º

GENÉTICA Y GENÓMICA
Herramientas para el desarrollo de nuevos alimentos
Daniel Ramón Vidal
Genética y genómica

1. El pasado: genética en alimentación

2. El presente: la genómica y los modelos

3. ¿Cómo usar esta...
Genética y genómica

1. El pasado: genética en alimentación

2. El presente: la genómica y los modelos

3. ¿Cómo usar esta...
Historia de la agricultura
¿Cómo se han mejorado las especies?

MUTACIÓN

CRUCE SEXUAL
Brócolis, coles y coliflores

Repollo

Coliflor

Yema
terminal

Coliflor

Col

Yema floral

Coles de
Bruselas

Ancestro

F...
Pomelos “naturales”

Naranja dulce
Pomelos
ancestrales

Pomelo Hudson

Pummelo

Pomelo Star Ruby
Gallinas mejoradas genéticamente
Y también transgénicos
¿Va a ir a más?
El proyecto Genoma Humano

•

Desde el año 2001 disponemos de la secuencia
completa del genoma humano que está
compuesta p...
El uso indirecto de la genética y la genómica

• Los ratones mutantes ob/ob que no
producen leptina son obesos; lo
mismo p...
Genética y genómica

1. El pasado: genética en alimentación

2. El presente: la genómica y los modelos

3. ¿Cómo usar esta...
¿Hacia donde va la secuenciación masiva?

• A fecha de hoy ya se han
secuenciado completamente 7407
genomas de distintos a...
Las plataformas de secuenciación masiva

2001

2013

10 años
3000 millones $
1000 científicos

3 semanas
4000 €
1 técnico ...
El futuro genómico

2014 Q4

9 minutos
100 $
Sin personal
Las otras tecnologías “ómicas”
La genómica comparativa

12 Mb
5770 genes

100.2 Mb
21733 genes

3000 Mb
23000 genes
Organismos modelo: Caenorhabditis elegans

• Fácil de usar en el laboratorio, tamaño
pequeño
• Ciclo de vida corto
• Dispo...
La apuesta de Biopolis SL

Bioquímica

Cultivos celulares
Genómica

Microbiología

Organismos modelo

Biología molecular

...
Genética y genómica

1. El pasado: genética en alimentación

2. El presente: la genómica y los modelos

3. ¿Cómo usar esta...
Cacao y salud: ¿cómo demostrarlo?

• Hay muchas referencias bibliográficas sobre el efecto de los polifenoles del cacao
en...
CocoanOX 12%

Selección de frutos

Inactivación PPO

Tamizado

Molienda

Extracción solventes

CocoanOX 12%

Aventado

Ext...
Efecto antioxidante en C. elegans

+CCX-12

5 dÍas
C. elegans

Estrés
oxidativo

5 hours

-CCX-12

EXPERIMENTO

% SUPERVIV...
Transcriptómica y mutantes

SIR2

EXPERIMENTO

SIR1

% SUPERVIVENCIA

SIN CCX-12 WT

5

CON CCX-12 WT

39

CON CCX-12 SIR ...
¿Cuál es la diana de los polifenoles de cacao?
Insulin-like
peptides
DAF-2

AGE-1

SGK-1

AKT-1
AKT-2

FTT-2

PAR-5
DAF-16...
Aumento de la esperanza de vida

+CCX-12
100
90
80

>21 días

70
% worms 60
alive
50
40
30
20
10
0
0 1 2 3 4 5 6 7 8 9 10 ...
Probióticos y estrés oxidativo

Streptococcus
(9 cepas)

Lactobacillus
(75 cepas)

ESCRUTINIO MASIVO

Bifidobacterium
(15 ...
Escrutinio en dos pasos
1

Ensayo

Alimentación

Sincronización
Huevos
(1mL Buffer M9)

L1 Larvae

Adultos

4 días

1 día
...
CNCM I-3690: una cepa antioxidante

• En general, las bacterias lácticas incrementan ligeramente la resistencia al estrés
...
Transcriptómica de la cepa I-3690

E. coli OP50

Insulin like-pathway

CNCM I-3690

Metabolismo de lípidos

DAF-16

CNCM I...
Resultados en un modelo murino

No colitis

Vehicle + TNBS

• Se ensayó la administración intragástrica
durante 5 días de ...
La enfermedad de Alzheimer

Estrés oxidativo
Inflamación
Degeneración neuronal
Haces neurofibrilares
Péptidos desde CB
“COCOA BARQUILLO”

HIDRÓLISIS PROTEÍCA
Hydrophobic Interaction chromatography (HIC)

FRACCIONES HIC
FRAC...
Identificación del péptido
FRACCIONES RPC POSITIVAS

IDENTIFICACIÓN MALDI-TOF

SECUENCIAS PEPTÍDICAS (17 péptidos)

Theobr...
Resultados

70

% Worm Survival (C. elegans N2)

100

80

60

% Inhibition

Antioxidant Activity

80

Percentage Not paral...
Transcriptómica
PÉPTIDO 13L-mer
Regulación
Metabolismo del
piruvato

Regulación
Proteasoma

Acetil coA

Turnover de proteí...
Inhibición de la agregación de Aβ

112

1,2

61

30

25
13

Ratio de agregación

1
0,8
0,6
0,4
0,2
0

Placebo

13L

Tubuli...
El modelo de C. elegans en Biopolis SL

Efecto antioxidante
Longevidad

Extractos vegetales
Probióticos
Fracciones de puri...
Revalorización de resíduos

•
•
•
•
•
•
•
•
•
•
•
•
•

Paja de trigo
Bagazo
Materiales
lignocelulósicos
Suero de quesería
...
El futuro: la biología de sistemas

• Hay que trabajar con modelos alternativos, el apoyo de las tecnologías

“ómicas” y l...
La reflexión final

A lo desconocido no hay que
tenerle miedo, simplemente
hay que entenderlo

(Marie Curie, 1867-1934)
Daniel Ramón Vidal (daniel.ramon@biopolis.es)
http://www.linkedin.com/profile/view?id=64921252&trk=tab_pro

Biopolis SL
Pa...
Upcoming SlideShare
Loading in …5
×

20131129 FFF Genética y Genómica_Daniel Ramón

705 views
520 views

Published on

20131129 FFF Genética y Genómica_Daniel Ramón

0 Comments
0 Likes
Statistics
Notes
  • Be the first to comment

  • Be the first to like this

No Downloads
Views
Total views
705
On SlideShare
0
From Embeds
0
Number of Embeds
0
Actions
Shares
0
Downloads
14
Comments
0
Likes
0
Embeds 0
No embeds

No notes for slide

20131129 FFF Genética y Genómica_Daniel Ramón

  1. 1. º GENÉTICA Y GENÓMICA Herramientas para el desarrollo de nuevos alimentos Daniel Ramón Vidal
  2. 2. Genética y genómica 1. El pasado: genética en alimentación 2. El presente: la genómica y los modelos 3. ¿Cómo usar estas técnicas?
  3. 3. Genética y genómica 1. El pasado: genética en alimentación 2. El presente: la genómica y los modelos 3. ¿Cómo usar estas técnicas?
  4. 4. Historia de la agricultura
  5. 5. ¿Cómo se han mejorado las especies? MUTACIÓN CRUCE SEXUAL
  6. 6. Brócolis, coles y coliflores Repollo Coliflor Yema terminal Coliflor Col Yema floral Coles de Bruselas Ancestro Flores y tallos Yema lateral Hojas Tallos Colrabi Col de Bruselas Brócoli Cale
  7. 7. Pomelos “naturales” Naranja dulce Pomelos ancestrales Pomelo Hudson Pummelo Pomelo Star Ruby
  8. 8. Gallinas mejoradas genéticamente
  9. 9. Y también transgénicos
  10. 10. ¿Va a ir a más?
  11. 11. El proyecto Genoma Humano • Desde el año 2001 disponemos de la secuencia completa del genoma humano que está compuesta por unos 23000 genes; sólo conocemos la funcionalidad de la mitad • Costó 3000 millones de dólares y casi diez años de trabajo de más de 1000 científicos • En muchos casos ya conocemos que genes de nuestro genoma se relacionan con metabolopatías con posible prevención nutricional o con las sensaciones organolépticas
  12. 12. El uso indirecto de la genética y la genómica • Los ratones mutantes ob/ob que no producen leptina son obesos; lo mismo pasa con los ratones mutantes db/db o las ratas mutantes fa/fa que son defectivas en el receptor de leptina • En humanos hay genes equivalentes • En humanos se han descrito defectos congénitos en la vía de leptina que se asocian a una obesidad mórbida temprana • En el genoma humano ya se han identificado más de 300 genes relacionados con obesidad
  13. 13. Genética y genómica 1. El pasado: genética en alimentación 2. El presente: la genómica y los modelos 3. ¿Cómo usar estas técnicas?
  14. 14. ¿Hacia donde va la secuenciación masiva? • A fecha de hoy ya se han secuenciado completamente 7407 genomas de distintos animales, plantas y microorganismos • Hay otros 25406 genomas en proceso de secuenciación • Entre otros de interés agroalimentario se han secuenciado los genomas del arroz, el maíz, el trigo, la judía, la uva, el tomate, el cacao, la levadura panadera o algunas bacterias lácticas
  15. 15. Las plataformas de secuenciación masiva 2001 2013 10 años 3000 millones $ 1000 científicos 3 semanas 4000 € 1 técnico FP
  16. 16. El futuro genómico 2014 Q4 9 minutos 100 $ Sin personal
  17. 17. Las otras tecnologías “ómicas”
  18. 18. La genómica comparativa 12 Mb 5770 genes 100.2 Mb 21733 genes 3000 Mb 23000 genes
  19. 19. Organismos modelo: Caenorhabditis elegans • Fácil de usar en el laboratorio, tamaño pequeño • Ciclo de vida corto • Disponibilidad de herramientas genéticas (clásicas y moleculares) • Buena colección de mutantes • Genoma secuenciado y bien anotado • Alto porcentaje de homología con el genoma humano
  20. 20. La apuesta de Biopolis SL Bioquímica Cultivos celulares Genómica Microbiología Organismos modelo Biología molecular Escalado Metabolómica Fermentación Modelos murinos
  21. 21. Genética y genómica 1. El pasado: genética en alimentación 2. El presente: la genómica y los modelos 3. ¿Cómo usar estas técnicas?
  22. 22. Cacao y salud: ¿cómo demostrarlo? • Hay muchas referencias bibliográficas sobre el efecto de los polifenoles del cacao en la prevención del riesgo cardiovascular • Un polvo de cacao convencional tiene un 3-4% de polifenoles • Un producto con mayor contenido en polifenoles sería muy interesante
  23. 23. CocoanOX 12% Selección de frutos Inactivación PPO Tamizado Molienda Extracción solventes CocoanOX 12% Aventado Extracción de grasa Torta de cacao Secado CocoanOX 30-45-70% E. Cienfuegos-Jovellanos, F.K. Jaisli, M.A. Pasamar, Y. Castilla, F.J. Arcos, D. Ramón. (2007). Method for obtaining polyphenol-rich cocoa powder with a low fat content and cocoa thus obtained. WO2007/096449
  24. 24. Efecto antioxidante en C. elegans +CCX-12 5 dÍas C. elegans Estrés oxidativo 5 hours -CCX-12 EXPERIMENTO % SUPERVIVENCIA SIN CCX-12 5 CON CCX-12 39
  25. 25. Transcriptómica y mutantes SIR2 EXPERIMENTO SIR1 % SUPERVIVENCIA SIN CCX-12 WT 5 CON CCX-12 WT 39 CON CCX-12 SIR 2.1 7
  26. 26. ¿Cuál es la diana de los polifenoles de cacao? Insulin-like peptides DAF-2 AGE-1 SGK-1 AKT-1 AKT-2 FTT-2 PAR-5 DAF-16 Citoplasma Núcleo SKN-1 SIR-2 DAF-16 Genes de longevidad
  27. 27. Aumento de la esperanza de vida +CCX-12 100 90 80 >21 días 70 % worms 60 alive 50 40 30 20 10 0 0 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 C. elegans days of adult -CCX-12 EXPERIMENTO LIFESPAN (días) SIN CCX-12 15.2 CON CCX-12 17.8 P. Martorell, J. V. Forment, R. de Llanos, F. Montón, S. Llopis, N. González, S. Genovés, E. Cienfuegos, H. Monzó, D. Ramón. (2011). Cocoa polyphenols increase lifespan in Caenorhabditis elegans by a SIR-2.1 and DAF-16 dependent mechanism. Journal of Agricultural and Food Chemistry 59: 2077-2085
  28. 28. Probióticos y estrés oxidativo Streptococcus (9 cepas) Lactobacillus (75 cepas) ESCRUTINIO MASIVO Bifidobacterium (15 cepas)
  29. 29. Escrutinio en dos pasos 1 Ensayo Alimentación Sincronización Huevos (1mL Buffer M9) L1 Larvae Adultos 4 días 1 día 3 días 5 horas Placas NG 20°C 25°C 25°C 25°C M9 + Colesterol Probiótico Inhibición E. coli C. elegans BA17 fem-1 Estrés oxidativo Viabilidad NG-OP50 2 5 días Estrés oxidativo (3mM H2O2) 5 horas NG-probiótico C. elegans wild –type (N2) G. Grompone, M.C. Degivry, D. Ramón, P. Martorell, N. González, S. Genovés, S. Legrain-Raspaud, I. Chabaud, R, Bourdet-Siscard. (2011). Method for selecting bacteria with antioxidant activity. WO2011/083353A1
  30. 30. CNCM I-3690: una cepa antioxidante • En general, las bacterias lácticas incrementan ligeramente la resistencia al estrés oxidativo; no se observó efecto en las bifidobacterias ensayadas • Se detectó un fuerte efecto en once cepas pertenecientes a los géneros Lactobacillus y Streptococcus; una de ellas, denominada Lactobacillus rhamnosus CNCM I-3690, funcionó de forma muy eficaz
  31. 31. Transcriptómica de la cepa I-3690 E. coli OP50 Insulin like-pathway CNCM I-3690 Metabolismo de lípidos DAF-16 CNCM I-4317 Respuesta a estrés Sistema inmune innato
  32. 32. Resultados en un modelo murino No colitis Vehicle + TNBS • Se ensayó la administración intragástrica durante 5 días de 108 ufc de la cepa I-3690 en un modelo de rectocolitis inducida por TNBS en ratones Balb/c; como control positivo se utilizó prednisolona y como control negativo se usó el tampón de administración del probiótico • Se realizó un análisis histopatológico CNCMI-3690 + TNBS Prednisolone + TNBS • El coeficiente de Wallace fue de 3.4 en el grupo control con el placebo y de 1.5 en el grupo de la prednisolona; el valor en el grupo tratado con la cepa L10C fue de 2.4 G. Grompone, P. Martorell, S. Llopis, N. González, S. Genovés, A.P. Mulet, T. Fernández-Calero, I. Tiscornia, M. Bollati-Fogolin, I. Chambaud, B. Foligné, A. Montserrat, D. Ramón. (2012). Anti-inflammatory Lactobacillus rhamnosus CNCM I-3690 strain protects against oxidative stress and increases lifespan in Caenorhabditis elegans. PLOS ONE 7: e52493
  33. 33. La enfermedad de Alzheimer Estrés oxidativo Inflamación Degeneración neuronal Haces neurofibrilares
  34. 34. Péptidos desde CB “COCOA BARQUILLO” HIDRÓLISIS PROTEÍCA Hydrophobic Interaction chromatography (HIC) FRACCIONES HIC FRACCIONES HIC POSITIVAS Reverse Phase Chromatography (RPC) FRACCIONES RPC FRACCIONES RPC POSITIVAS MALDI-TOF IDENTIFICACIÓN DE LOS PÉPTIDOS
  35. 35. Identificación del péptido FRACCIONES RPC POSITIVAS IDENTIFICACIÓN MALDI-TOF SECUENCIAS PEPTÍDICAS (17 péptidos) Theobroma cacao 21 kDa seed protein (221 aas) mktatavvlllfaftsksyffgvanaanspvldtdgdelqtgvqyyvlssisgagggglalgratgqscpeivvqr rsdldngtpvifsnadskddvvrvstdvniefvpirdrlcststvwrldnydnsagkwwvttdgvkgepgpnt lcswfkiekagvlgykfrfcpsvcdscttlcsdigrhsdddgqirlalsdnewawmfkkasktikqvvnakh B. Muguerza, H. Monzó, N. Alepuz, E. Bataller, S. Genovés, M. Enrique, P. Martorell, D. Ramón. (2010). Obtainment of cocoa extracts rich in bioactive peptides with inhibiting activity of ACE and PEP enzymes. EP2322041A1 E. Bataller, S. Genovés, P. Martorell, D. Ramón, A. Ibañez, S. Llopis, N. González, H. Monzó, B. Muguerza. (2011). Obtainment of bioactive products from cocoa having inhibitory activity against the PEP enzyme and antioxidant and/or anti-neurodegenerative activity. WO2011/076954A1
  36. 36. Resultados 70 % Worm Survival (C. elegans N2) 100 80 60 % Inhibition Antioxidant Activity 80 Percentage Not paralyzed IC50 PEP 13-mer (0.19 mg/ml) 40 20 60 50 40 30 20 0 0,001 0,01 0,1 1 NGM+vitamin C 9L 11R 13L not induced NGM 100 ZPP 9L 75 11R 50 13L 13R 25 0 24 41 43 0 NGM Paralysis assay 10 -20 0,0001 • 125 13R 45 47 49 51 53 Time (h) [13-mer] mg/ml Inhibición PEP Actividad antioxidante Parálisis • El valor IC50 más bajo para la inhibición de PEP lo dió el péptido 13L-mer (0.19 mg/mL) • Este péptido presentó la mayor actividad antioxidante in vivo • También fue el más eficaz en la reducción de la parálisis • Curiosamente, el péptido 13L-mer inhibe in vitro la enzima humana PLA2 • Hemos detectado trazas de este péptido en chocolates comerciales
  37. 37. Transcriptómica PÉPTIDO 13L-mer Regulación Metabolismo del piruvato Regulación Proteasoma Acetil coA Turnover de proteínas Función sináptica Reducción del agregado amiloide REDUCCIÓN DE LA TOXICIDAD DE Aβ Regulación Metabolismo del triptófano Serotonina Locomoción Apetito
  38. 38. Inhibición de la agregación de Aβ 112 1,2 61 30 25 13 Ratio de agregación 1 0,8 0,6 0,4 0,2 0 Placebo 13L Tubulina Martorell P, Bataller E, Llopis S, González N, Álvarez B, Montón F, Ortíz P, Ramón D, Genovés S. A cocoa peptide protects Caenorhabditis elegans from oxidative stress and b-amyloid peptide toxicity. PLOS ONE 8: e63283
  39. 39. El modelo de C. elegans en Biopolis SL Efecto antioxidante Longevidad Extractos vegetales Probióticos Fracciones de purificación Inflamación Moléculas aisladas Obesidad Enfermedad de Alzheimer Replicación de virus Café Cerveza Refrescos carbonatados Colonización de bacterias Yogurt Zumos de frutas
  40. 40. Revalorización de resíduos • • • • • • • • • • • • • Paja de trigo Bagazo Materiales lignocelulósicos Suero de quesería Fases ricas en glicerol de biodiesel Restos grasos de matadero Aguas de producción de mantequillas Residuos de almazara Aceites de fritura Residuos urbanos Residuos municipales (RSU) Gas de síntesis (CO + H2 ) Biogas (metano + CO2) • • • • • • • • • • • • Metanol Etanol 1,3-propanodiol 2,3-butanodiol Ácido L-láctico Butanol Iso-butanol Dihidroxiacetona Poli-3-hidroxibutirato Poli-3-hidroxibutiratoco-valerato mcl-PHA Ácidos (R)-3-hidroxi alcanoicos
  41. 41. El futuro: la biología de sistemas • Hay que trabajar con modelos alternativos, el apoyo de las tecnologías “ómicas” y la ayuda de la bioinformática • La biología de sistemas es la clave • El ejemplo de los líderes: Nestlé Institute of Health Sciences
  42. 42. La reflexión final A lo desconocido no hay que tenerle miedo, simplemente hay que entenderlo (Marie Curie, 1867-1934)
  43. 43. Daniel Ramón Vidal (daniel.ramon@biopolis.es) http://www.linkedin.com/profile/view?id=64921252&trk=tab_pro Biopolis SL Parc Cientific Universitat de València C/ Catedrático Agustín Escardino Benlloch 9; Edificio B; 469809-Paterna; Valencia

×