Your SlideShare is downloading. ×
RoXaN, une nouvelle protéine cellulaire interagissant avec la protéine non-structurale NSP3 du Rotavirus
Upcoming SlideShare
Loading in...5
×

Thanks for flagging this SlideShare!

Oops! An error has occurred.

×
Saving this for later? Get the SlideShare app to save on your phone or tablet. Read anywhere, anytime – even offline.
Text the download link to your phone
Standard text messaging rates apply

RoXaN, une nouvelle protéine cellulaire interagissant avec la protéine non-structurale NSP3 du Rotavirus

1,230
views

Published on

My Thesis Presentation (2000°

My Thesis Presentation (2000°

Published in: Technology

0 Comments
0 Likes
Statistics
Notes
  • Be the first to comment

  • Be the first to like this

No Downloads
Views
Total Views
1,230
On Slideshare
0
From Embeds
0
Number of Embeds
9
Actions
Shares
0
Downloads
16
Comments
0
Likes
0
Embeds 0
No embeds

Report content
Flagged as inappropriate Flag as inappropriate
Flag as inappropriate

Select your reason for flagging this presentation as inappropriate.

Cancel
No notes for slide

Transcript

  • 1. RoXaN, une nouvelle protéine cellulaire interagissant avec la protéine non-structurale NSP3 du Rotavirus Pierre Lindenbaum 9 Juin 2000 Directeur de thèse: Dr. Didier PONCET. INRA/VIM/Laboratoire de Biologie Moléculaire des Rotavirus 78352 Jouy-en-Josas CEDEX
  • 2. Introduction Rotavirus L'initiation de la traduction Résultats RoXaN Reconstitution Analyse de la séquence de RoXaN Interaction avec NSP3 Interaction avec eIF4G/NSP3 Interaction avec d'autres protéines Discussion Perspectives Propriétés des TPR Fonction de RoXaN Obtention d'un sérum dirigé contre RoXaN Double-Hybride
  • 3. Introduction Rotavirus L'initiation de la traduction Résultats RoXaN Reconstitution Analyse de la séquence de RoXaN Interaction avec NSP3 Interaction avec eIF4G/NSP3 Interaction avec d'autres protéines Discussion Perspectives Propriétés des TPR Fonction de RoXaN Obtention d'un sérum dirigé contre RoXaN Double-Hybride
  • 4. Impact du Rotavirus dans le monde 40% des enfants diarrhéïques de moins de 5 ans. 300 000 000 $ en frais d'hospitalisation aux U.S.A. Impact agronomique 1 000 000 décès/an Principale cause des gastro-entherites d'origine virale touchant les jeunes mammifères.
  • 5. 1 2 3 4 5 6 9 10 11 7 8 VP4 VP7 VP2 VP6 CORE Protéine VP1 VP2 VP3 VP4 NSP1 VP6 NSP3 NSP2 VP7 NSP4 NSP5, NSP6 Segmentd'ARNdb Structure du Rotavirus
  • 6. c c c c c c c c c Noyau VP1 VP2 VP3 VP4 VP6 NSP1 VP7 NSP2 NSP3 NSP4 NSP5 c c VIROPLASME Traduction des protéines Virales. Réplication. c RETICULUM Le cycle du Rotavirus
  • 7. Comparaison des ARNm viraux / cellulaires AUGUGACC 3'Coiffe ORF ARNm viraux NSP3 AAAAAAAAAA 3'Coiffe ORF ARNm cellulaires PABP
  • 8. La protéine Non-Structurale NSP3 Liaison à l'ARN Liaison à l'eIF4G Région "coiled-coil"
  • 9. Introduction Rotavirus L'initiation de la traduction Résultats RoXaN Reconstitution Analyse de la séquence de RoXaN Interaction avec NSP3 Interaction avec eIF4G/NSP3 Interaction avec d'autres protéines Discussion Perspectives Propriétés des TPR Fonction de RoXaN Obtention d'un sérum dirigé contre RoXaN Double-Hybride
  • 10. Rappels sur le Double Hybride Milieu Leu-Trp-His- Milieu Leu-Trp-His- • Les Protéines X et Y interagissent: • Les Protéines X et Y n'interagissent pas: Liaison à l'ADN GAL4 X GAL4 Domaine activateur Y UAS HIS Levure Leu- Trp- His- APPÂT PROIE
  • 11. Double Hybride et transactivation Liaison à l'ADN GAL4 X UAS HIS
  • 12. Introduction Rotavirus L'initiation de la traduction Résultats RoXaN Reconstitution Analyse de la séquence de RoXaN Interaction avec NSP3 Interaction avec eIF4G/NSP3 Interaction avec d'autres protéines Discussion Perspectives Propriétés des TPR Fonction de RoXaN Obtention d'un sérum dirigé contre RoXaN Double-Hybride
  • 13. P | P | eIF4G 4E PABP AAAAAAAAAAA 4A 40 SeIF3 m7G AUG MnKI Erk1, Erk2, p38 AAU MAPK + FRAP/mTOR 4E 4E-BP4E-BP eIF4GI est le support de l'initiation de la traduction
  • 14. NSP3 interagit avec eIF4G GAL4 Domaine activateur eIF4GI m88- NSP3Liaison à l'ADN GAL4
  • 15. Déplacement de la PABP par NSP3 4G 4A 4E Cellules infectées NSP3 déplace la PABP de EIF4G et permet la traduction des ARN m viraux 5'Cap NSP3 AUGUGACC 3' ARN viral 4G 4A 4E Cellules non infectées Traduction des ARNm polyadénylés. 5'Cap PABPARN cellulaire eIF4F AAAAAAAAAAAA 3' PABP NSP3
  • 16. Introduction Rotavirus L'initiation de la traduction Résultats RoXaN Reconstitution Analyse de la séquence de RoXaN Interaction avec NSP3 Interaction avec eIF4G/NSP3 Interaction avec d'autres protéines Discussion Perspectives Propriétés des TPR Fonction de RoXaN Obtention d'un sérum dirigé contre RoXaN Double-Hybride
  • 17. Découverte de RoXaN-1 GAL4 Domaine activateur eIF4GI m88- NSP3Liaison à l'ADN GAL4 GAL4 Domaine activateur RoXaN-I
  • 18. Introduction Rotavirus L'initiation de la traduction Résultats RoXaN Reconstitution Analyse de la séquence de RoXaN Interaction avec NSP3 Interaction avec eIF4G/NSP3 Interaction avec d'autres protéines Discussion Perspectives Propriétés des TPR Fonction de RoXaN Obtention d'un sérum dirigé contre RoXaN Double-Hybride
  • 19. Northern Blot de RoXaN-1 6kb 28S 18S Northern Blot RoXaN-1 sur ARNm de cellules MA104
  • 20. Reconstitution de l'ADNc de RoXaN RoXaN1 1274 pb RoXaN2 2370 pb RoXaN 5742pb KIAA1031 Chromosome 22 (AL035659) ESTAI28132 AI927120 (Humaine)
  • 21. Introduction Rotavirus L'initiation de la traduction Résultats RoXaN Reconstitution Analyse de la séquence de RoXaN Interaction avec NSP3 Interaction avec eIF4G/NSP3 Interaction avec d'autres protéines Discussion Perspectives Propriétés des TPR Fonction de RoXaN Obtention d'un sérum dirigé contre RoXaN Double-Hybride
  • 22. RoXaN 5742pb 977 Acides Aminés (110 kd) Palindrome 20 bases LDALD 359 LDALD 336 "coiled-coil" 900-977 TPR 82-115 Doigt de Zinc 886-915Région Hydrophobe 271-325
  • 23. RoXaN est ubiquitaire dans les tissus. RT-PCR Elisa réalisée sur différents tissus en utilisant KIAA1031comme amorce (projet HUGE) unité: fg d'ADN/ng d'ARN poly(A).
  • 24. Introduction Rotavirus L'initiation de la traduction Résultats RoXaN Reconstitution Analyse de la séquence de RoXaN Interaction avec NSP3 Interaction avec eIF4G/NSP3 Interaction avec d'autres protéines Discussion Perspectives Propriétés des TPR Fonction de RoXaN Obtention d'un sérum dirigé contre RoXaN Double-Hybride
  • 25. Recherche d'un sérum dirigé contre RoXaN Expression de RoXaN-1 par le système Bac-to-Bac Expression de RoXaN-1 par le système pET Expression de RoXaN-1 par le système GEX Immunisation par un peptide Immunisation par RoXaN-1 purifiée
  • 26. Introduction Rotavirus L'initiation de la traduction Résultats RoXaN Reconstitution Analyse de la séquence de RoXaN Interaction avec NSP3 Interaction avec eIF4G/NSP3 Interaction avec d'autres protéines Discussion Perspectives Propriétés des TPR Fonction de RoXaN Obtention d'un sérum dirigé contre RoXaN Double-Hybride
  • 27. NSP3-HisTag NSP3- 9011NHisTag PABPHisTag - + - + - +plasmide seul: traduction in vitro RoXaN1 traduite in vitro + - + - + - RoXaN1traduiteinvitro Protéine fixée aux billes RoXaN1 69Kd - 46Kd - 30Kd - RoXaN interagit avec NSP3 in vitro NSP3HisHisHisHis RoXaN S35
  • 28. NSP3 50 kD (Chaines lourdes des Ig) 25kD (chaines légères des Ig) Western Blot anti-NSP3 monoclonal Transfection FLAG-RoXaN1 Infection:rotavirus Immuno Précipitation Anti-FLAG Anti-NSP1 Lysat de cellules infectées Lysat de cellules non- infectées Western Blot anti-NSP3 FLAG RoXaN-1 NSP3 NSP3 co-immunoprécipite avec RoXaN-1 in vivo
  • 29. 50 kD 25kD Western Blot anti-FLAG(RoXaN1) Infection: Rotavirus Transfection FLAG-RoXaN1 Immunoprécipitation RoXaN1 RoXaN1 Stu Lysat trans- fecté RoXaN 1 -FLAG infecté Lysat infecté RoXaN1 Stu NSP3NSP1NSP3 NSP3 NSP3 NSP1 FLAG RoXaN-1 NSP3 NSP3 co-immunoprécipite avec RoXaN-1 in vivo
  • 30. EcoRI | PvuII | CloneIt: Obtention de deletions en phase
  • 31. RoXaN1Coiled coils (156-241) Interaction avec RoXaN1 en double- hybride NSP3A 3154 A2881 1784 A3294 163 A9005 4 150 A9011N 4 204 206 A9011C A9012N 4 240 A9020 163 293 A9012C 241 NSP3 Domaine de Liaison à l'ARN (4-149) Domaine de Liaison à eIF4GI/II 206-313) Interaction avec RoXaN1 in vitro n.d. n.d. n.d. n.d. n.d. n.d. n.d. RoXaN1 en GAD (proie) RoXaN1 en pGBT9 (appât) Met88 88 n.d. n.d. n.d. n.d. n.d. (1) interagit aussi avec GAD-RoXaN2 (1) Délimitation de la zone d'interaction NSP3-RoXaN (1/2)
  • 32. Délimitation de la zone d'interaction NSP3-RoXaN (2/2) TPR NSP3 977 | 1 | Interaction avec NSP3 en double-hybrideRoXaN m88.NSP3 clonée en pGBT9 (Appât) NSP3 clonée en GAD (Proie) n.d. n.d. n.d. n.d. n.d. n.d. n.d. n.d. n.d. RoXaN2 763 | n.d. 30 | 135 | RoXaN1 StuI 163 | 343 |RoXaN1 Eco109 82 | 398 | 149 | 135 | pGBT9 RoXaN1 SacIIStuI pGBT9 RoXaN1 SacIIStuI Sma 103070/103071174 | 144 | 103060/103063 265 | 144 | 174 | 103060/103071 244 | 103080/103061 341 | 341 | -35 | 246 | 341 | -10 | 135 | 342 | 103060/103061 144 | -10 | RoXaN1ATG | UTR
  • 33. Introduction Rotavirus L'initiation de la traduction Résultats RoXaN Reconstitution Analyse de la séquence de RoXaN Interaction avec NSP3 Interaction avec eIF4G/NSP3 Interaction avec d'autres protéines Discussion Perspectives Propriétés des TPR Fonction de RoXaN Obtention d'un sérum dirigé contre RoXaN Double-Hybride
  • 34. pGBT9 / pYX212 / pGAD424 pGBT9-NSP3 / pYX212 / pGAD424-NSP3 pGBT9-EIF4G/ pYX-NSP3 / pGAD424-RoXaN1 pGBT9-EIF4G/ pYX-NSP3 / pGAD424 pGBT9-EIF4G / pYX212 / pGAD424-RoXaN1 pGBT9-EIF4G Eco/ pYX -NSP3/ pGAD424- RoXaN1 Contrôle (-) Contrôle (+) Domaine activateur RoXaN 1 EIF4G 37-176 UAS HIS m88- NSP3 Le système triple-hybride. Liaison RoXaN appartient au complexe eIF4G/NSP3 dans le systéme triple hybride
  • 35. EIF4G Transfection FLAG-RoXaN1 Infection Rotavirus Immunoprécipitation Lysat de cellules infectées Lysat de cellules non infectéesFLAG FLAG FLAG NSP3 NSP3, eIF4G et RoXaN1 co-immunoprécipitent in vivo Western Blot anti-EIF4GI EIF4G NSP3 RoXaN1FLAG EIF4G NSP3 RoXaN1FLAG
  • 36. Introduction Rotavirus L'initiation de la traduction Résultats RoXaN Reconstitution Analyse de la séquence de RoXaN Interaction avec NSP3 Interaction avec eIF4G/NSP3 Interaction avec d'autres protéines Discussion Perspectives Propriétés des TPR Fonction de RoXaN Obtention d'un sérum dirigé contre RoXaN Double-Hybride
  • 37. Crible de RoXaN en double-hybride RoXaN1 Liaison à l'ADN GAL4 GAL4 Domaine activateur p170/ eIF3 TPRde RoXaN Liaison à l'ADN GAL4
  • 38. 1 2 3 4 5 6 7 8 Appât:pGBT9 Proie:GAD424 1 m88NSP3 RoXaN1 2 pGBT9 GAD424 3 TPR GAD-424 4 TPR NSP2 5 TPR p170 6 p170 GAD-424 7 p170 NSP2 8 p170 RoXaN1 le TPR de RoXaN-1 interagit avec la sous/unité p170 de eIF3
  • 39. Introduction Rotavirus L'initiation de la traduction Résultats RoXaN Reconstitution Analyse de la séquence de RoXaN Interaction avec NSP3 Interaction avec eIF4G/NSP3 Interaction avec d'autres protéines Discussion Perspectives Propriétés des TPR Fonction de RoXaN Obtention d'un sérum dirigé contre RoXaN Double-Hybride
  • 40. Les motifs TPR (Tetratricopeptide) Organismes Fonctions diverses Compartiments Bactéries, champignons, plantes, animaux Cytosol, noyau, mitochondries, peroxysomes… Nombre de motifs variables 34 acides aminés Co-chaperons, APC, repression de la transcription transport peroxisomal, mitochondrial… SGT/Protéine NS1 du parvovirus PP5 FKBP52 CDC23
  • 41. Les 3 motifs TPR de la PP5
  • 42. Introduction Rotavirus L'initiation de la traduction Résultats RoXaN Reconstitution Analyse de la séquence de RoXaN Interaction avec NSP3 Interaction avec eIF4G/NSP3 Interaction avec d'autres protéines Discussion Perspectives Propriétés des TPR Fonction de RoXaN Obtention d'un sérum dirigé contre RoXaN Double-Hybride
  • 43. Un homologue de RoXaN chez la drosophile Score = 62.8 bits (150), Expect = 9e-10 Identities = 43/146 (29%), Positives = 69/146 (46%), Gaps = 20/146 (13%) Query: 793 NKILDMQQTYDMWLKKHNPGKPGEGTPISSREGEKQIQMPTDYADIMMGYHCWLCGKNSN 852 +K D+ + KH PG G+G+ S +G++ T C C Sbjct: 243 HKTNDLLAAMKLTAGKHQPGS-GDGS--GSDQGDQAAPSTT----------CSYCTITFQ 289 Query: 853 SKKQWQQHIQSEKHKEKVFTSDSDASGWAFRFP-----MGEFRLCDRLQKGKACPDGDKC 907 ++ + +QH Q+E H +KV SD + W +R P + + LC+ + C G +C Sbjct: 290 TRNELRQHCQTEAH-QKVIMSD-EGRDWKWRPPPRGYTLDTYSLCETFSEAHICHYGAQC 347 Query: 908 RCAHGQEELNEWLDRREVLKQKLAKA 933 AHGQ+ELNEW +R E + ++ KA Sbjct: 348 VEAHGQDELNEWKERFEYRRMRMQKA 373 RoXaN/CG9425
  • 44. Un homologue de RoXaN dans le chromosome 16 humain Query: 69 QVYLRALVRNLFNEGNDVYREHDWNNSISQYTEALNIADYAKSXXXXXXXXXXXXXYINR 128 + +L LV+NLF EGND++RE D+ ++ QY E LN+ADYA S ++N+ Sbjct: 29 EAFLLKLVQNLFAEGNDLFREKDYKQALVQYMEGLNVADYAASDQVALPRELLCKLHVNK 88 Query: 129 IACYSNMGFHDKVLEDCNIVLSLNASNCKALYRKSKALSDLGRYKKAYDAVAKCSLAVPQ 188 ACY MG ++K LED L L++ + +AL+RK++AL++LGR+K+AY+ ++CSLA+P Sbjct: 89 AACYFTMGLYEKALEDSEKALGLDSESIRALFRKARALNELGRHKEAYECSSRCSLALPH 148 Query: 189 DEHVIKLTQELAQKLGFKIRKAYVRAEALNH----------------------SVEDIEP 226 DE V +L QELAQKLG ++RKAY R + L S++DIE Sbjct: 149 DESVTQLGQELAQKLGLRVRKAYKRPQELETFSLLSNGTAAGVADQGTSNGLGSIDDIET 208 Query: 227 DL-LTPRQEAVPVVSLPA-PSFSH--EVGSELASVPVMPLTSILP--------------- 267 D + PR + S P P F H ++ + L S +P T L Sbjct: 209 DCYVDPRGSPALLPSTPTMPLFPHVLDLLAPLDSSRTLPSTDSLDDFSDGDVFGPELDTL 268 Query: 268 -----------------------LQVEESALPSAVLANGGKMPFTMP------EAFLDDG 298 + V P GG +P + P +D Sbjct: 269 LDSLSLVQGGLSGSGVPSELPQLIPVFPGGTPLLPPVVGGSIPVSSPLPPASFGLVMDPS 328 Query: 299 DMVLGDELD---------DLLDSAP--ETNETVMPS-ALVRGPLQ--------------- 331 + LD D LD P ET + S RG L Sbjct: 329 KKLAASVLDALDPPGPTLDPLDLLPYSETRLDALDSFGSTRGSLDKPDSFMEETNSQDHR 388 Query: 332 --------TASVSPSMPFSASLLGTLPIGARYAPPPSFSEFYPPL---------TSSLED 374 S P MP +A L+ P+ A + + YP LE Sbjct: 389 PPSGAQKPAPSPEPCMPNTALLIKN-PLAATHEFKQACQLCYPKTGPRAGDYTYREGLEH 447 Query: 375 FCSS---LNSFSMSESK---------------------RDVAAEEECRYSGHCTFAYCQE 410 C L SE + +D+ +++C+Y +CTFAY QE Sbjct: 448 KCKRDILLGRLRSSEDQTWKRIRPRPTKTSFVGSYYLCKDMINKQDCKYGDNCTFAYHQE 507 Query: 411 EIDVWTLERKGAFSREAFF---GGNGKINLTVFKLLQEHLGEFIFLCEKCFDHKPRMISK 467 EIDVWT ERKG +R+ F GG + +LT+ KLL+EH G F FLCE CFD KPR+ISK Sbjct: 508 EIDVWTEERKGTLNRDLLFDPLGGVKRGSLTIAKLLKEHQGIFTFLCEICFDSKPRIISK 567 Query: 468 RNKDNSTACSHPVTKHEFEDNKCLVHILRETTVKYSKIRSFHGQCQLDLCRHEVRYGCLR 527 KD+ + CS+ KH F +NKCLVHI+R T++KYSKIR F Q D+CRHEVRYGCLR Sbjct: 568 GTKDSPSVCSNLAAKHSFYNNKCLVHIVRSTSLKYSKIRQFQEHFQFDVCRHEVRYGCLR 627 Query: 552 DMEQFYELWLKSQKNEKSEDIASQSNKENGKQIHMPTDYAEVTVDFHCWMCGKNCNSEKQ 611 DM+Q Y++WLK K + S++E KQI MPTDYA++ + +HCW+CGKN NS+KQ Sbjct: 797 DMQQTYDMWLKKHNPGKPGEGTPISSREGEKQIQMPTDYADIMMGYHCWLCGKNSNSKKQ 856 Query: 612 WQGHISSEKHKEKVFHTEDDQYCWQHRFPTGYFSICD 648 WQ HI SEKHKEKVF ++ D W RFP G F +CD Sbjct: 857 WQQHIQSEKHKEKVFTSDSDASGWAFRFPMGEFRLCD 893 RoXaN / AF161540
  • 45. eIF4G 4E PABP AAAAAAAAAAA 4A 40 SeIF3 m7G AUG AAU Rôle de l'eIF3
  • 46. 4G 4E 5'Cap PABP AAAAAAAAAAAA 3' 4G 4E 4G 4E 5'Cap PABP AUG PABP AAAAAAAAAAAA 3' En présence de poly(A) et de coiffe, la PABP et eIF4G stimulent l'initiation de la traduction. La PABP liant le complexe d'initiation en plusieurs endroits. En absence de poly(A), la PABP peut transactiver la traduction coiffe dépendante en interagissant peut-être avec des facteurs de stimulation non identifiés à ce jour. Facteur de stimulation RoXaN ? En absence de coiffe mais en présence de poly(A) eIF4G est capable de lier à la PABP. AUG AUG Facteur de stimulation RoXaN ? Facteur de stimulation RoXaN ? Le Modèle d'Otero & Sachs (1999)
  • 47. Introduction Rotavirus L'initiation de la traduction Résultats RoXaN Reconstitution Analyse de la séquence de RoXaN Interaction avec NSP3 Interaction avec eIF4G/NSP3 Interaction avec d'autres protéines Discussion Perspectives Propriétés des TPR Fonction de RoXaN Obtention d'un sérum dirigé contre RoXaN Double-Hybride
  • 48. Perspectives Purification de RoXaN Rôle de RoXaN Obtention d'un sérum dirigé contre RoXaN Animaux "Knock-out" Effets sur la traduction in vitro Double hybride reverse Homologues de RoXaN / NSP3 LUCUTR UTR
  • 49. Remerciements Didier Poncet, Maria Gajardo, Nathalie Castagne, Patrice Vende, Annie Charpilienne, Jean Cohen. et beaucoup d'autres…

×