak bahkan mengganggu akidah. Model-model sihir begitu, mayat terbang, alam ghaib, itu semua mengganggu itu. Dalam hal ini menurut UU No 32 tahun 2002 tentang Penyiaran, kewenangan mengontrol konten siaran televisi dan radio itu ada di KPI. Jadi kewenangannya,mengontrol,menegurdanmemberikansanksiadadi KPI. Jadi jangan membayangkan Kemenkominfo seperti zaman Departemen Penerangan dulu. Sejak Departemen Penerangan diubah menjadiKemenkominfodicabutlahkewenangantersebut. Jadi kita ini ditugaskan untuk membangun infrastruktur teknologi, informasi dan komunikasi. Kalau dalam penyiaran hanya TVRIdanRII,jaringantelekomunikasidaninternet.JadidiluaritukeKPI. Begitulah di dalam undang-undangnya, kalau kewenangan orangkitaambil,disalahkanlagi.Pascareformasibegitudiaturnya. Hal-hal seperti ini akan kami ingatkan lagi kepada KPI, semestinyadiabertanggungjawab.JanganberlepastanganjugaKPIdi situ. KPI juga perlu dibekali agar memberikan sanksi itu jangan hanya tegur-teguransaja.Karenabiasanyaakandiabaikan. Ke depan ini perlu aturan yang lebih tegas sehingga KPI bisa memberikansanksibahkanbilaperludendasecaramateri.[] EffendiGazali, PakarKomunikasiPolitik Kepentingan Rating dan Sharing Media kita itu banyak dipengaruhi kepentingan bisnis, jadi sangat tergantung padaratingdansharingdanbagianlainyang dipengaruhipolitik.Kitamelihatketikaorangpunyakanal,merekabisa mengiklankan dirinya berkali-kali dalam bentuk iklan politik dan lain sebagainya. Soal rating dan sharing ini, saya melihat sangat serius. Bagaimana bangsa kita harus mengakui akhirnya, misalkan kita harus terlibatdenganpembahasanyanglamasepertiEyangSubur,initerlalu lamadanbertele-tele.Untuktidakterpengaruhhaldemikiankitaharus punya lembaga rating yang mengaudit tayangan pertelevisian tersebut. Macam-macam kanal di Indonesia umumnya kalau mereka tidakdi-driveolehekonomikdenganratingdansharingsemata,laluada hiburan, lalu ada unsur politiknya kita tahu siapa yang punya kanal- kanaltelevisitersebut.[] KHCholilRidwan, KetuaMUIPusat IniPelecehanterhadapIslam Menurut saya dan tidak hanya MUI bahkan seluruh ulama juga tidak menginginkan Islam dijadikan komoditas, bahan olok-olok supaya rating naik. Itu kan merupakanpelecehansebetulnyaterhadapIslam. Haji itu gelar kehormatan untuk seseorang yang naik haji, tapi sinetronTukangBuburNaikHaji,UstadzFotocopydanHajiMeditituyang sifatnya merendahkan harkat martabat haji, itu sudah melakukan penistaanterhadapagama. AgamaIslamsudahjadimain-mainan,kalausengajamengolok- olok Islam dihukumnya bisa dianggap keluar dari Islam loh, tergolong golonganmunafikin,adaterdapatdalamsurah al-Baqarahayat13-14. Mereka membuat sinetron hanya memperolok-olok Islam saja. Itutergolonggolonganmunafikinitu,baiksutradara,produser,pemain, itukalaumemangsengajaIslamdijualsebagaikomoditas. Hal ini selalu berulang, padahal perkara ini sudah lama tayangan-tayangan seperti ini, ditegur sama KPI muncul lagi dengan beda cerita jadi memang suatu kebijakan yang mengatur itu dan kita tidakpunya,untukmenindaktegassiaranitu.[] AsrorunNi'amSholeh, Wakil Ketua Komisi Perlindungan Anak Indonesia MudahDitiruolehAnak Pengaruh tayangan pada anak, yang terlihat dari banyak penelitian menunjukkan korelasi tayangan kekerasan di televisi dengan perilaku kekerasan yang dilakukan oleh anak-anak. Baik anak menjadi pelaku tidak kekerasan ataukah menjadi korban tindak kekerasan. Temuan itu sudah sangat banyak, ada beberapa tayangan yang kemudian dihentikan salah satunya smack down yang menujukkan pada kita bertapa hubungan kausalitas atara kekerasan pada anak itu menjelmamenjadiaktifitasyangberbahayapadaanak. Kemudian,darisisiteori,apayangdisaksikananakituakanjauh lebih banyak dari apa yang dituturkan. Ini yang dikenal dalam teori akademik sebagai teori peniruan (imitasi). Karena akan lebih mudah mengambildariapayangdilihat. Sekalipun, visualisasi kekerasan itu mengirimkan pesan jangan meniru adegan itu, tetapi anak dalam konteks teori itu tidak bisa menghindari dari tampilan tidak kekerasan untuk tidak diikuti, karena semakinpenasarandenganvisualisasisepertiitu. Ditambah lagi, tayangan yang secara frekuensi milik publik harusnyatayangandanpenyiaranyangmemanfaatkanfrekuensipublik itu harus dijadikan kepentingan publik bukan untuk kepentingan kapitalsemata.[] SatrioArismunandar, DosenNewsmakingCriminologyFISIPUI Harus Kompak dan Serius Menolak Kalau saya lihat, sinetron Ustadz Fotokopy (SCTV) itu isinya sudah bukan lagi kritik sosial tetapi sudah konyol-konyolan yang tidak ada unsur edukatifnya. Tidak ada mutunya. Bandingkan ya dengan sinetron yang rada bermutu seperti ParaPencariTuhan (SCTV). Di PPT juga kan digambarkan ada tokoh ustadz yang mempunyai kelemahan. Tapi kesannya bukan melecehkan, di situ digambarkan secara proporsional, ada kebaikan tetapi juga ada kekurangan, yang semuanampakwajarnampakpulanilaikearifannya.TetapikalaudiUF, itu 100 persen isinya jelek. Mulai dari tokoh hajinya hingga tokoh ustadznya. Saya muak banget lihatnya, karena tidak ada bagus- bagusnya. Hatinya selalu dengki, ngomong selalu kasar, tukang bohong, fitnah, belagu, sombong, memutarbalikan ayat. Jadi tampak sekaliketidakwajarannyadantidakadanilaiedukatifnyasamasekali. Saya tidak tahu apakah para produser tayangan-tayangan yang merusak itu berniat untuk merusak akidah, akhlak dan gaya hidup penontonnya. Tetapi memproduksi itu semua untuk kepentingan komersialiya.Yangpentingkanduitmasuk.Jadidisinidiamengabaikan nilai-nilai edukatif, yang penting ada iklan, duit masuk. Jadi lebih mengejarkekomersialisasi. Tetapi akibatnya sama juga, apakah berniat mau merusak atau tidak merusak, dampaknya sama saja merusak. Kalau niat kan yang tahu hanya dia sama Tuhan, kita tidak tahu. Tetapi faktanya memang merusak. Bila dia berkilah,“saya berniat baik kok”ya mana kita tahu, tetapiyangjelastayanganitutidakmendidik. Sebenarnya begini, bila ingin tayangan itu tidak ditayangkan, yang penting adanya kekompakan. Contohnya waktu itu, di Lativi kan adaserialgulatSmackDown.Meskiditayangkannyamalam,anak-anak kecil juga kan senang menontonnya. Kemudian ada anak kecil memitingtemannyahinggamatidenganalasanhanyameniruadegan gulat di Smack Down tersebut. Kemudian Menteri Pendidikan, Menteri Perempuan, Komnas Anak segala macam tokoh-tokoh, semua sepakat memintafilmtersebuttidakbolehtayanglagi. Akhirnya Lativi tidak lagi menayangkannya padahal ratingnya sangat tinggi, dan iklannya banyak. Jadi kalau kita kompak, ada kampanye dari berbagai kelompok massa, yang penting keras tekanannya,televisipunakanmenyerah.Tapikalaukitasekederprotes, kirim surat doang, ya tidak didengar. Jadi kampanye penolakannya harusserius.[]fatih-joy IffahAinurRohmah, JubirMuslimahHTI Harus Melarang, Jangan Tunggu Diprotes Sinetron bermasalah yang sebagian besar mengajarkan gaya hidup bebas dan hedonis (Contohnya, Akibat Pergaulan Bebas/SCTV); perzinahan (Selingkuh/Indosiar), juga merendahkan Islam dan simbol nilai/hukum (Haji Medit/SCTV, Ustadz Fotocopy/SCTV dan TukangBuburNaikHaji/RCTI) yang menjual simbol Islam 'Haji' dan 'Ustadz' untuk menarik perhatian penontonnya dengan cara menampilkan sosok yang bertolak belakang dengan sosok ustadz dan hajiyangsemestinya. Jadi ini menyakiti umat Islam karena mengolok-olok simbol- simbolIslam.Sinetronbermasalahinimerusakumatdanmenanamkan nilai-nilaiyangbertentangandenganIslam. Sinetron dengan model begini semakin banyak diproduksi, menunjukkan pihak produser dan stasiun TV hanya berorientasi keuntungansaja,tidakmempertimbangkanaspekpengaruhburuknya bagi masyarakat. Ini juga menunjukkan bahwa negara gagal melindungi rakyat dari berbagai pemikiran dan gaya hidup yang merusakyangdisebarkanmelaluimedia. Meskiberalasanmenggambarkanrealitasdimasyarakat,namun media semestinya memerankan diri membimbing masyarakat ke arah perilakuyangbenar,bukanhanyaberorientasipadaselerapasarsaja. Memang hanya negaralah yang bisa mengarahkan masyarakat yang memiliki bermacam orientasi –positif dan negatif- sehingga masyarakat bisa terjaga dari terpapar berbagai pemikiran maupun tayanganyangmencontohkanperilakukontraproduktif. Negara semestinya menggariskan rambu-rambu penataan mediadandiiringipenegakanhukumyangtegas.Dalamkaitandengan sinetron-sinetron bermasalah semestinya negara tidak menunggu protes masyarakat. Ada atau tidak ada protes, mestinya tayangan semacamitudilarang. Yangbisastopyanegaramelaluilembagapengawasyangselalu memantau semua produk pemikiran di tengah masyarakat, juga memiliki otoritas untuk mengajukan ke pengadilan, pembinaan, pengarahan, penyetopan hingga pelarangan berdiri media jika tidak memenuhi ketentuan syariat. Karenanya standar yang dipakai oleh lembaga pengawas media dan peradilan harus sama, yakni rambu- rambusyariatIslam.[]jokoprasetyo
  11. 11. 11Telaah Wahyu Oleh: Rokhmat S Labib, MEI Perilaku JahatPerilaku Jahat Penghuni NerakaPenghuni Neraka Perilaku Jahat Penghuni Neraka Media Umat | Edisi 104, 22 Jumadil Akhir - 6 Rajab 1434 H/ 3 - 16 Mei 2013 Ikhtisar: 1. Perilaku orang yang dimasukkan ke dalamnerakaJahannam:(a)menukar kenikmatan Allah dengan kekufuran; (b) menjerumuskan kaumnya di nera- kaJahannam;(c)menyesatkanmanu- siadijalanAllah. 2. Kita tidak boleh terpengaruh dengan mereka, apalagi mengikuti propagan- dasesatmereka. Tidakkah kamu perhatikan orang-orang yang telah menukar nikmat Allah dengan kekafiran dan menjatuhkan kaumnya ke lembah kebinasaan? Yaitu neraka Jahannam; mereka masuk ke dalamnya; dan itulah seburuk-buruk tempat kediaman. Orang-orang kafir itu telah menjadikan sekutu-sekutu bagi Allah supaya mereka menyesatkan (manusia) dari jalan-Nya. Katakanlah: "Bersenang-senanglah kamu, karena sesungguhnya tempat kembalimu ialah neraka" (TQS Ibrahim [14]: 28-30). K esudahan nasib ma- nusia di akhirat amat ditentukan oleh tin- dakan mereka sendiri selama hidup di du- nia. Ayat ini adalah di antara yang menjelaskan realitas tersebut secara gamblang. Perilaku orang- orang yang menjerumuskan diri mereka dan orang lain di neraka jahannam digambarkan ayat ini. Dengan gambaran tersebut, di- harapkan manusia terhindar dari perilaku buruk yang mengantar- kankepadanerakatersebut. Mengganti Nikmat dengan Kufur Allah SWT berfirman: Alam tara ilâ al-ladzîna baddalû ni'ma- tal-Lâh kufr[an] (tidakkah kamu perhatikan orang-orang yang telah menukar ni`mat Allah de- ngan kekafiran). Imam al-Qur- thubi meriwayatkan dari Ibnu 'Abbas bahwa orang-orang yang diceritakan dalam ayat ini adalah musyrikQuraisy. Menurut al-Syaukani dalam tafsirnya, Fath al-Qadîr, ini merupakan pendapat jumhur mufassirin berpendapat bahwa yang dimaksud mereka dalam ayat ini adalah kafir Mak-kah. Ayat ini juga turun berkaitan dengan mereka. Meskipun demikian, dite- gaskan Ibnu Katsir bahwa makna ayat ini bersifat umum mencakup semua orang kafir. Sebab, Allah SWT telah mengutus Nabi Mu- hammad SAW sebagai rahmat bagi alam semesta dan nikmat bagi manusia. Barangsiapa yang menerima dan mensyukurinya, masuksurga.Sebaliknya,siapasa- ja yang menolak dan menging- karinya, maka masuk neraka. Pen- jelasan senada juga dikemukakan al-Hasan.Sebagaimanadikutipal- Qurthubi, al-Hasan mengatakan bahwa ayat ini meliputi semua orangmusyrik. Ini merupakan khithâb (se- ruan) yang ditujukan kepada Rasulullah SAW dan semua orang yang tepat dengan seruan terse- but. Seruan tersebut mengan- dung makna ta'jîb (memunculkan rasa heran) pada diri Raslullah SAW terhadap orang-orang kafir yang melakukan sejumlah peri- laku buruk dan jahat yang me- nyebabkanmerekasengsara. Perbuatan buruk pertama yang disebutkan adalah: baddalû ni'matal-Lâh kufr[an] (orang- orangyangtelahmenukarnikmat Allah dengan kekafiran). Menurut Fakhruddin al-Razi ada tiga ke- mungkinan maksud dari 'meng- ganti nikmat Allah dengan keku- furan'. Pertama, mereka meng- gantisikapsyukur merekakepada nikmat Allah dengan kekufuran. Ketika mereka diwajibkan men- syukuri kenikmatan, tetapi mere- ka justru melakukan kekufuran. Seolah-olah mereka telah meng- ubah dan mengganti total syukur dengankekufuran. Kedua, yang mereka tukar adalah nikmat Allah SWT itu sen- diri dengan kekufuran. Pasalnya, mereka telah mengingkari kenik- matan tersebut, kemudian Allah SWT mencabut nikmat itu dari mereka. Sehingga, yang tersisa hanya kekufuran sebagai peng- gantikenikmatan. Ketiga, sesungguhnya Allah SWT memberi kenikmatan kepa- da mereka berupa Rasul SAW dan Alquran. Namun mereka lebih memilih kekufuran daripada ke- imanan. Dijelaskan juga oleh al- Thabari, makna telah menukar kenikmatan Allah dengan keku- furan; bahwa Allah SWT telah memberikan kenikmatan kepada Quraisy dengan diutusnya Nabi Muhammad SAW dari kalangan mereka dan menjadi rasul yang memberikan rahmat bagi mere- ka. Namun mereka mengingkari dan mendustakannya; sehingga mereka menukar kenikmatan Allah dengan kekufuran. Ituah perbuatan dan perilaku buruk mereka. Menjerumuskan Pengikutnya ke Neraka Perbuatan buruk mereka yang kedua adalah: Wa ahallû qawmahum dâr al-bawâr (dan menjatuhkan kaumnya ke lem- bah kebinasaan?). Kata ahallû qawmahum dalam ayat ini berarti anzalûhum (menjatuhkan, men- jerumuskan mereka). Menjeru- muskan kaum mereka adalah de- ngan menghalangi mereka (un- tuk mengimani kenikmatan Allah SWT itu). Demikian penjelasan Abdurrahmanal-Sa'di. Sedangkan yang dimaksud dengan qawmahum, menurut al- Zamakhsyari dalam tafsirnya, al- Kasysyâf, adalah orang-orang yang mengikuti mereka atas kekufuran.Tak jauh berbeda, Ibnu 'Athiyah juga menafsirkan qaw- mahum sebagai orang-orang yangmenaatimereka. Kaum yang mengikuti me- reka itu pun dijerumuskan ke dalam dâr al-bawâr. Diterangkan oleh banyak mufassir, kata al- bawâr berarti al-halâk (kebinasa- an). Sehingga dâral-bawâr berarti dâr al-halâk (tempat kebinasaan, kehancuran). Yang dimaksud de- ngan lembah kebinasaan dite- rangkan dalam ayat selanjutnya Allah SWT berfirman: Jahannam yashlawnahâ (yaitu neraka Ja- hannam; mereka masuk ke da- lamnya). Menurut al-Zamakhsyari, kata Jahannam merupakan athf al-bayân (menambahkan kata baru yang berfungsi sebagai pen- jelas). Itu artinya, yang dimaksud dengan dâr al-bawâr adalah Ja- hannam. Demikian penjelasan para mufassir, seperti Ibnu Zaid, sebagaimana dikutip al-Qurthubi dalam tafsirnya, al-Jâmi' li Ahkâm al-Qur`ân. Dikatakan juga oleh al- Samarqandi, bahwa frasa: Jahan- nam yashlawnahâ (neraka Jahan- nam yang mereka masuki) berarti mereka masuk ke dalamnya di akhirat. Kemudian ditegaskan de- ngan firman-Nya: Wabi`sa al- qarâr (dan itulah seburuk-buruk tempat kediaman). Kata bi`sa merupaka kata yang digunakan untuk celaan terhadap segala se- suatu. Sedangkan kata al-qarâr di sini berarti al-mustaqarr (tempat kediaman). Sehingga bi`sa al- qarâr berarti tempat kembali yangpalingburuk. Dikatakan al-Samarqandi, bi`sa al-qarâr berarti bi`sa al- mustaqarr Jahannam (seburuk- buruknya tempat kediaman adalahadalahnerakaJahannam). Menjadikan Sekutu bagi AllahSWT Perbuatan buruk ketiga yang mereka lakukan adalah: Waja'alû lil-Lâh andâd[an] liyu- dhillû 'an sabîlihi (orang-orang kafir itu telah menjadikan sekutu- sekutu bagi Allah supaya mereka menyesatkan (manusia) dari jalan-Nya). Kata andâd[an] meru- pakan bentuk jamak dari kata nidd[an]. Dijelaskan Fakhruddin al- Razi, yang dimaksud dengan al- andâd adalah al-asybâh wa al- syurakâ` (serupa dan sekutu). Me- nurutnya, sekutu yang dimaksud- kan mengandung tiga kemung- kinanmakna. Pertama, mereka memberi- kan bagian tertentu untuk ber- hala dalam kenikmatan yang dianugerahkan Allah SWT kepada mereka. Contoh ucapan mereka dalam ini adalah: Ini untuk Allah, daniniuntuksekutu-sekutukami. Kedua, mereka menyekutu- kan antara berhala dan al-Khaliq dalam peribadatan. Dan ketiga, mereka menyampaikan secara terang-terangan keberadaan se- kutu bagi Allah. Ucapan mereka dalam hal ini seperti ketika ber- haji: Labayka lâ syarîka laka illâ syarîka huwa laka tamlikuhu wa mâ milk (kami menghadiri pang- gilanmu, tidak ada sekutu bagi- Mu kecuali sekutu yang menjadi milik-Mu). Menjadikan sekutu selain Allah SWT jelas merupakan kese- satan. Selain membuat mereka tersesat, tindakan tersebut juga dapat menyesatkan orang lain. Ini ditegaskan dalam frasa selanjut- nya: liyudhillû 'an sabîlihi. Mereka menyesatkan manusia dari sabî- lihi. Pengertian sabîlihi adalah dî- nihi(agama-Nya).Sehingga,seba- gaimana dijelaskan al-Samarqan- di, frasa tersebut bermakna: liyushrifû al-nâs 'an dîn al-Islâm (untuk memalingkan manusia dariagamaIslam). Dikatakan juga oleh Ibnu Katsir, di samping telah menjadi- kan sekutu-sekutu bagi Allah yang mereka sembah, mereka juga mengajak manusia untuk melakukanhalyangsama. Kemudian Allah SWT me- merintahkan Rasulullah SAW un- tuk menyampaikan ancaman terhadap mereka: Qul tamatta'û (katakanlah: "Bersenang-senang- lah kamu). Artinya, bersenang- senanglah di dunia dengan keku- furankalian.Kalimatini,sekalipun menggunakan shîghah fi'l al-amr (bentuk kata perintah), akan tetapi menghasilkan makna al- tahdîdwaal-wa'îd(ancaman). Makna ini dapat disimpul- kan dari kalimat berikutnya: Fainna mashîrakum ilâ al-nâr (karena sesungguhnya tempat kembalimu ialah neraka"). Ini sebagaimana firman Allah SWT: Perbuatlah apa yang kamu kehen- daki; sesungguhnya Dia Maha Melihat apa yang kamu kerjakan (TQSFushilat[41]:40). Dijelaskan Imam al-Qur- thubi, ancaman terhadap mereka ini mengisyaratkan sedikitnya ke- nikmatan dunia. Pasalnya, kenik- matanduniatersebutterputus. Kata mashîrakum berarti maruddukum wa marji'ukum (tempat kembali kalian). Se- hingga ayat ini berarti: Tempat kembali kalian di akhirat kelak adalah neraka Jahannam. Bukan yang lain. Inilah balasan yang setimpal atas kejahatan dan ke- kufuranmerekadidunia. Diterangkan Ibnu Katsir, ayat ini sebagaimana firman Allah SWT: Kami biarkan mereka ber- senang-senang sebentar, kemudi- an Kami paksa mereka (masuk) ke dalam siksa yang keras (TQS Luk- man [31]: 24). Juga firman Allah SWT: (Bagi mereka) kesenangan (sementara) di dunia, kemudian kepada Kamilah mereka kembali, kemudian Kami rasakan kepada mereka siksa yang berat, disebab- kan kekafiran mereka (TQS Yunus [10]:70). Demikianlah perilaku jahat orang-orang kafir selama di du- nia. Kenikmatan yang Allah SWT anugerahkan kepada mereka tidak disyukuri. Di antara kenik- matan besar adalah diutusnya Rasulullah SAW dan risalah yang beliau bawa, Islam. Kenikmatan tersebut mereka tolak dan ing- kari. Mereka sendirilah meng- ubah kenikmatan dengan keku- furan, yang akhirnya berbuah ke- sengsaraan. Mereka dimasukkan ke dalam neraka Jahannam. Tak berhenti pada dirinya. Mereka memalingkan manusia dari Islam dan menjerumuskan mereka ke dalam neraka. Semoga kita ter- masuk yang terselamatkan dari proganda sesat mereka. Wal-Lâh a'lambial-shawâb.[]
  12. 12. 12 Media Nasional Maraknya artis menjadi calon legislator (caleg) merupakan sebuah kegagalan dari budaya politik di Indonesia. Caleg “Indonesia Idol” 2014 Media Umat | Edisi 104, 22 Jumadil Akhir - 6 Rajab 1434 H/ 3 - 16 Mei 2013 Angel LelgaAngel LelgaAngel Lelga Anang HermansyahAnang HermansyahAnang Hermansyah Ikang FauziIkang FauziIkang Fauzi Mandala ShojiMandala ShojiMandala Shoji Donny DamaraDonny DamaraDonny Damara Mahalnya jadi Caleg B esarnya animo untuk menjadi caleg bukan tanpa modal yang sedikit. Setidaknya para calon anggota legislatif itu harus merogoh koceknya dalam-dalam. Hasil penelitian disertasi doktornya, Wakil Ketua DPR Pramono Anung mengatakan, modal menjadi calon legislator tergantung latarbelakangsikandidat. Figur publik dan artis biasanya menyiapkan dana maksimal Rp 600 juta. Sementara birokrat dan pengusaha, setidaknya menyediakan Rp 6 milyar. “Anggaran artis lebih sedikit karena sudah punya modal popularitas,” katadia. Pramono mengakui biaya calon selama kampanye tak sebanding dengan pendapatan bersih anggota DPR, yang rata-rata Rp 50 juta per bulan. Namun, seorang pengusaha yang terpilih menjadi anggota DPR bisa memanfaatkan kemudahan akses informasi tentang kebijakan pemerintah. Bermodal jaringan bisnis, mereka dapat mengantisipasi kebijakan yang diterbitkanpemerintah. Direktur Eksekutif Pol-Tracking Institute Hanta Yuda menyatakan, tingginya biaya politik pada Pemilu 2014 bakal berdampak pada korupsi politik. Ia menegaskan, tidak sedikit dari calon legislatif yang berharap uangnya kembali. “Karena biaya politik tinggi bakal meningkatkan political costdanjugamemunculkanmoneypolitics,”kataHanta. Memulai debut sebagai calon legislator dari Partai NasDem, Taufik Basari, yang juga pengacara, menyiapkan dana Rp 200 juta. Sejak awal ia bertekad menghindari politik biaya tinggi. Jika dana yang dihabiskan terlalu banyak, ujar Taufik, legislator hanya berpikir mengembalikan modal selama kampanye.[]fm P anggung idola tak hanya di layar kaca. Rupanya, pentas idola juga akan digelar da- lam pemilihan anggo- ta legislatif tahun 2014. Bagaima- na tidak, banyak artis tampil sebagai calon anggota legislatif. Apakah para caleg selebritas itu dapat menjawab aspirasi masya- rakat? Setiap artis punya alasan mengapa mereka banting stir jadi politikus. Aktor film Donny Dama- ra, bakal calon legislatif Partai NasionalDemokrat(Nasdem)me- nerangkan ikutnya ia sebagai caleg karena ingin mendorong pembangunan infrastruktur de- nganmemangkasbirokrasi. “Saya mau memastikan jika dari sini Rp 10, sampai di daerah juga Rp 10," ujar Donny Damara di Jakarta. Lain Donny lain pula alasan pemain sinetron dan presenter Mandala Shoji. Ia beralasan ingin menghijaukan Indonesia. “Saya ingin menanam pohon. Tapi apa bisa di semua wilayah?Apabisa di bekaslahantambang?”katadia. Sederet nama artis papan atas meramaikan perebutan kursi DPR.AdaAnangHermansyah,Eko Patrio, Cornelia Agatha, Marisa Haque, Ikang Fauzi, Emilia Conte- sa,AngelLelgadll. Kordinator Forum Masyara- kat Peduli Parleman Indonesia (Formapi), Sebastian Salang me- nyatakan keberadaan caleg artis yang akan maju di Pemilu 2014 diyakini tidak akan membawa perubahanbaikkinerjaDPR. Menurutnya, partai politik menjadikan artis sebagai caleg hanya sebagai pendorong untuk memperoleh suara. "Partai prag- matis untuk mendulang suara yang besar. Artis-artis yang popu- ler dipakai untuk menghasilkan suara yang besar dan kursi di DPR," ujar Salang dalam jumpa pers di kantor sekretariat Formapi di Matraman, Jakarta Timur, Ahad (28/4). Salang menilai kebanyakan caleg yang diajukan minim kom- petensi terhadap tugas DPR yakni anggaran, legislasi dan penga- wasan. "Mayoritas artis direkrut tanpa melalui pembinaan parpol, meski ada beberapa yang sudah membina diri sejak lama di par- pol,"sebutnya. Dari catatan Formapi, hanya PKS, PKPI dan PBB yang tidak menyodorkan artis sebagai caleg- nya. Sementara partai lain utama- nya PAN paling banyak menyo- dorkan artis. PDIP memiliki 5 artis, Demokrat (5), Golkar (3), PAN (9), PKB (7), Gerindra (9), Hanura (3), Nasdem (6) dan PPP dengan 4 calegartis. Sedangkan pengamat poli- tik dari Universitas Airlangga Su- rabaya, Haryadi menilai, penye- bab kalangan artis yang memilih berpindah ke ranah politik karena merasa pamornya mulai memu- dar hingga berpikir untuk men- cari lahan baru, yaitu mencoba peruntungandiduniapolitik. Menurutnya, tujuan utama artis menjadi caleg untuk menda- patkan lahan baru untuk menge- ruk materi. "Biasanya artis yang lari ke sana adalah mereka yang sudah tidak laku, artinya pamor- nyasudahturun,"tegasHaryadi. Hal itulah yang membuat mereka memutuskan untuk ikut bergabung di ranah politik. "Jujur saja, saat ini profesi menjadi anggota dewan bukan hanya sekadar lahan politik, tapi juga lahan ekonomi yang memikat," tandasHaryadi. KegagalanParpol Pengamat komunikasi po- litik Effendi Gazali mengatakan, maraknya artis menjadi caleg merupakan sebuah kegagalan dari budaya politik di Indonesia. “Partai politik gagal menciptakan kader, dan di parlemen partai politik gagal menjaga marwah dari DPR,” tuturnya kepada Media Umat,Sabtu(27/4)Jakarta. Menurutnya, begitu putus asakah parpol sehingga tidak mampu lagi menciptakan kader. Dan bahkan, menurutnya, parpol tidak menghargai proses internal mereka sendiri. “Ini akan menim- bulkan perkelahian loh,” imbuh- nya. Ini bisa terjadi, lanjutnya, karena sudah ada kader, tiba-tiba adaartismasuk.“Iniakanmenghi- langkan kepercayaan diri kader partaiitusendiri,”paparnya. Apakah artis bisa memberi sumbangsih? Effendi menutur- kan beberapa berhasil. Namun, menurutnya, tidak sedikit dari mereka yang kadang datang, kadang enggak. “Terus kalau bicara diketawain sama teman- temannyadikomisi,”bebernya. “Yang paling bahaya kalau menganggap jika menjadi ang- gota DPR itu sebagai sambilan, inilah yang saya katakan meng- hilangkan marwah DPR,” terang- nya. Hal yang sama diterangkan, Yahya Abdurrahman. Menurut- nya,adanyacalegartismembukti- kan kalau parpol itu tidak memili- ki platfom/garis perjuangan dan ide-ide perjuangan. “Kenapa? Se- bab memilih artis karena popu- laritasnya, yang akan memikat suara,”bebernya. Ketua Lajnah Siyasiyah DPP Hizbut Tahrir Indonesia (HTI) ini menilai hal itu karena tidak ada- nya proses kaderisasi dari parpol dan bahkan dikuatkan dengan banyaknya partai yang membuka pendaftarancaleg. “Ini seperti ajang Indonesia Idol saja, ada pendaftaran, terus diseleksi lalu jadilah mereka yang menang karena dipilih,” imbuh- nya. Yahya menuduh bahwa seperti itulah demokrasi yang tidak bersandar dengan menca- lonkan seseorang itu yang benar- benarlayak. “Demokrasi memang hanya bertumpu pada popularitas, tidak bertumpu konsepnya pada orang-orang yang layak,” terang- nya. Kalau seperti ini kondisinya, menurutYahya,sama saja dengan menggadaikan nasib umat. “Ba- gaimana bisa menyerahkan nasib umat pada orang-orang yang kehidupannya kayak gituh kok, yang terjadi akan seperti artis putus nyambung-putus nyam- bungpernikahannya,”paparnya. Kualitas artis, terang Yahya, nyatanya tidak terdengar kiprah- nya di legislasi, karena modal me- reka cuma popular.“Memang ada satu dua artis yang modalnya se- lain popular dan punya kemam- puan, namun itu hanya sebagian kecil,” pungkasnya.[] fatih muja- hid
  13. 13. 13Media Nasional UDAH DIMAKLUMIN AJA?UDAH DIMAKLUMIN AJA?UDAH DIMAKLUMIN AJA? Oleh: Luky B Rouf Lajnah Dakwah Sekolah (LDS) Pusat Penulis dan Pemerhati Masalah Remaja UDAH DIMAKLUMIN AJA?UDAH DIMAKLUMIN AJA?UDAH DIMAKLUMIN AJA? Media Umat | Edisi 104, 22 Jumadil Akhir - 6 Rajab 1434 H/ 3 - 16 Mei 2013 Buruknya Legislasi dalam Sistem Demokrasi Sistem Islam memiliki proses legislasi yang khas, yang sangat berbeda dengan sistem demokrasi. MEDIA GAUL Berita terheboh beberapa pekan ini tentang perilaku ngawur yang ditun- jukkan siswi SMAN 2 Toli-toli, yang melecehkan gerakan shalat. Dalam video yang berdurasi 5 menit 33 detik, kelima siswa yang merekam keisengan mereka pada tanggal 9 Maret 2013, memperlihat- kan plesetan bacaan ayat-ayat Alquran (surah al-Fatihah) yang diiringi musik "one more night"-nya Maron Five serta goyang- analayalaHarlemShake. Jujur lho, ketika pas ada beberapa anakremajangelakuin, kayakkasusdiatas, maka ada yang minta untuk dimaklumin. Alasan utamanya, ya karena mereka masih remaja. Masih labil emosinya, masih cari jati diri, masih meluap-luap emosinya, dan lainsebagainya. Namun rupanya kita masih harus ngurut urat kesabaran kita, karena faktanya pada saat pencarian jati diri itu, remaja menemukannya di dunia pergaul- an mereka. Mereka menemukannya dari apa yang mereka dengar dan apa yang mereka tonton seperti film, sinetron, musik, majalah, koran, dsb. Wajar jika Akbar S Ahmed (1992) pernah mengung- kapkan, “tidak ada ancaman yang lebih gawatterhadapeksistensimasyarakatIslam daripadaancamanserbuanmediaBarat.” Perilaku remaja nyontek abis dari media sekuler, kalo ini terjadi pembiaran oleh ortu, lingkungan bahkan sekolah dan negara, maka akan menjadi sebuah kewa- jaran. Nah, pada saat itulah 'kewajaran', seperti sudah menjadi hukum tak tertulis di tengah masyarakat. Orang tua dan masyarakat menganggap wajar perilaku pelecehan shalat ala SMAN 2Toli-toli, pada saat yang bersamaan nggak tahu atau merasa biasa-biasa aja, ketika mereka pa- hamIslamataunggak. UdahKhilafahAja! Loh, koq gampang banget dikasih solusi khilafah? Ya iya memang itu solusi- nya. Mau solusi apa lagi coba? Sistem kapitalisme-sekularisme yang sekarang diterapkan udah jelas-jelas melahirkan generasi free thinker macam SMAN 2 Toli- toli. Maka pilihannya cuman ada sistem Islam, karena sistem selain Islam, termasuk Sosialisme-Komunismejugatelahgagal. Cobakitajujur,ulamasekaliberImam Syafi'i yang sudah jadi ulama semasa mudanya, hidup di sistem apa? Sistem khilafah, yakni di masa Khalifah Harun Ar- Rasyid. Kemudian, ada ilmuwan Muslim Jabir ibn Hayan, Al-Khawarizmi, dll, juga hidupdimasakhilafah. Nah, pertanyaannya pentingnya kenapa ulama dan ilmuwan tersebut bisa muncul di masa khilafah? Karena para ilmuwan atau ulama tersebut mempunyai idealisme atau semacam mimpi besar, dan idealisme mereka terpelihara, karena didukung oleh keluarga, masyarakat dan sistemyangkondusifsaatitu. Bandingkan dengan kondisi seka- rang. Seorang remaja atau pelajar seka- rang, jangankan punya idealisme, lha wong masa depan mereka aja mau ke mana, mereka masih nggak tahu. Kalo pun ada sebagian remaja Muslim yang punya idealisme, tapi idealismenya mengalami pasang surut. Ya, tergantung godaan dan ujiandisekitarnya,kuatnggakdihadapinsi remajatersebut. Seorang remaja Muslim yang punya idealisme ingin menjaga ketakwaannya, tapi pada saat bersamaan penggoda ketakwaan itu ada sekitar remaja. Pengin- nya nggak ngelakuin pacaran, tapi teman- temannya ngolok-olok dibilangin kuno kalo nggak pacaran. Trus, teve ngasih conto gimana ngegaet lawan jenis. Kemu- dian negara malah memfasilitasi sarana pacaran, maka remaja yang tadi punya idealisme, bisa tergoda dan akhirnya ngelakuinpacaran. Nah, dalam sistem khilafah Islam, diterapkan pilar pengontrol individu, masyarakat dan negara. Misal, ketika syariat memerintahkan seseorang untuk bertakwa, "Bertakwalah kepada Allah di mana saja engkau berada.." (HR. Ahmad danalTirmidzi). Maka masyarakat menyokongnya dengan kontrol berupa amar ma'ruf nahyi munkar, seperti perintah, 'Barang siapa di antara kalian yang melihat kemungkaran, hendaklah dia merubahnya dengan tangannya. Apabila tidak mampu maka hendaknya dengan lisannya. Dan apabila tidak mampu lagi maka dengan hatinya, sesungguhnyaitulahselemah-lemahiman.'.” (HR.Muslim) Kemudian negara juga ikut memeli- hara dengan hukum-hukum yang diterap- kannnya sesuai dengan perintah,“Hendak- lah kamu memutuskan perkara di antara mereka dengan hukum yang diturunkan oleh Allah, dan janganlah kamu mengikuti hawanafsumereka.(TQS.al-Maidah:49). So, dengan adanya kontrol masyara- kat serta penerapan hukum oleh negara, maka itu bisa menjaga individu-indivudu warganya—yang berpotensi melakukan kemaksiatan—agar senantiasa terikat dengan hukum-hukum syariah, yang denganketerikatannyaituiadijamindapat meraihkebahagiaanduniadanakhirat.[] T ahukah Anda bagai- mana proses sebuah undang-undang lahir? Tentu tidak banyak yang tahu. Tiba-tiba sudahdibahasdigedungDPR. Prof Fahmi Amhar, pakar Geospasial, yang bersama rekan- rekannya di Bakorsutanal, pernah menjadi penyusun naskah akade- mik RUU di bidangnya, menutur- kan pengalamannya dalam me- nyusun UU. “Mulai dari proses awal hingga akhir, semuanya amburadul. Dalam pansus itu, yang peduli hanya sedikit. Se- dangkan yang kompeten di bidang tersebut hanya satu orang, karena dialah satu-satunya alumni geologi. Bahkan, ada juga yang komentarnya ngaco,” kata- nya dalam Dirasah Syar'iyyah Ammah edisi 23 dihelat oleh Lajnah Tsaqafiyah DPP Hizbut Tahrir Indonesia (HTI), Sabtu (27/4) di Kantor DPP HTI, Crown Palace,Jakarta. Pembahasan RUU di DPR kadang dilakukan secara terbuka, dan diliput wartawan. Biasanya, pembahasannya sangat alot, bahkan dalam sehari hanya satu pasal yang selesai. Tetapi, karena waktu tidak cukup, rapat pun berpindah ke hotel. “Nah, kalau sudah di hotel, rapat yang alot ketika di DPR itu akan berlang- sung kilat. Karena, nggak ada war- tawan,”paparnya. Fakta tersebut, menurut Ketua Lajnah Tsaqafiyah DPP HTI Hafidz Abdurrahman, membukti- kan bahwa sistem demokrasi, yang diklaim lebih baik daripada sistem Khilafah itu, jelas bobrok. “Ini jelas jauh berbeda dengan legislasi di Negara Khilafah,” sambungnya. Dalam sistem Khilafah, ke- wenangan legislasi hukum tidak diserahkan kepada Majelis Umat, tetapi diserahkan kepada khali- fah. Karena, Ijmak Sahabat me- nyatakan demikian. Khalifah pun, dalam penyusunan UU, harus berdasarkan sumber wahyu, jika terkait dengan UU Syariah. Yaitu, Alquran, Sunnah, Ijmak Sahabat danQiyas. Selain itu, lanjutnya, “Baik hukum, pandangan dan pemikir- an yang dijadikan UU harus dibangun berdasarkan akidah Islam atau terpancar dari akidah Islam. Juga tidak boleh berten- tangandenganIslam,”jelasnya. Ia menerangkan, dalam prosesnya, khalifah pun tidak mengadopsihukumkarenafaktor mazhab, tetapi karena dalil yang paling kuat. Sedangkan dalam perkara yang terkait dengan pan- dangan, strategi dan sejenisnya diambil yang paling kuat berda- sarkan aspek khibrah (keahlian). Dalam perkara operasional, dilak- sanakan atau tidak, bisa diambil berdasarkan suara mayoritas.[] fatih

×