Epinefrina, señalizacion, odontología

  • 3,119 views
Uploaded on

Vias de señalizacion epinefrina

Vias de señalizacion epinefrina

  • Full Name Full Name Comment goes here.
    Are you sure you want to
    Your message goes here
    Be the first to comment
    Be the first to like this
No Downloads

Views

Total Views
3,119
On Slideshare
0
From Embeds
0
Number of Embeds
1

Actions

Shares
Downloads
19
Comments
0
Likes
0

Embeds 0

No embeds

Report content

Flagged as inappropriate Flag as inappropriate
Flag as inappropriate

Select your reason for flagging this presentation as inappropriate.

Cancel
    No notes for slide

Transcript

  • 1. UNIVERSIDAD EL BOSQUE
    DIVISION DE POSTGRADOS DE ODONTOLOGIA
    BIOLOGIA MOLECULAR.
    SECUENCIA GENETICA DE LA EPINEFRINA.
    Integrantes:
    Arboleda Nicolás
    Durán Gabriel
    Fernández Rodrigo
    Palmet Sara
    Rey David
  • 2. Pagina de resultados de busqueda con palabra clave monoamine oxidase, donde se eligio el resultado 4 .
  • 3. Cuarto resultado secuencia completa.
  • 4. Secuencia de RNAm y la traduccón a proteína.
  • 5.
  • 6. SECUENCIA DE AMINOACIDOS.
  • 7.
  • 8. Homo sapiens monoamine oxidase A (MAOA), nuclear gene encoding mitochondrial protein.
  • 9. 1 gggcgctcccggagtatcagcaaaagggttcgccccgcccacagtgcccggctccccccg
    61 ggtatcaaaagaaggatcggctccgcccccgggctccccgggggagttgatagaagggtc
    121 cttcccaccctttgccgtccccactcctgtgcctacgacccaggagcgtgtcagccaaag
    181 catggagaatcaagagaaggcgagtatcgcgggccacatgttcgacgtagtcgtgatcgg
    241 aggtggcatttcaggactatctgctgccaaactcttgactgaatatggcgttagtgtttt
    301 ggttttagaagctcgggacagggttggaggaagaacatatactataaggaatgagcatgt
    361 tgattacgtagatgttggtggagcttatgtgggaccaacccaaaacagaatcttacgctt
    421 gtctaaggagctgggcatagagacttacaaagtgaatgtcagtgagcgtctcgttcaata
  • 10. 481 tgtcaaggggaaaacatatccatttcggggcgcctttccaccagtatggaatcccattgc
    541 atatttggattacaataatctgtggaggacaatagataacatggggaaggagattccaac
    601 tgatgcaccctgggaggctcaacatgctgacaaatgggacaaaatgaccatgaaagagct
    661 cattgacaaaatctgctggacaaagactgctaggcggtttgcttatctttttgtgaatat
    721 caatgtgacctctgagcctcacgaagtgtctgccctgtggttcttgtggtatgtgaagca
    781 gtgcgggggcaccactcggatattctctgtcaccaatggtggccaggaacggaagtttgt
    841 aggtggatctggtcaagtgagcgaacggataatggacctcctcggagaccaagtgaagct
    901 gaaccatcctgtcactcacgttgaccagtcaagtgacaacatcatcatagagacgctgaa
  • 11. 961 ccatgaacattatgagtgcaaatacgtaattaatgcgatccctccgaccttgactgccaa
    1021 gattcacttcagaccagagcttccagcagagagaaaccagttaattcagcggcttccaat
    1081 gggagctgtcattaagtgcatgatgtattacaaggaggccttctggaagaagaaggatta
    1141 ctgtggctgcatgatcattgaagatgaagatgctccaatttcaataaccttggatgacac
    1201 caagccagatgggtcactgcctgccatcatgggcttcattcttgcccggaaagctgatcg
    1261 acttgctaagctacataaggaaataaggaagaagaaaatctgtgagctctatgccaaagt
    1321 gctgggatcccaagaagctttacatccagtgcattatgaagagaagaactggtgtgagga
    1381 gcagtactctgggggctgctacacggcctacttccctcctgggatcatgactcaatatgg
  • 12. 1441 aagggtgattcgtcaacccgtgggcaggattttctttgcgggcacagagactgccacaaa
    1501 gtggagcggctacatggaaggggcagttgaggctggagaacgagcagctagggaggtctt
    1561 aaatggtctcgggaaggtgaccgagaaagatatctgggtacaagaacctgaatcaaagga
    1621 cgttccagcggtagaaatcacccacaccttctgggaaaggaacctgccctctgtttctgg
    1681 cctgctgaagatcattggattttccacatcagtaactgccctggggtttgtgctgtacaa
    1741 atacaagctcctgccacggtcttgaagttctgttcttatgctctctgctcactggttttc
    1801 aataccaccaagaggaaaatattgacaagtttaaaggctgtgtcattgggccatgtttaa
    1861 gtgtactggatttaactacctttggcttaattccaatcattgttaaagtaaaaacaattc
  • 13. 1921 aaagaatcacctaattaatttcagtaagatcaagctccatcttatttgtcagtgtagatc
    1981 aactcatgttaattgatagaataaagccttgtgatcactttctgaaattcacaaagttaa
    2041 acgtgatgtgctcatcagaaacaatttctgtgtcctgtttttattcccttcaatgcaaaa
    2101 tacatgatgatttcagaaacaaagcatttgactttctgtctgtggaggtggagtaggtga
    2161 aggcccagcctgtaactgtcctttttcttcccttaggcaatggtgaactgtcattacaga
    2221 gcctagaggctcacagcctcctggaggaagcagcctccactttggatcaggaaatagtaa
    2281 aggaaagcagtgttgggggtagcggcatgcagaccctcagaccagaatggggacatcttg
    2341 tggtctgctgcctcaggaatctcctgaccacttgtagtccctccgacttctctagacatc
  • 14. 2401 tagtctcagtgctagcttatttgtatttttcctctttcacttcttatggaggagagtgtt
    2461 taactgagttagaatgttgaaactgacttgctgtgacttatgtgcagctttccagttgag
    2521 cagaggaaaatagtggcaggactgtcccccaggaggactccctgcttagctctgtgggag
    2581 accaactacgactggcatcttctcttccccctggaaggcagctagacaccaatggatcct
    2641 tgtcagttgtaacattctatttcaacttcaggaaagcagcagttttcttttaatttttcc
    2701 tatgaccataaaattagacatacctctcaacttacatatgtcttcaacatggttacctct
    2761 gcataaatattagcaaagcatgccaatttctcttaagtactgaaatacatatgataaatt
    2821 tgactgttatttgttgagactatcaaacagaaaagaaattagggctctaatttccttaaa
  • 15. 2881 gcaagctcacttgctttagttgttaagttttataaaagacatgaaattgagtcattttat
    2941 atatgaaaactaagttctctatcttaggagtaatgtcggcccacaagggtgcccacctct
    3001 tgttttccccttttaaaaactcagatttttaaaagccctttccaaaggtttcaactgtaa
    3061 aatacttctttttacaatgtatcaacatatttttatttaaggggaattaacaattgccag
    3121 ggaaaccagccaacccaagtttattatatcattaaccttatcataaattcaaacctaagt
    3181 tgctggaccctggtgtgaggacataaatcttccaaagttttgcctatcctaagagctgca
    3241 tttttctactgctctttaccttgcattttagctaatttaggagttttgagaatgtattgg
    3301 atacgctccagtacataaggagttgccgcatattatatcagactgctttgagaaatctca
  • 16. 3361 tccctagtctattgcagttgtttctattagcttactgattaactcagtcctgacacacct
    3421 tttgggaaatgctgatttaaacttcttaactggcaacagttggaacagtaatcagtttgc
    3481 taacatatttaaagtcttgaatgttgaagaactcatgtgatttacccttttcaacttttt
    3541 ggaaaacgatttaatttattctaattagattaaccctattaatctatggattgggtatca
    3601 aaatgaatgccagtccagatgtgcctagacacgaaattggagctgaggactctcacgata
    3661 tgcaagttcatccaacgtgaagataccataagctttttctctgaaccagagaaatgaaag
    3721 tcagtttaagaggctgatagatcttggccctgttaaggcatccacttcacagttctgaag
    3781 gctgagtcagccccactccacagttaggccaagaattagattttaaaacttcatctgtct
  • 17. 3841 gtcccagttaactgttaaataaggcctcatcctccactgaagagtatggattgaaggatt
    3901 gtgaactatgtttagtgtgattgtgaacttggtgcctaatgttccatgtctgaagtttgc
    3961 cccagtgctacacgttggagtatacctatgtgtgtgctttgccactgaagtaagattttg
    4021 cctgtatggtactgttttgtttgttaataaagtgcactgccacccccaatgcaaaaaaaa
    4081 aaaaaaaaaa
  • 18. NOMBRES Y ABREVIATURAS DE LOS AMINOACIDOS ESTANDAR.
  • 19.
  • 20.
  • 21. SECUENCIA DE AMINOACIDOS DE LA EPINFEFRINA.
    monoamine oxidase A
    [Homo sapiens]
  • 22. 1 menqekasiaghmfdvvvigggisglsaakllteygvsvlvleardrvggrtytirnehv
    61 dyvdvggayvgptqnrilrlskelgietykvnvserlvqyvkgktypfrgafppvwnpia
    121 yldynnlwrtidnmgkeiptdapweaqhadkwdkmtmkelidkicwtktarrfaylfvni
    181 nvtsephevsalwflwyvkqcggttrifsvtnggqerkfvggsgqvserimdllgdqvkl
    241 nhpvthvdqssdniiietlnhehyeckyvinaipptltakihfrpelpaernqliqrlpm
    301 gavikcmmyykeafwkkkdycgcmiiededapisitlddtkpdgslpaimgfilarkadr
    361 laklhkeirkkkicelyakvlgsqealhpvhyeeknwceeqysggcytayfppgimtqyg
    421 rvirqpvgriffagtetatkwsgymegaveageraarevlnglgkvtekdiwvqepeskd
    481 vpaveithtfwernlpsvsgllkiigfstsvtalgfvlykykllprs
  • 23. menqekasiaghmfdvvvigggisglsaakllteygvsvlvleardrvggrtytirnehv
    Aug-gaa-gac-ggg-gaa-gcc-agc-auc-ggc.
    gga-cac-aug-uuu-gac-guu-guu-guu-auc-gga.
    Gga-gga-auc-agc-gga-uua-cua-ggc-gga-agc-ggc-ggc
    gga-gga-aca-gaa-uau-gga-gug-agc-gug-gga
    gug-gga-gaa-ggc-cgc-gac-cgc-gug-gga-gga.
    Cgc-aca-uac-aca-auc-cgc-gac-gaa-cac-guu.
    RNAm.
  • 24. 531 AMINOACIDOS X 3 --------------- 1593 CODONES
    531 AMINOACIDOS ------------------------- RNAm (LECTURA)
  • 25.
  • 26. BIBLIOGRAFIA
    http://www.ncbi.nlm.nih.gov/nuccore/212549708/?report=graph&content=5&from=469&to=100192
    http://www.ncbi.nlm.nih.gov/nucleotide/33469954
  • 27. UNIVERSIDAD EL BOSQUE
    DIVISION DE POSTGRADOS DE ODONTOLOGIA
    BIOLOGIA MOLECULAR.
    IMPORTANCIA CLINICA DE LA EPINEFRINA.
    Integrantes:
    Arboleda Nicolás
    Durán Gabriel
    Fernández Rodrigo
    Palmet Sara
    Rey David
  • 28.
    • La adrenalina, también llamada epinefrina en su sustitutivo sintético.
    • 29. Hormonavasoactiva secretada en situaciones de alerta por las glándulas suprarrenales.
    • 30. Es una mono amina catecolamina, simpaticomimética derivada de los aminoácidosfenilalanina y tirosina.
  • 31.
    • Pertenece al grupo de las catecolaminas, sustancias que tienen un grupo catecol y un radical amino.
    • 32. Son sintetizadas a partir del aminoácidotirosina.
    • 33. Las catecolaminas actúan, en general, sobre el sistema nervioso simpático.
  • SECRECION.
    • Las fibras preganglionares llegan hasta el ganglio celíaco sin hacer sinapsis en él, desde donde siguen hasta la médula suprarrenal. Sus axones llegan a las células, que contienen vesículas que almacenan adrenalina. La adrenalina se segrega a la sangre y se distribuye a través del torrente circulatorio.
    • 34. La formación de la adrenalina se realiza a partir de la noradrenalina, utilizando la ruta común que usan todas las catecolaminas, como dopamina, L-dopa, noradrenalina y adrenalina.
  • EFECTOS.
    • Aumentar la tensión arterial.
    • 35. Aumentar el ritmo cardíaco.
    • 36. Dilata la pupila para tener una mejor visión.
    • 37. Aumenta la respiración, por lo que se ha usado como medicamento contra el asma.
  • Síntesis de las Catecolaminas a partir de la Tirosina.
  • 38.
  • 39. EPINEFRINA.
    • Composición
    Epinefrina cada ampolla de 1 ml contiene 1 mg de clorhidrato de epinefrina.
  • 40. Indicaciones
    • Colapso circulatorio agudo
    • 41. Resucitación cardiopulmonar
    • 42. Broncoespasmo
    • 43. Reacciones anafilácticas
    • 44. Shock, hipotensión
    • 45. Hemorragias abundantes.
    • 46. Reducción de la presión intraocular en el glaucoma simple e hipoglicemia por shock insulínico
    • Efectos adversos.
    • 47. La mayor parte de los efectos adversos afectan al sistema cardiovascular: vasoconstricción periférica, hipertensión, hemorragia cerebral, edema pulmonar, taquicardia, bradicardia refleja, arritmia cardíaca, angina y palpitaciones. En raras ocasiones se presenta mareo, anorexia, náusea y vómito.
    • 48. Dosis.
    La vía intravenosa se emplea solo para resucitación cardiorespiratoria, paro cardíaco y colapso. La vía subcutánea o intramuscular se emplea en reacciones anafilácticas agudas y broncoespasmo.
  • 49. EFFECTS OF DENTAL LOCAL ANAESTHETICS IN CARDIAC TRANSPLANT RECIPIENTS
    Meechan JG, Parry G
    Dent. J. 2002 feb 9; 192(3):161-3
  • 50.
    • Objective
    To investigate the cardiovascular responses of cardiac
    transplant recipients to dental local anaesthetic solutions with and withoutepinephrine (adrenaline).
    • Materials and methods
    A clinical study employing 30 patients (20 cardiac transplant recipients and ten healthy) awaiting gingival or minor oral surgery under local anaesthesia receiving either 4.4 ml lidocaine(lignocaine) with 1:80,000 epinephrine or 4.4 ml 3% prilocaine with 0.03IU/ml felypressin.
  • 51. Results
    Cardiactransplantpatientsexperienced a significanttachycardia 10 minutes after injection of the epinephrine-containing solution. No significant change in heart rate was detected after the injection of an epinephrine-free solution. Blood pressure was not affected. Periodontal surgery did not affect the responses to the local anaesthetics in the transplant recipients.
    Conclusions
    The cardiovascular response to dental local anaesthesia in cardiac transplant recipients is governed by the solution injected.
  • 52. UNIVERSIDAD EL BOSQUE
    DIVISION DE POSTGRADOS DE ODONTOLOGIA
    BIOLOGIA MOLECULAR.
    SEÑALIZACION TRANSMEMBRANAL DE LA ADRENALINA.
    Integrantes:
    Arboleda Nicolás
    Durán Gabriel
    Fernández Rodrigo
    Palmet Sara
    Rey David
  • 53. RECEPTORES ADRENERGICOS (ADRENORECEPTORES)
  • 54. RECEPTORES ADRENERGICOS (ADRENORECEPTORES)
  • 55.
  • 56.
  • 57.
  • 58. BIBLIOGRAFIA.
    Mechanisms of disease: beta-adrenergicreceptors--alterations in signaltransduction and pharmacogenomics in heartfailure
    Alterations in adrenergic receptor signaling in heartfailure
    Pharmacology and physiology of humanadrenergic receptor polymorphisms
    Linkage of beta1-adrenergic stimulationtoapoptoticheartcelldeaththroughproteinkinase A-independentactivation of Ca2+/calmodulinkinase II
    Induction of beta3-adrenergic receptor functionalexpressionfollowingchronicstimulationwithnoradrenaline in neonatal ratcardiomyocytes
    Gainingrespectability: membrane-delimited, caveolar-restrictedactivation of ion channels
    Pharmacology and physiology of humanadrenergic receptor polymorphisms
    Recentprogress in alpha1-adrenergic receptor research
    Thealpha(2a)-adrenergic receptor plays a protective role in mouse behavioralmodels of depression and anxiety
    In vivo gene modificationelucidatessubtype-specificfunctions of alpha(2)-adrenergicreceptors
    Alpha1-adrenergic receptors and theirsignificancetochemical-inducednephrotoxicity--a briefreview
    Alpha1-adrenergic receptors: new insights and directions
    Adrenoceptors and signal transduction in neurons, Received: 22 May 2006 / Accepted: 13 June 2006 / Published online: 1 August 2006