Loading...
Flash Player 9 (or above) is needed to view slideshows. We have detected that you do not have it on your computer.To install it, go here
Slideshow Transcript
- Slide 1: BioPerl and Comparative Genomics • BioPerl - toolkit for Bioinformatics data • Fungal comparative genomics
- Slide 2: Overview of Toolkit Bioperl is... A Set of Perl modules for manipulating genomic and other biological data An Open Source Toolkit with many contributors A flexible and extensible system for doing bioinformatics data manipulation
- Slide 3: Some things you can do Read in sequence data from a file in standard formats (FASTA, GenBank, EMBL, SwissProt,...) Manipulate sequences, reverse complement, translate coding DNA sequence to protein. Parse a BLAST report, get access to every bit of data in the report
- Slide 4: Major Domains covered in Bioperl Sequences, Features, Annotations, Pairwise alignment reports Multiple Sequence Alignments Bibliographic data Graphical Rendering of sequence tracks Database for features and sequences
- Slide 5: Additional things Gene prediction parsers Trees, Parsing Phylogenetic and Molecular Evolution software output Population Genetic data and summary statistics Taxonomy Protein Structure
- Slide 6: Practical Examples Manipulate a DNA or Protein Sequence Read and write different Sequence formats Extract sequence annotations and features Parse a BLAST report
- Slide 7: Orienting to the code http://cvs.open-bio.org bioperl-live - Core packages bioperl-run - for running applications bioperl-ext - C language extension bioperl-db - bioperl BioSQL implementation bioperl-pedigree, bioperl-microarray are side-projects
- Slide 8: Website http://bioperl.org or http://bio.perl.org/ HOWTOs Frequently Asked Questions (FAQ) News Links to online Documentation
- Slide 9: Anatomy of a Bioperl Module perldoc Module -- perldoc Bio::SeqIO SYNOPSIS -- runnable code DESCRIPTION -- summary about the module Each module will have annotated functions
- Slide 10: A Tour: Core Objects Bioperl Sequences, Features, Locations, Annotations Sequence searching & pairwise alignments Multiple Sequence Alignments
- Slide 11: Sequences and Features TSS Feature PolyA site Exon Features Sequence Genomic Sequence with 3 exons 1 Transcript Start Site (TSS) 1 Poly-A Site
- Slide 12: Sequences, Features, and Annotations Sequence - DNA, RNA, AA Feature container Feature - Information with a Sequence Location Annotation - Information without explicit Sequence location
- Slide 13: Parsing Sequences Bio::SeqIO multiple drivers: genbank, embl, fasta,... Sequence objects Bio::PrimarySeq Bio::Seq Bio::Seq::RichSeq
- Slide 14: Look at the Sequence object Common (Bio::PrimarySeq) methods seq() - get the sequence as a string length() - get the sequence length subseq($s,$e) - get a subseqeunce translate(...) - translate to protein [DNA] revcom() - reverse complement [DNA] display_id() - identifier string description() - description string
- Slide 15: Using a Sequence my $str = “ATGAATGATGAA”; my $seq = Bio::PrimarySeq->new(-seq => $str, -display_id=>”example”); print “id is “, $seq->display_id,” ”; print $seq->seq, “ ”; my $revcom = $seq->revcom; print $revcom->seq, “ ”; print “frame1=”,$seq->translate->seq,“ ”; id is example ATGAATGATGAA TTCATCATTCAT trans frame1=MNDE
- Slide 16: Sequence Features Bio::SeqFeatureI - interface - GFF derived start(), end(), strand() for location information location() - Bio::LocationI object (to represent complex locations) score,frame,primary_tag, source_tag - feature information spliced_seq() - for attached sequence, get the sequence spliced.
- Slide 17: http://www.sanger.ac.uk/Software/formats/ GFF/GFF_Spec.shtml
- Slide 18: has-a Bio::Annotation::Collection Bio::Seq Annotations Features has-a has-a Bio::SeqFeature::Generic Bio::Annotation::Comment has-a Bio::LocationI
- Slide 19: Reading and Writing Sequences Bio::SeqIO fasta, genbank, embl, swissprot,... Takes care of writing out associated features and annotations Two functions next_seq (reading sequences) write_seq (writing sequences)
- Slide 20: Writing a Sequence use Bio::SeqIO; # Let’s convert swissprot to fasta format my $in = Bio::SeqIO->new(-format => ‘swiss’, -file => ‘file.sp’); my $out = Bio::SeqIO->new(-format => ‘fasta’, -file => ‘>file.fa’);` while( my $seq = $in->next_seq ) { $out->write_seq($seq); }
- Slide 21: v Mon Nov 17 12:38:43 2003 1 opt E() < 20 323 0:== 22 0 0: one = represents 184 library sequences 24 2 0:= 26 12 2:* 28 61 26:* 30 211 157:*= 32 664 607:===* 34 1779 1645:========*= 36 3558 3379:==================*= 38 5908 5584:==============================*== 40 8049 7790:==========================================*= 42 10001 9522:===================================================*=== 44 10660 10503:=========================================================* 46 10987 10698:==========================================================*= 48 10332 10242:=======================================================*= 50 9053 9346:==================================================* 52 7736 8217:=========================================== * 54 6828 7018:======================================* 56 5448 5863:============================== * 58 4484 4813:========================= * 60 3818 3899:=====================* Sequence Database 62 2942 3126:================* 64 2407 2486:=============* 66 1866 1965:==========* 68 1495 1545:========* 70 1169 1211:======* 72 886 946:=====* 74 708 738:====* 76 542 574:===* Searching 78 451 446:==* 80 355 347:=* 82 271 265:=* 84 211 210:=* 86 151 163:* 88 104 126:* inset = represents 3 library sequences 90 101 97:* 92 78 75:* :========================*= 94 56 58:* :===================* 96 38 45:* :============= * 98 26 35:* :========= * 100 26 27:* :========* 102 20 21:* :======* 104 13 16:* :=====* 106 22 12:* :===*==== 108 10 10:* :===* 110 5 7:* :==* 112 4 6:* :=* 114 4 4:* :=* 116 3 3:* :* 118 9 3:* :*== >120 110 2:* :*====================================
- Slide 22: A Detailed look at BLAST parsing 3 Components Result: Bio::Search::Result::ResultI Hit: Bio::Search::Hit::HitI HSP: Bio::Search::HSP::HSPI
- Slide 23: use Bio::SearchIO; my $cutoff = ’0.001’; my $file = ‘BOSS_Ce.BLASTP’, my $in = new Bio::SearchIO(-format => ‘blast’, -file => $file); while( my $r = $in->next_result ) { print "Query is: ", $r->query_name, " ", $r->query_description," ",$r->query_length," aa "; print " Matrix was ", $r->get_parameter(’matrix’), " "; while( my $h = $r->next_hit ) { last if $h->significance > $cutoff; print "Hit is ", $h->name, " "; while( my $hsp = $h->next_hsp ) { print " HSP Len is ", $hsp->length(’total’), " ", " E-value is ", $hsp->evalue, " Bit score ", $hsp->score, " ", " Query loc: ",$hsp->query->start, " ", $hsp->query->end," ", " Sbject loc: ",$hsp->hit->start, " ", $hsp->hit->end," "; } } }
- Slide 24: BLAST Report Copyright (C) 1996-2000 Washington University, Saint Louis, Missouri USA. All Rights Reserved. Reference: Gish, W. (1996-2000) http://blast.wustl.edu Query= BOSS_DROME Bride of sevenless protein precursor. (896 letters) Database: wormpep87 20,881 sequences; 9,238,759 total letters. Searching....10....20....30....40....50....60....70....80....90....100% done Smallest Sum High Probability Sequences producing High-scoring Segment Pairs: Score P(N) N F35H10.10 CE24945 status:Partially_confirmed TR:Q20073... 182 4.9e-11 1 M02H5.2 CE25951 status:Predicted TR:Q966H5 protein_id:... 86 0.15 1 ZC506.4 CE01682 locus:mgl-1 metatrophic glutamate recept... 91 0.18 1 F23D12.2 CE05700 status:Partially_confirmed TR:Q19761 ... 73 0.45 3 >F35H10.10 CE24945 status:Partially_confirmed TR:Q20073 protein_id:AAA81683.2 Length = 1404 Score = 182 (69.1 bits), Expect = 4.9e-11, P = 4.9e-11 Identities = 75/315 (23%), Positives = 149/315 (47%) Query: 511 YPFLFDGESVMFWRIKMDTWVATGLTAAILGLIATLAILVFIVVRISLGDVFEGNPTTSI 570 Y +F+ + WR +V L ++ + +A+LV ++V++ L V +GN + I Sbjct: 1006 YQSVFEHITTGHWRDHPHNYVLLALITVLV--VVAIAVLVLVLVKLYLR-VVKGNQSLGI 1062
- Slide 25: BLAST Script Results Query is: BOSS_DROME Bride of sevenless protein precursor. 896 aa Matrix was BLOSUM62 Hit is F35H10.10 HSP Len is 315 E-value is 4.9e-11 Bit score 182 Query loc: 511 813 Sbject loc: 1006 1298 HSP Len is 28 E-value is 1.4e-09 Bit score 39 Query loc: 508 535 Sbject loc: 427 454
- Slide 26: FASTA Parsing Script use Bio::SearchIO; my $cutoff = ’0.001; my $file = ‘BOSS_Ce.FASTP’, my $in = new Bio::SearchIO(-format => ‘fasta’, -file => $file); while( my $r = $in->next_result ) { print "Query is: ", $r->query_name, " ", $r->query_description," ",$r->query_length," aa "; print " Matrix was ", $r->get_parameter(’matrix’), " "; while( my $h = $r->next_hit ) { last if $h->significance > $cutoff; print "Hit is ", $h->name, " "; while( my $hsp = $h->next_hsp ) { print " HSP Len is ", $hsp->length(’total’), " ", " E-value is ", $hsp->evalue, " Bit score ", $hsp->score, " ", " Query loc: ",$hsp->query->start, " ", $hsp->query->end," ", " Sbject loc: ",$hsp->hit->start, " ", $hsp->hit->end," "; } } }
- Slide 27: FASTA Report FASTA searches a protein or DNA sequence data bank version 3.4t20 Sep 26, 2002 Please cite: W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448 Query library BOSS_DROME.aa vs /blast/wormpep87 library searching /blast/wormpep87 library 1>>>BOSS_DROME Bride of sevenless protein precursor. - 896 aa vs /blast/wormpep87 library 9238759 residues in 20881 sequences Expectation_n fit: rho(ln(x))= 5.6098+/-0.000519; mu= 12.8177+/- 0.030 mean_var=107.8223+/-22.869, 0's: 0 Z-trim: 2 B-trim: 0 in 0/62 Lambda= 0.123515 Kolmogorov-Smirnov statistic: 0.0333 (N=29) at 48 FASTA (3.45 Mar 2002) function [optimized, BL50 matrix (15:-5)] ktup: 2 join: 38, opt: 26, gap-pen: -12/-2, width: 16 Scan time: 9.680 The best scores are: opt bits E(20881) F35H10.10 CE24945 status:Partially_confirmed T (1404) 207 48.5 6.8e-05 T06E4.11 CE06377 locus:pqn-63 status:Predicted ( 275) 122 32.6 0.8 C33B4.3 CE01508 ankyrin and proline rich domain (1110) 124 33.6 1.6 Y48C3A.8 CE22141 status:Predicted TR:Q9NAG3 pr ( 291) 110 30.5 3.7 Y34D9A.2 CE30217 status:Partially_confirmed TR ( 326) 108 30.2 5.1 K06H7.3 CE26941 Isopentenyl-diphosphate delta i ( 618) 107 30.3 8.9 F44B9.8 CE29044 ARPA status:Partially_confirmed ( 388) 104 29.5 9.4 >>F35H10.10 CE24945 status:Partially_confirmed TR:Q20 (1404 aa) initn: 94 init1: 94 opt: 207 Z-score: 197.9 bits: 48.5 E(): 6.8e-05 Smith-Waterman score: 275; 22.527% identity (27.152% ungapped) in 728 aa overlap (207-847:640-1330) 180 190 200 210 220 230 BOSS_D RAISIDNASLAENLLIQEVQFLQQCTTYSMGIFVDWELYKQLESVIKD---LEYNIWPIP
- Slide 28: FASTA Script Results Query is: BOSS_DROME Bride of sevenless protein precursor. 896 aa Matrix was BL50 Hit is F35H10.10 HSP Len is 728 E-value is 6.8e-05 Bit score 197.9 Query loc: 207 847 Sbject loc: 640 1330
- Slide 29: Using the Search::Result object use Bio::SearchIO; use strict; my $parser = new Bio::SearchIO(-format => ‘blast’, -file => ‘file.bls’); while( my $result = $parser->next_result ){ print “query name=“, $result->query_name, “ desc=”, $result->query_description, “, len=”,$result- >query_length,“ ”; print “algorithm=“, $result->algorithm, “ ”; print “db name=”, $result->database_name, “ #lets=”, $result->database_letters, “ #seqs=”,$result- >database_entries, “ ”; print “available params “, join(’,’, $result->available_parameters),” ”; print “available stats “, join(’,’, $result->available_statistics), “ ”; print “num of hits “, $result->num_hits, “ ”; }
- Slide 30: Using the Search::Hit Object use Bio::SearchIO; use strict; my $parser = new Bio::SearchIO(-format => ‘blast’, -file => ‘file.bls’); while( my $result = $parser->next_result ){ while( my $hit = $result->next_hit ) { print “hit name=”,$hit->name, “ desc=”, $hit->description, “ len=”, $hit->length, “ acc=”, $hit->accession, ” ”; print “raw score “, $hit->raw_score, “ bits “, $hit->bits, “ significance/evalue=“, $hit->evalue, “ ”; } }
- Slide 31: Cool Hit Methods start(), end() - get overall alignment start and end for all HSPs strand() - get best overall alignment strand matches() - get total number of matches across entire set of HSPs (can specify only exact ‘id’ or conservative ‘cons’)
- Slide 32: Using the Search::HSP Object use Bio::SearchIO; use strict; my $parser = new Bio::SearchIO(-format => ‘blast’, -file => ‘file.bls’); while( my $result = $parser->next_result ){ while( my $hit = $result->next_hit ) { while( my $hsp = $hit->next_hsp ) { print “hsp evalue=“, $hsp->evalue, “ score=“ $hsp->score, “ ”; print “total length=“, $hsp->hsp_length, “ qlen=”, $hsp->query->length, “ hlen=”,$hsp->hit->length, “ ”; print “qstart=”,$hsp->query->start, “ qend=”,$hsp->query->end, “ qstrand=“, $hsp->query->strand, “ ”; print “hstart=”,$hsp->hit->start, “ hend=”,$hsp->hit->end, “ hstrand=“, $hsp->hit->strand, “ ”; print “percent identical “, $hsp->percent_identity, “ frac conserved “, $hsp->frac_conserved(), “ ”; print “num query gaps “, $hsp->gaps(’query’), “ ”; print “hit str =”, $hsp->hit_string, “ ”; print “query str =”, $hsp->query_string, “ ”; print “homolog str=”, $hsp->homology_string, “ ”; } }
- Slide 33: Cool HSP methods rank() - order in the alignment (which you could have requested, by score, size) matches - overall number of matches seq_inds - get a list of numbers representing residue positions which are conserved, identical, mismatches, gaps
- Slide 34: SearchIO system BLAST (WU-BLAST, NCBI, XML, PSIBLAST, BL2SEQ, MEGABLAST, TABULAR (-m8/m9)) FASTA (m9 and m0) HMMER (hmmpfam, hmmsearch) UCSC formats (WABA, AXT, PSL) Gene based alignments Exonerate, SIM4, {Gene,Genome}wise
- Slide 35: SearchIO reformatting Supports output of Search reports as well Bio::SearchIO::Writer “BLAST flavor” HTML, Text Tabular Report Format
- Slide 36: Bioperl Reformatted HTML of BLASTP Search Report for gi|6319512|ref|NP_009594.1| BLASTP 2.0MP-WashU [04-Feb-2003] [linux24-i686-ILP32F64 2003-02-04T19:05:09] Copyright (C) 1996-2000 Washington University, Saint Louis, Missouri USA. All Rights Reserved. Reference: Gish, W. (1996-2000) http://blast.wustl.edu Hit Overview Score: Red= (>=200), Purple 200-80, Green 80-50, Blue 50-40, Black <40 Build custom overview (Bio::Graphics) Query= gi|6319512|ref|NP_009594.1| chitin synthase 2; Chs2p [Saccharomyces cerevisiae] (963 letters) Database: cneoA_WI.aa 9,645 sequences; 2,832,832 total letters Hyperlink to external Score E resources Sequences producing significant alignments: (bits) value cneo_WIH99_157.Gene2 Start=295 End=4301 Strand=1 Length=912 ExonCt=24 1650 1.6e-173 cneo_WIH99_63.Gene181 Start=154896 End=151527 Strand=-1 Length=876 ExonCt=13 1441 3.9e-149 Hyperlink to cneo_WIH99_133.Gene1 Start=15489 End=19943 Strand=1 Length=1017 ExonCt=23 1357 3e-142 alignment part cneo_WIH99_45.Gene2 Start=84 End=3840 Strand=1 Length=839 ExonCt=25 1311 1.5e-138 of report cneo_WIH99_112.Gene165 Start=122440 End=118921 Strand=-1 Length=1036 ExonCt=9 198 1.2e-15 cneo_WIH99_11.Gene7 Start=39355 End=42071 Strand=1 Length=761 ExonCt=9 172 6.4e-13 cneo_WIH99_60.Gene9 Start=36153 End=32819 Strand=-1 Length=1020 ExonCt=5 166 1.2e-12 cneo_WIH99_106.Gene88 Start=242538 End=238790 Strand=-1 Length=1224 ExonCt=3 157 6.3e-09
- Slide 38: Turning BLAST into HTML use Bio::SearchIO; use Bio::SearchIO::Writer::HTMLResultWriter; my $in = new Bio::SearchIO(-format => 'blast', -file => shift @ARGV); my $writer = new Bio::SearchIO::Writer::HTMLResultWriter(); my $out = new Bio::SearchIO(-writer => $writer -file => “>file.html”); $out->write_result($in->next_result);
- Slide 39: Turning BLAST into HTML # to filter your output my $MinLength = 100; # need a variable with scope outside the method sub hsp_filter { my $hsp = shift; return 1 if $hsp->length('total') > $MinLength; } sub result_filter { my $result = shift; return $hsp->num_hits > 0; } my $writer = new Bio::SearchIO::Writer::HTMLResultWriter (-filters => { 'HSP' => &hsp_filter} ); my $out = new Bio::SearchIO(-writer => $writer); $out->write_result($in->next_result); # can also set the filter via the writer object $writer->filter('RESULT', &result_filter);
- Slide 40: Trees • Support reading of Tree data • newick, nexus, nhx formats • Manipulation of Trees • Trees are connections of Nodes which have ancestor and children pointers 40
- Slide 41: Simple Tree Routines LCA • Lowest Common Ancestor • Tests of monophyly, paraphyly outgroup • Reroot tree • Distances between two nodes • Find a node by name 41
- Slide 42: Constructing Trees • For Purely Bioperl Solution (only in post Bioperl 1.4 releases) • Bio::Align::DNAStatistics and ProteinStatistics can build pairwise distance matricies • Bio::Tree::DistanceFactory has UPGMA, Neighbor-Joining implemented 42
- Slide 43: Interfacing with Phylip • Bio::Tools::Run::Phylo::Phylip • ProtDist (also parser Bio::Matrix::IO) • Neighbor, ProtPars, SeqBoot, Consense • DrawGram, DrawTree 43
- Slide 44: Reading/Writing a Tree #!/usr/bin/perl -w use Bio::TreeIO; use strict; my $in = Bio::TreeIO->new(-format => ‘nexus’, -file => ‘trees.nex’); my $out = Bio::TreeIO->new(-format => ‘newick’, -file => ‘>trees.nh’); while( my $tree = $in->next_tree ) { $out->write_tree($tree); } 44
- Slide 45: Fetching subset of nodes #!/usr/bin/perl -w use strict; use Bio::TreeIO; my $in = Bio::TreeIO->new(-format => ‘newick’, -fh => *DATA); if( my $tree = $in->next_tree ) { my @nodes = $tree->get_nodes; my @tips = grep { $_->is_Leaf } @nodes; print "there are ",scalar @tips, " tips "; my @internal = grep { ! $_->is_Leaf } @nodes; print "there are ",scalar @internal, " internal nodes "; my ($A_node) = $tree->find_node(-id => 'A'); print "branch length of Ancestor of ",$A_node->id, " is ", $A_node->ancestor->branch_length, " "; } __DATA__ (((A:10,B:11):2,C:5),((D:7,F:6):17,G:8)); 45
- Slide 46: Walking up the tree (tips to root) if( my $tree = $in->next_tree ) { my @tips = grep { $_->is_Leaf } $tree->get_nodes; for my $node ( @tips ) { my @path; while( defined $node) { push @path, $node->id; $node = $node->ancestor; } print join(“,“, @path), “ ”; } } __DATA__ (((A:10,B:11)I1:2,C:5)I2,((D:7,F:6)I3:17,G:8)I4)Root; A I1 C,I2,Root B I2 A,I1,I2,Root C B,I1,I2,Root Root G,I4,Root D I3 D,I3,I4,Root F I4 F,I3,I4,Root 46 G
- Slide 47: From Alignments to Trees • Bio::AlignIO to parse the alignment • Bio::Align::ProteinStatistics to compute pairwise distances • Bio::Tree::DistanceFactory to build a tree based on a matrix of distances using NJ or UPGMA • More sophisticated tree building should be done with tools like phyml, PAUP, MOLPHY, PHYLIP, MrBayes, or PUZZLE 47
- Slide 48: Testing phylogenetic hypotheses • No sophisticated ML methods are currently built in Bioperl for testing for phylogenetic correlations, etc • Can export trees and use tools like Mesquite 48
- Slide 49: Bioperl & Population Genetics • Basic data • Marker - polymorphic region of genome • Individual - individual sampled • Genotype - observed allele(s) for a marker in an individual • Population - collection of individuals 49
- Slide 50: The Players • Bio::PopGen::Population - container for Individuals, calculate summary stats • Bio::PopGen::Individual - container for Genotypes • Bio::PopGen::Marker - summary info about a Marker (primers, genome loc, allele freq) • Bio::PopGen::Genotype - pairing of Individual & Marker; allele container 50
- Slide 51: Population Genetics Data Objects Population Has Map Individual Has Has Marker Genotype Has 51
- Slide 52: Some Data Formats • PrettyBase format (Seattle SNP data) MARKER SAMPLEID ALLELE1 ALLELE2 ProcR2973EA 01 C T ProcR2973EA 02 N N ProcR2973EA 03 C C ProcR2973EA 04 C T ProcR2973EA 05 C C • Comma Delimited (CSV) SAMPLE,MARKERNAME1,MARKERNAME2,... SAMPLE,ProcR2973EA,Marker2 sample-01,C T,G T sample-02,C C,G G • Phase format 3 5 P 300 1313 1500 2023 5635 MSSSM #1 12 1 0 1 3 52 11 0 1 0 3
- Slide 53: Reading in Data use Bio::PopGen::IO; my $in = Bio::PopGen::IO->new(-format => ‘csv’ -file => ‘dat.csv’); my @pop; while( my $ind = $in->next_individual ) { push @pop, $ind; } # OR my $pop = $in->next_population; 53
- Slide 54: Ready Built Stuff • Bio::PopGen::PopStats - population level statistics (only FST currently) • Bio::PopGen::Statistics - suite of Population Genetics statistical tests and summary stats. • Bio::PopGen::Simulation::Coalescent - primitive Coalescent simulation • Basic tree topology and branch length assignment. 54
- Slide 55: Using the Modules use Bio::PopGen::Statistics; my $stats = Bio::PopGen::Statistics->new(); my $pi = $stats->pi($population); # or use an array reference of Individuals my $pi = $stats->pi(@individuals); # Tajima’s D my $TajimaD = $stats->tajima_D($population); # Fu and Li’s D my $FuLiD = $stats->fu_and_li_D($ingroup_pop, $outgroup_ind); # Fu and Li’s D* my $FLDstar = $stats->fu_and_li_D_star($population); # pairwise composite LD my %LDstats = $stats->composite_LD($population); my $LDarray = $LDstats{’marker1’}->{’marker2’}; my ($ldval,$chisq) = @$LDarray; 55
- Slide 56: Getting Data from Alignments • use Bio::AlignIO to read in Multiple Sequence Alignment data • Bio::PopGen::Utilities aln_to_population will build Population from MSA • Will make a “Marker” for every polymorphic site (or if asked every site) • Eventually will have ability to only get silent/non-silent coding sites 56
- Slide 57: Simulations • Simulation::Coalescent (Hudson 1990) • Generate random topology • Assign mutations to branches • Tree tips are AlleleNodes (Tree::Node & PopGen::Individual) 57
- Slide 58: Coalescent Simulation use Bio::PopGen::Simulation::Coalescent; my $factory = new Bio::PopGen::Simulation::Coalescent( -sample_size => 10, -maxcount => 100); # max number trees my $tree = $factory->next_tree; $factory->add_Mutations($tree,20); my @inds = $tree->get_leaf_nodes; use Bio::PopGen::Statistics; my $pi = Bio::PopGen::Statistics->pi(@inds); my $D = Bio::PopGen::Statistics-> tajima_D (@inds); 58
- Slide 59: Scripts scripts/popgen/composite_LD -i filename.prettybase [-o outfile.LD] [--format prettybase/csv] [--sortbyld] [--noconvertindels] ProcR2973EA 01 C T ProcR2973EA 02 N N ProcR2973EA 03 C C ProcR2973EA 04 C T ProcR2973EA 05 C C ProcR2973EA 06 C T ProcR2973EA 07 C C ProC9198EA,ProcR2973EA - LD=-0.0375, chisq=2.56 59
- Slide 60: Simple pairwise Ka, Ks rates estimation • Within Bioperl can calculate pairwise K ,K a s and Ka/Ks using Nei’s method. • Bio::Align::DNAStatistics • calc_KaKs_pair($alnobj,$seq1id,$seq2id) calc_all_KaKs_pairs($alnobj) 60
- Slide 61: Ortholog/Homolog finding • Doesn’t really require much of Bioperl to do this • Want to find best reciprocal BLAST/ FASTA/SSEARCH hits • Build up a matrix, where each query sequence has a list of its best hits 61
- Slide 62: my $reportfile = ‘/usr/local/bio/data/reports/fly_worm.FASTA.m9.gz’; open(IN,”zcat $reportfile |”) || die $!; my %data; while(<IN>) { my @line = split; my ($query,$subject,$pid,$alnlen) = @line; my ($evalue) = $line[10]; next if $query eq $subject; push @{$data{$query}}, [$subject, $evalue,$pid,$alnlen]; } my %seen; my %orthologs; # some tracking and data vars for my $q ( keys %data ) { next if $seen{$q}++; # skip if we’ve processed it already my ($s, $evalue,$pid,$alnlen) = @{$data{$q}->[0]}; my ($qsp) = split(/:/,$q); my ($ssp) = split(/:/,$s); $seen{$s}++; next if( $qsp eq $ssp || $pid < 30 || (defined $data{$q}->[1] && 1e-10 < abs($data{$q}->[1]->[1] - $evalue) ) ); # second best hit # is too good if( $data{$s}->[0]->[0] eq $q ) { my $id = join(”-”, sort ($qsp,$ssp)); push @{$orthologs{$id}}, [$q,$s,$evalue,$pid,$alnlen]; } } 62
- Slide 63: # print out the ortholog pairs, do some sorting to insure that # order of names is consistent and order by evalue for my $id ( keys %orthologs ) { open(OUT, “>$id.orthologs”) || die $!; for my $pair ( sort {$a->[2] <=> $b->[2] } @{$orthologs{$id}} ) { my ($q,$s,$evalue,$pid,$alnlen) = @$pair; ($q,$s) = sort ( $q, $s ); # assume prefixed print OUT join(” ”, ($q,$s,$evalue,$pid,$alnlen)), “ ”; } } 63
- Slide 64: Gene families • Families can be constructed with single- linkage - merging all homologs into a single cluster • Or using a tool like MCL (http://micans.org/ mcl) to build gene families from a matrix of pairwise distances (BLAST or FASTA scores) 64
- Slide 65: Automating PAML • PAML - phylogenetic analysis with maximum likelihood • Estimate synonymous and non-synonymous substitution rates • Along branches of a tree or in a pairwise fashion 65
- Slide 66: Preparing Data • Multiple sequence alignments of protein coding sequence • No stop codons! • Must be aligned on codon boundaries • Easiest way is to align at protein level, then project back into CDS alignment 66
- Slide 67: Doing Protein Alignments • Bio::Tools::Run::Alignment::Clustalw or Bio::Tools::Run::Alignment::MUSCLE or just prepare the sequence files and run the alignment programs via scripts • Bio::AlignIO to parse the alignment data • Bio::Align::Utilities to project back into CDS space 67
- Slide 68: Build tree or assume a tree • If doing analysis of genomes which have a know species tree - use that tree • Branch lengths are not part of PAML. Multiple topologies can be provided to test alternative hypotheses (by comparing maximum likelihood values) 68
- Slide 69: Running PAML #!/usr/bin/perl -w use strict; use Bio::Tools::Run::Phylo::PAML::Codeml; use Bio::AlignIO; my $factory = Bio::Tools::Run::Phylo::PAML::Codeml->new( -params => { ‘runmode’ => -2, ‘seqtype’ => 1}); my $alnio = Bio::AlignIO->new(-format => ‘clustalw’, -file => ‘cds.aln’); my $aln = $alnio->next_aln; # get the alignment from file $factory->alignment($aln); # set the alignment my ($returncode,$parser) = $factory->run(); my $result = $parser->next_result; my $MLmatrix = $result->get_MLMatrix; print "Ka = ", $MLmatrix->[0]->[1]->{’dN’}," "; print "Ks = ", $MLmatrix->[0]->[1]->{’dS’}," "; print "Ka/Ks = ", $MLmatrix->[0]->[1]->{’omega’}," "; 69
- Slide 70: Parsing PAML #!/usr/bin/perl -w use strict; use Bio::Tools::Phylo::PAML; my $parser = Bio::Tools::Phylo::PAML->new (-file => ‘results/mlc’, -dir => ‘results’); if( my $result = $parser->next_result ) { my @otus = $result->get_seqs; # get Nei & Gojobori dN/dS matrix my $NGmatrix = $result->get_NGmatrix; printf “%s and %s dS=%.4f dN=%.4f Omega=%.4f ”, $otus[0]->display_id, $otus[1]->display_id, $NGMatrix->[0]->[1]->{dS}, $NGMatrix->[0]->[1]->{dN}, $NGMatrix->[0]->[1]->{omega}; } 70
- Slide 71: Getting the Trees out my @trees = $result->get_trees; for my $tree ( @trees ) { print “likelihood is “, $tree->score, “ ”; # do something else with the trees, # for non runmode -2 results # inspect the tree, branch specific rates # the "t" (time) parameter is available via # ("omega", "dN", etc.) are available via # ($omega) = $node->get_tag_values('omega'); for my $node ( $tree->get_nodes ) { print $node->id, “ t=”,$node->branch_length, “ omega “, $node->get_tag_values(‘omega’); } } 71
- Slide 72: Summary Lots of modules to do lots of things How to find out what exists? Read HOWTOs, bptutorial, Browse the docs website - http://doc.bioperl.org/ Ask on-list bioperl-l@bioperl.org
- Slide 73: Fungal Genomics • ~45 fungal genomes currently sequenced • 5-10 more in production at sequencing centers • Diverse sampling across the fungal tree • Clusters of closely related species • Cryptococcus, Aspergillus, Saccharomyces, Candida
- Slide 74: Genome Annotation Pipeline Rfam tRNAscan ZFF to GFF3 GFF to AA SNAP FASTA predicted Proteins proteins Twinscan all-vs-all GFF2 to GFF3 Bio::DB::GFF Tools::Glimmer Glimmer SearchIO protein to Genscan Genome genome Tools::Genscan coordinates homologs HMMER MCL SearchIO SearchIO and BLASTZ orthologs BLASTN Tools::GFF GLEAN GFF2 to GFF3 exonerate (combiner) Proteins Gene protein2genome families exonerate ESTs est2genome BOSC 2005
- Slide 75: Genome Browsing BOSC 2005
- Slide 76: Comparative Genomics • Find orthologs, align, build trees • Assess gene structure among orthologs • Find gene families • Assess gene structure • Copy number among genomes BOSC 2005
- Slide 77: Comparative Genomics: Gene Structure Species phylogeny Bio::Tree/TreeIO Bio::DB Bio::AignIO Bio::SimpleAlign Bio::SeqIO MUSCLE Alignments Score shared orthologs Bio::Coordinate with Introns intorn positions on Tree BOSC 2005
- Slide 78: Phylogenomics Species phylogeny Bio::TreeIO gene MrBayes families Bio::DB PhyML Classify tree Bio::SeqIO Bio::AignIO MUSCLE differences ProtML PUZZLE Bin genes by orthologs topology BOSC 2005
- Slide 79: Arabidopsis thaliana Dictyostelium discoideum Rhizopus oryzae Ustilago maydis Basidiomycota Cryptococcus neoformans Cryptococcus neoformans Cryptococcus neoformans Cryptococcus neoformans Coprinus cinereus Phanerochaete chrysosporium Schizosaccharomyces pombe Fungi Sclerotinia sclerotiorum Ascomycota Botrytis cinerea Magnaporthe grisea Sordiomycota Neurospora crassa Podospora anserina Chaetomium globosum Trichoderma reesi Euasco Fusarium verticillioides Fusarium graminearum Stagonospora nodorum Aspergillus terreus Aspgergillus Aspergillus nidulans Aspergillus fumigatus Eurotiomycota Histoplasma capsulatum Onygenales Coccidioides immitis Uncinocarpus reesii Yarrowia lipolytica Kluyveromyces lactis Ashbya gossypii Hemiascomycota Opistikant Candida glabrata Saccharomyces castellii Saccharomyces bayanus Saccharomyces kudriavzevii Saccharomyces mikatae Saccharomyces paradoxus Saccharomyces cerevisiae Saccharomyces Complex Saccharomyces cerevisiae Saccharomyces cerevisiae Saccharomyces kluyveri Kluyveromyces waltii Candida tropicalis Candida albicans Candida dubliniensis Candida guilliermondii Debaryomyces hansenii Candida lusitaniae Caenorhabdtis elegans Nematoda Caenorhabdtis briggsae Apis mellifera Metazoa Insecta Drosophila melanogaster Coelomata... Diptera Anopholes gambiae Ciona intestinalis Xenopus tropicalis Vertebrate Danio rerio Fish Fugu rubripes Tetraodon nigroviridis Gallus gallus Canis familiaris Mammalia Rattus norvegicus Rodenta Mus musculus PrimateRodent Homo sapiens Primate Pan troglodytes
- Slide 80: Rhizopus oryzae Ustilago maydis Basidiomycota Cryptococcus neoformans Cryptococcus neoformans Cryptococcus neoformans Cryptococcus neoformans Coprinus cinereus Phanerochaete chrysosporium Schizosaccharomyces pombe Fungi Sclerotinia sclerotiorum Ascomycota Botrytis cinerea Magnaporthe grisea Sordiomycota Neurospora crassa Podospora anserina Chaetomium globosum Trichoderma reesi Euasco Fusarium verticillioides Fusarium graminearum Stagonospora nodorum Aspergillus terreus Aspgergillus Aspergillus nidulans Aspergillus fumigatus Eurotiomycota Histoplasma capsulatum Onygenales Coccidioides immitis Uncinocarpus reesii Yarrowia lipolytica Kluyveromyces lactis Ashbya gossypii Hemiascomycota Opistikant Candida glabrata Saccharomyces castellii Saccharomyces bayanus Saccharomyces kudriavzevii Saccharomyces mikatae Saccharomyces paradoxus Saccharomyces cerevisiae Saccharomyces Complex Saccharomyces cerevisiae Saccharomyces cerevisiae Saccharomyces kluyveri Kluyveromyces waltii Candida tropicalis Candida albicans Candida dubliniensis Candida guilliermondii Debaryomyces hansenii Candida lusitaniae
- Slide 81: Consensus Splice Site Exon Exon AG GT G H.sapiens exon|intron H.sapiens intron|exon 2 2 C bits bits 1 1 A A T T G A G G T C A C G T C T T T 0 0 C A A T G T C C A C G A G C -2 -1 0 1 2 3 4 5 -5 -4 -3 -2 -1 0 1 5′ 3′ 5′ GTATGT AG weblogo.berkeley.edu weblogo.berkele S.cerevisiae exon|intron 2 S.cerevisiae intron|exon 2 bits 1 bits 1 T A C C A T 0 G T A A A G C C A -2 -1 0 1 2 3 4 5 T 0 G C 5′ 3′ A C -5 -4 -3 -2 -1 0 1 5′ GT G AG weblogo.berkeley.edu weblogo.berkele F.graminearium exon|intron F.graminearium intron|exon 2 2 bits bits 1 1 AA T C T GT A T G T 0 0 C C A C T C A A C T A G C A G -2 -1 0 1 2 3 4 5 -5 -4 -3 -2 -1 0 1 5′ 3′ 5′ AG GT G weblogo.berkeley.edu weblogo.berkele C.neoformans exon|intron C.neoformans intron|exon 2 2 bits bits 1 1 T T AA C G C G C T 0 0 TT T A A A C A G G C C A -2 -1 0 1 2 3 4 5 -5 -4 -3 -2 -1 0 1 5′ 3′ 5′ weblogo.berkeley.edu weblogo.berkele
- Slide 82: 2290 Arabidopsis thaliana 2685 Fugu rubripes 2746 2656 Mus musculus 6699 2767 2772 - 2772 2735 Homo sapiens 2748 803.6 2769 947 Rhizopus oryzae 1498 2109 1648 86 Ustilago maydis 2428 1490 2064 Cryptococcus neoformans 1578 1614 958.6 1615 Phanerochaete chrysosporium 1781 1519.9 1621 Coprinopsis cinerea 1605 214 Schizosaccharomyces pombe 1507 372 Fusarium graminearum 1803 349.7 1492 368 Magnaporthe grisea Podospora anserina 339.4 359 378.6 463 Chaetomium globosum 1128 513 1803 388.4 336 Neurospora crassa 640 1141 509 403 Stagonospora nodorum Aspergillus nidulans 469 410.2 630 481 Aspergillus fumigatus 474.0 1184 476.0 474 Aspergillus terreus 972 30 Yarrowia lipolytica 5 Debaryomyces hansenii 27 29 Saccharomyces cerevisiae 7 7 28 7 6 Candida glabrata 7 6 Kluyveromyces lactis 7/6 7 Ashbya gossypii 0.1
- Slide 83: Intron loss • If loss predominates, how are introns lost? • Fink (1987) model proposes mRNA integration into genome. • Boeke et al (1985) showed loss intron through RNA intermediate which is integrated into genome. • Large scale comparisons are too far awy to determine recent loss events.
- Slide 84: Searching for Intron loss in C. neoformans • Average of 5 introns per gene (Loftus et al, 2005) • A Average Ks between var. grubii and var. gattii 0.22 D (roughly mouse-rat B/C divergence), C. gattii vs C. neoformans Ks is 0.35 • 5133 4-way orthologs
- Slide 85: Loss/gain events observed • 25 out of the 5133 loci had loss or gain events. • 2 had evidence 4 or more intron loss/gain events. • CNI01550, putative RNA helicase missing 10 introns in var grubii (serotype A). • ~5-7 singleton introns in one of the Cryptococcus spp indicative of intron gain.
- Slide 86: 10 introns lost in C. neoformans var grubii 2 3 5 6 78 9 10 11 12 13 1415 16 17 18 19 20 21 22 1 2 3 5 6 78 9-19 20 21 22 C.gattii var grubii var neoformans } }
- Slide 87: Happened at the locus and was a perfect deletion 1k 2k 3k 4k 5k 6k 7k 8k 9k 10k 11k CNI01560 CNI01540 CNI01550 C.neoformans var neoformans 89% nt identity 92% nt identity 86% nt identity C.neoformans var grubii 85% nt identity 88% nt identity 85% nt identity C.gattii
- Slide 88: Other Research Projects • Multigene phylogenies of the fungi • Gene family evolution • Sugar transporter family expansion in C.neoformans • Gene family evolution mammals (with M. Hahn)





