Your SlideShare is downloading. ×
0
Identificazione di nuovi geni
malattia nelle patologie
mitocondriali
Daniele Ghezzi
UO Neurogenetica Molecolare
Sequenziamento di nuova generazione
Perché il sequenziamento dell’esoma?
85% mutazioni
Strategia tradizionale
Analisi di linkage o mappaggio
di omozigosità
Geni candidati
Grosse famiglie con malattia
genetica ...
Analisi familiari
Filtraggio varianti
Conservazione e predizione
patogenicità cambio aa
Geni codificanti
proteine
mitocond...
Total variants identified in Individual ID #55554 21336
Synonymous variants 11140
Non Synonimous Variants 10196
NSV with f...
Classificazione genetica delle malattie mitocondriali
Difetti del DNA mitocondriale
• Protein synthesis genes (rRNAs, tRNA...
Geni codificanti per fattori per la sintesi proteica mitocondriale
MRPL3
MRPL44
MTPAP
MTFMT
EARS2
FARS2
AARS2
MARS2
CARS2
...
Kovalova & Tyynisimaa 2013
Tessuto specificità delle mutazioni aaRS2
•P1:Neonatal onset
•Psychomotor delay
•Axial hypotonia, hypertonia of limbs
•Brain MRI: thin corpus callosum, bilateral le...
Compound heterozygous mutations in TARS2 gene
Ivs6+3 A/G
wt TGGgtaaga
Mut TGGgtgaga
Pro282Leu (ex8)
wt CCC
Mut CTC
H.sapie...
TARS2
HSP60
P2 Ct
55% 100%
0%
10%
20%
30%
40%
50%
60%
70%
80%
90%
100%
Ct P2 Ct P2
Leu(UUR) Threonine
tRNA
aa-tRNA
TARS2
H...
0
50
100
Muscle homogenate Cultured fibroblasts
I II III IV V I II III IV V
•A 29 year-old woman
•No family history for ne...
Arg521STOP (ex11)
wt CGA
Mut TGA
Phe50Cys (ex1)
wt TTT
Mut TGT
H.sapiens AAKASAVRAAFLNFFRDRHGHRLVPSAS
P.troglodytes AAKASA...
AARS2
AARS2
M. Van der Knaap (University Medical Center, Amsterdam)
A
B
Phe50Cys
Arg521*
Leu155Arg Arg592Trp
Aminoacylation domain
Editing domain
Gly965ArgGlu405Lys
Gln537* Glu784Serfs*9
Ala...
Nuovi geni malattia
Nuove mutazioni e nuovi fenotipi
42%
3%11%8%
37% validati
delez
probabili
varianti dubbie
senza diagnosi
- 38 pz con diagnosi clinica e biochimica di malat...
Sequenziamento dell’esoma
 Rispetto alle tradizionali analisi di linkage, l’exome sequencing è una strategia
molto più ef...
Sequenziamento dell’esoma
 Richiede strumentazioni costose e personale specializzato
 Genera un enorme quantità di dati,...
Per la diagnostica…
Per la ricerca di nuovi geni malattia…
Targeted
resequencing < €€€ , < Time
> ANSWERS
TruSeq Custom Amplicon (Illumina)
E’ importante pianificare la strategia di utilizzo del pannello già al momento del diseg...
Pannello Mito1 (difetti isolati, PDH, CoQ10)
72 geni (492 esoni; 1195 ampliconi)
Pannello Mito2 (difetti multipli)
61 geni...
Vantaggi:
- Sistema molto flessibile
- Dinamico (implementabile con nuovi geni)
- basso costo per paziente (250-600 €)
- h...
Sequenziamento di pannelli di geni (Targeted resequencing)
Collaboratori
Holger Prokisch, Tobias Haack, Thomas Meitinger (Helmoltz Center, Munich, Germany)
Massimo Zeviani, Aurelio ...
•A 7 year-old boy
•No family history for neurological disorders
•Congenital onset
•Psychomotor delay and microcephalia
•Se...
Homozygous mutation in VARS2 gene
Thr337Ile (ex10)
wt ACA
Mut ATA
H.sapiens SFGLLFSVAFPVDGEPDAEVVVGTTRPETL
C.lupus SFGLLVS...
VARS2
VARS2
HSP60
P1 P1+VARS2 Ct Ct+VARS2
***
0
0.0002
0.0004
0.0006
0.0008
0.001
0.0012
P1 Imm P1+VARS2 Ct Imm Ct+VARS2
*...
Nucleus
YDR∆YDR
pFL38
YDR
Il lievito come modello per le malattie mitocondriali
∆ strain
2% glucose 2% acetate
104 103 102...
ALA1
vector
ala1F22C
ala1V500X
Glucose Glycerol
ala1L-16X
28°C
37°C
ALA1
vector
ala1F22C
ala1V500X
ala1L-16X YEAST MODEL: ...
ALA1
vector
ala1F22C
ala1V500X
Glucose Glycerol
ala1L125R
ALA1
vector
ala1F22C
28°C37°C
A
ALA1 vector ala1F22C ala1V500X a...
The protein apparatus is
provided by specific
nuclear genes
mtDNA translation takes place in mitochondria
The RNA apparatu...
Upcoming SlideShare
Loading in...5
×

Ghezzi - Convegno Mitocon 2014

812

Published on

Published in: Health & Medicine
0 Comments
0 Likes
Statistics
Notes
  • Be the first to comment

  • Be the first to like this

No Downloads
Views
Total Views
812
On Slideshare
0
From Embeds
0
Number of Embeds
3
Actions
Shares
0
Downloads
10
Comments
0
Likes
0
Embeds 0
No embeds

No notes for slide

Transcript of "Ghezzi - Convegno Mitocon 2014"

  1. 1. Identificazione di nuovi geni malattia nelle patologie mitocondriali Daniele Ghezzi UO Neurogenetica Molecolare
  2. 2. Sequenziamento di nuova generazione
  3. 3. Perché il sequenziamento dell’esoma? 85% mutazioni
  4. 4. Strategia tradizionale Analisi di linkage o mappaggio di omozigosità Geni candidati Grosse famiglie con malattia genetica (autosomica recessiva) Screening mutazionale Identificazione di nuovi geni malattia Pazienti singoli e piccole famiglie Filtraggio Geni (mutazioni) candidati Sequenziamento esoma Varianti Nuova strategia
  5. 5. Analisi familiari Filtraggio varianti Conservazione e predizione patogenicità cambio aa Geni codificanti proteine mitocondriali Analisi gruppi di pz con stesso fenotipo Colture cellulari Lievito
  6. 6. Total variants identified in Individual ID #55554 21336 Synonymous variants 11140 Non Synonimous Variants 10196 NSV with frequency <0.2% in “in-house” + public databases 331 >2 NSV / gene 22 n idsnv chr genesymbo NonSyn/G Omim class function Cases Controls Variant MapQual Depth PercentVa rs 1 2032113 chr1:11682 B3GALT6 9 http://www. snp missense 1 0 1 60 5 40 http://www. 2 2032120 chr1:65008 ESPN 72 606351 snp missense 1 0 1 43 7 57 rs3817921 3 1799904 chr1:11522 AMPD1 12 102770 snp missense 1 2 1 60 97 53 rs61752478 4 2032541 chr11:2062 SLC6A5 18 604159 snp missense,5utr 1 0 2 60 3 67 http://www. 5 1669566 chr11:6674 C11orf86 6 http://www. snp missense 1 2 2 60 3 100 rs11806072 6 2032647 chr14:6520 PLEKHG3 27 http://www. snp missense,5utr 1 0 2 60 6 83 http://www. 7 2032663 chr15:2077 GOLGA8E 11 http://www. snp missense 1 0 2 27 13 77 http://www. 8 1754118 chr15:4328 UBR1 17 605981 snp missense 1 1 1 59 27 33 http://www. 9 2032689 chr15:8378 TM6SF1 8 http://www. snp missense,3utr,missens 1 0 1 60 164 44 http://www. 10 1804636 chr17:8039 HEXDC 13 http://www. snp missense,3utr 1 1 1 60 68 43 rs11290967 11 2032834 chr19:7542 PEX11G 11 http://www. snp missense 1 0 2 60 5 80 http://www. 12 2032864 chr19:5117 SHANK1 46 http://www. snp missense 1 0 1 60 3 67 http://www. 13 2032222 chr2:15239 NEB 83 161650 snp missense 1 0 1 60 148 46 http://www. 14 2015210 chr20:5852 TCF15 8 http://www. snp missense 1 1 2 60 5 80 http://www. 15 1837500 chr6:35096 TCP11 9 http://www. snp missense,missense,ne 1 1 1 60 64 50 http://www. 16 2032068 chr6:74207 MTO1 8 http://www. indel,snp frameshift,missense 1 0 1 60 86 38 http://www. 17 2032393 chr6:13724 SLC35D3 13 http://www. snp missense 1 0 2 60 7 86 http://www. 18 2018016 chr7:44026 POLR2J4 9 http://www. snp missense,5utr 1 1 2 32 6 83 rs78733954 19 1772682 chr7:13207 PLXNA4 22 http://www. snp missense 1 1 1 59 33 33 http://www. 20 2032429 chr7:15168 GALNTL5 11 http://www. snp missense,3utr 1 0 1 59 69 54 rs75797831 21 2032436 chr8:87483 MFHAS1 23 http://www. snp missense 1 0 1 60 64 55 http://www. 22 2032486 chr9:13632 C9orf7 8 http://www. snp missense,3utr 1 0 2 60 3 67 http://www. Filtraggio (per malattie mitocondriali) Alterazione proteina Varianti rare Trasmissione recessiva 1 gene codificante una proteina mitocondriale
  7. 7. Classificazione genetica delle malattie mitocondriali Difetti del DNA mitocondriale • Protein synthesis genes (rRNAs, tRNAs) • Protein-encoding OXPHOS subunit genes • Large deletions Mutazioni DNA nucleare • Geni codificanti proteine strutturali MRC • Geni codificanti fattori d’assemblaggio MRC • Geni codificanti enzimi per biosintesi di lipidi o cofattori • Geni codificanti per fattori importanti per mantenimento mtDNA • Geni codificanti per fattori per la sintesi proteica mitocondriale • Geni coinvolti nella biogenesi/dinamica mitocondriale Mutazioni mtDNA Mutazioni nDNA Non nota 52% 30%18% Diagnosi genetica DNA mitocondriale
  8. 8. Geni codificanti per fattori per la sintesi proteica mitocondriale MRPL3 MRPL44 MTPAP MTFMT EARS2 FARS2 AARS2 MARS2 CARS2 MTO1
  9. 9. Kovalova & Tyynisimaa 2013 Tessuto specificità delle mutazioni aaRS2
  10. 10. •P1:Neonatal onset •Psychomotor delay •Axial hypotonia, hypertonia of limbs •Brain MRI: thin corpus callosum, bilateral lesion of the pallidum •Increased lactate (plasma, CSF) •Multiple OXPHOS deficiency in muscle •P2:Neonatal onset •Axial hypotonia, hypertonia of upper limbs •Frequent vomiting •Increased lactate (CSF) •Multiple OXPHOS deficiency in muscle P1 P2 2 0 50 100 Muscle homogenate Cultured fibroblasts I II III IV V I II III IV V TARS2
  11. 11. Compound heterozygous mutations in TARS2 gene Ivs6+3 A/G wt TGGgtaaga Mut TGGgtgaga Pro282Leu (ex8) wt CCC Mut CTC H.sapiens SSGAPETLQRVSGISFPTTELLRVWEA M.Mulatta SSGAPETLQRVSGISFPTTELLSAWEA C.lupus SSGTPETLQRVSGISFPTVEELRAWEE B.taurus FPDAPETLQRVSGISFPTAEELRAWEE M.musculus SLGAPETLQRVSGISFPKVELLRNWEA R.Norvegicus SSEAPETLQRVSGISFPKAELLRNWEA G.gallus GPSGRLSLQRIAAIAFPSTQELQAWQQ Phylogenetic conservation Pathogenicity prediction Pdeleterious substitution Pwt Psubstituted 0.83211 P282L 0.42337 0.02433 (Panther) This mutation is predicted to be probably damaging with a score of 0.974 (Polyphen2) EXON 6 intron 6 . TARS2 cDNA studies on the splice-site variant P3: c.845T Ct: c.845C
  12. 12. TARS2 HSP60 P2 Ct 55% 100% 0% 10% 20% 30% 40% 50% 60% 70% 80% 90% 100% Ct P2 Ct P2 Leu(UUR) Threonine tRNA aa-tRNA TARS2 HSP60 P2 P2+TARS2 Ct Ct+TARS2 0 0.0001 0.0002 0.0003 0.0004 0.0005 0.0006 0.0007 0.0008 0.0009 P2 Imm P2+TARS2 Ct Imm Ct+TARS2 *** ns *** ns Complementazione (infezione con TARS2 wt) TARS2
  13. 13. 0 50 100 Muscle homogenate Cultured fibroblasts I II III IV V I II III IV V •A 29 year-old woman •No family history for neurological disorders •Since 2 years of age psychomotor delay •Progressive severe cerebellar ataxia and psychotic features •Brain MRI: cerebellar atrophy and periventricular leukopathy. •Profound COX deficiency in muscle AARS2 GT P1 COX/SDH P1
  14. 14. Arg521STOP (ex11) wt CGA Mut TGA Phe50Cys (ex1) wt TTT Mut TGT H.sapiens AAKASAVRAAFLNFFRDRHGHRLVPSAS P.troglodytes AAKASAVRAAFLNFFRDRHGHRLVPSAS C.lupus PAQATAVRDAFLSFFRDRHGHRLVPSAS B.taurus PPHGAAVRDAFLSFFRDRHGHRLVPSAT M.musculus PPHGAAVRDAFLSFFRDRHGHRLVPSAS G.gallus PIQAAAVRDAFLSFFRDRHGHRLVPSAS D.rerio EFTSKRVRRKFIDFFREGYGHRVVPSSS F50C R521X wt mt Position NN output Prediction F C 50 0.6877 PATHOLOGICAL Phylogenetic conservation Pathogenicity prediction This mutation is predicted to be probably damaging with a score of 1.000 (Polyphen2) (PMUT) Compound heterozygous mutations in AARS2 gene AARS2
  15. 15. AARS2
  16. 16. AARS2 M. Van der Knaap (University Medical Center, Amsterdam)
  17. 17. A B Phe50Cys Arg521* Leu155Arg Arg592Trp Aminoacylation domain Editing domain Gly965ArgGlu405Lys Gln537* Glu784Serfs*9 Ala77Val Arg199Cysa Phe131del Val730Meta Thr871Asnfs*21 AARS2
  18. 18. Nuovi geni malattia Nuove mutazioni e nuovi fenotipi
  19. 19. 42% 3%11%8% 37% validati delez probabili varianti dubbie senza diagnosi - 38 pz con diagnosi clinica e biochimica di malattia mitocondriale - Sequenziamento dell’esoma (Istituto di Genetica, Monaco, Germania; BGI, Shenzen, Cina; MBU, Cambridge, UK) La nostra esperienza…
  20. 20. Sequenziamento dell’esoma  Rispetto alle tradizionali analisi di linkage, l’exome sequencing è una strategia molto più efficace per identificare varianti rare, responsabili di malattie mendeliane  Il sequenziamento dell’esoma è indicato per trovare le mutazioni responsabili di malattie molto eterogenee dal punto di vista genetico  A differenza dell’analisi di linkage, l’exome sequencing può essere applicato a piccole famiglie e a singoli individui  Per definizione, l’exome sequencing identifica varianti nelle regioni codificanti; quindi, anche se più informativo degli approcci classici, non è un metodo esaustivo - mutazioni negli introni - esoni non “analizzati” - delezioni esoniche …
  21. 21. Sequenziamento dell’esoma  Richiede strumentazioni costose e personale specializzato  Genera un enorme quantità di dati, la cui analisi richiede personale dedicato e adeguata forza biocomputazionale La capacità di distinguere mutazioni patogene tra centinaia di varianti è fondamentale - importanza dei filtri utilizzati - possibilità di validazione funzionale  Il sequenziamento dell’esoma associato a opportuni filtri, è efficace nell’individuare la causa genetica in malattie mitocondriali, grazie alla possibilità di validare la patogenicità delle varianti identificate  Questo approccio permette di identificare nuovi geni malattia (MTO1, FBXL4, VARS2, TARS2) e presentazioni fenotipiche inattese (AIFM1, TMEM70, AARS2) Exome sequencing nelle malattie mitocondriali
  22. 22. Per la diagnostica… Per la ricerca di nuovi geni malattia… Targeted resequencing < €€€ , < Time > ANSWERS
  23. 23. TruSeq Custom Amplicon (Illumina) E’ importante pianificare la strategia di utilizzo del pannello già al momento del disegno 1 run= 7Gbasi di dati =7 000 000 000 bp Pochi geni per tanti pazienti Tanti geni per pochi pazienti - minimo 16 massimo 1536 ampliconi (≈80 geni) tramite DesignStudio Caratteristiche: - Target resequencing basato su PCR, Kit da 96 campioni
  24. 24. Pannello Mito1 (difetti isolati, PDH, CoQ10) 72 geni (492 esoni; 1195 ampliconi) Pannello Mito2 (difetti multipli) 61 geni (586 esoni; 1370 ampliconi) In letteratura descritte mutazioni in circa 150 geni Malattie mitocondriali Geni analizzati per diagnostica: 45 Pz/mese: 40-50 UO Neurogenetica Molecolare (Istituto Neurologico “Besta”, Milano) Pannello MD1 (distonie, discinesie, NTL, folati, pterine) 45 geni (495 esoni; 1253 ampliconi) Pannello MD2 (Parkinson, NBIA, Wilson, CLN) 49 geni (504 esoni; 1376 ampliconi) Pannello MD3 (glicolisi, Aicardi-Goutieres, calcificazioni) 50 geni (587 esoni; 1435 ampliconi) Altre patologie neurologiche Disturbi movimento infantili e giovanili Neurodegenerazione con accumulo di ferro Disturbi glicolisi
  25. 25. Vantaggi: - Sistema molto flessibile - Dinamico (implementabile con nuovi geni) - basso costo per paziente (250-600 €) - high troughput: possibilità di screening di molti più geni Svantaggi: - ottimizzazione manuale del disegno - non copre al 100% tutti i geni - elevato investimento iniziale (x 96 campioni 10.000-30.000 €) - necessità di interpretazione e validazione di molte varianti nuove di significato incerto TruSeq Custom Amplicon (Illumina)
  26. 26. Sequenziamento di pannelli di geni (Targeted resequencing)
  27. 27. Collaboratori Holger Prokisch, Tobias Haack, Thomas Meitinger (Helmoltz Center, Munich, Germany) Massimo Zeviani, Aurelio Reyes, Alan Robinson (MRC Cambridge, UK) Mingyan Fang (BGI, Shenzen, China) E. Baruffini, C. Dallabona, I. Ferrero (Università di Parma) Graziella Uziel, Isabella Moroni (NPI, Istituto Neurologico “Besta”) E. Bertini (Osp. Pediatrico Bambin Gesù, Roma), R. Parini (Osp. San Gerardo, Monza), A. Burlina (Università di Padova) M.A. Donati (Osp. Meyer, Firenze), P. Balestri (Università di Siena), M. Van der Knaap (University Medical Center, Amsterdam), R. Taylor (University of Newcastle, UK) www.mitopedia.org Grazie! Ministero della Salute Exome seq Lievito Clinici
  28. 28. •A 7 year-old boy •No family history for neurological disorders •Congenital onset •Psychomotor delay and microcephalia •Seizures, hypotonia, hypostenia •Brain MRI: periventricular hyperintense lesions, and in the insula and fronto-temporal right cortex. Spectroscopy also revealed increase of lactate in the frontal white matter. •Isolated cI deficiency in muscle 0 50 100 Muscle homogenate Cultured fibroblasts I II III IV V I II III IV V VARS2
  29. 29. Homozygous mutation in VARS2 gene Thr337Ile (ex10) wt ACA Mut ATA H.sapiens SFGLLFSVAFPVDGEPDAEVVVGTTRPETL C.lupus SFGLLVSVAFPVDGEPDAEVVVGTTRPETL B.taurus SFGLLFSVAFPVDGEPDAEVVVGTTRPETL R. norvegicus SFGLLVSIAFPVDGDPGTEIVVGTTRPETL M.musculus SFGLLASVAFPVDGEPDTEIVVGTTRPETL D.rerio EFGTMVTFAYPLEGQ-EGEVAVSTTRPETM Phylogenetic conservation Pathogenicity prediction wt mt Position NN output Prediction T I 367 0.6061 PATHOLOGICAL (PMUT) This mutation is predicted to be probably damaging with a score of 0.998 (Polyphen2) aminoacylation domain editing domain T337I VARS2
  30. 30. VARS2 VARS2 HSP60 P1 P1+VARS2 Ct Ct+VARS2 *** 0 0.0002 0.0004 0.0006 0.0008 0.001 0.0012 P1 Imm P1+VARS2 Ct Imm Ct+VARS2 *** ns *** ns Complementazione (infezione con VARS2 wt) VARS2 HSP60 P1 Ct 69% 100% 0% 10% 20% 30% 40% 50% 60% 70% 80% 90% 100% Ct P1 Ct P1 Leu(UUR) Valine tRNA aa-tRNA
  31. 31. Nucleus YDR∆YDR pFL38 YDR Il lievito come modello per le malattie mitocondriali ∆ strain 2% glucose 2% acetate 104 103 102 104 103 102 wt RESPIRATION AND FERMENTATION ONLY RESPIRATION
  32. 32. ALA1 vector ala1F22C ala1V500X Glucose Glycerol ala1L-16X 28°C 37°C ALA1 vector ala1F22C ala1V500X ala1L-16X YEAST MODEL: Oxphos growth AARS2
  33. 33. ALA1 vector ala1F22C ala1V500X Glucose Glycerol ala1L125R ALA1 vector ala1F22C 28°C37°C A ALA1 vector ala1F22C ala1V500X ala1L125R ns *** ns %respirationrate 0 20 40 60 80 100 120 0 20 40 60 80 100 120 140 ALA1 vector ala1F22C ala1V500Xala1L125R CIV CI/CIII %activity 0 20 40 60 80 100 120 ALA1 ala1F22C B 0 20 40 60 80 100 120 ALA1 ala1F22C *** 28°C 37°C C CIV CI/CIII 28°C 37°C 28°C 37°C Var1 Cox1 Cox2 Cob Cox3 Atp6 Atp8/9 normalized ratio 1.0 0.9 <0.1 1.0 0.4 28°C 37°C overexposed Loaded Unloaded D 28°C E F 28°C ALA1 ala1F22C ala1V500X vector ala1L125R 37°C ALA1 ala1F22C 550560 602 nm 550 560 602 nm AARS2
  34. 34. The protein apparatus is provided by specific nuclear genes mtDNA translation takes place in mitochondria The RNA apparatus is provided by mtDNA genes (tRNAs, rRNAs) aaRSs are a group of enzymes that charge tRNAs with their cognate aminoacids (crucial step for the initiate of translation)
  1. A particular slide catching your eye?

    Clipping is a handy way to collect important slides you want to go back to later.

×