Your SlideShare is downloading. ×
Waspada Aceh1september
Waspada Aceh1september
Waspada Aceh1september
Waspada Aceh1september
Waspada Aceh1september
Waspada Aceh1september
Waspada Aceh1september
Waspada Aceh1september
Waspada Aceh1september
Waspada Aceh1september
Waspada Aceh1september
Waspada Aceh1september
Waspada Aceh1september
Waspada Aceh1september
Waspada Aceh1september
Waspada Aceh1september
Waspada Aceh1september
Waspada Aceh1september
Waspada Aceh1september
Waspada Aceh1september
Waspada Aceh1september
Waspada Aceh1september
Waspada Aceh1september
Waspada Aceh1september
Upcoming SlideShare
Loading in...5
×

Thanks for flagging this SlideShare!

Oops! An error has occurred.

×
Saving this for later? Get the SlideShare app to save on your phone or tablet. Read anywhere, anytime – even offline.
Text the download link to your phone
Standard text messaging rates apply

Waspada Aceh1september

5,557

Published on

0 Comments
0 Likes
Statistics
Notes
  • Be the first to comment

  • Be the first to like this

No Downloads
Views
Total Views
5,557
On Slideshare
0
From Embeds
0
Number of Embeds
0
Actions
Shares
0
Downloads
15
Comments
0
Likes
0
Embeds 0
No embeds

Report content
Flagged as inappropriate Flag as inappropriate
Flag as inappropriate

Select your reason for flagging this presentation as inappropriate.

Cancel
No notes for slide

Transcript

  • 1. WASPADA Demi Kebenaran Dan Keadilan Harian Umum Nasional Banda Aceh: Terbit Sejak 11 Januari 1947 Cuaca : Berawan dan Provinsi NAD: peluang hujan Lereng Timur Pegunungan, Dataran Tinggi, Pesisir Timur, Pendiri : H. Mohd. Said (1905 - 1995) Angin : Tenggara - Barat Laut Pantai Barat: Berawan Hj. Ani Idrus (1918 - 1999) Kec. antara 10 s/d 30 Km/jam dan hujan ringan Temperatur Maks/Min: 340C - 240C EDISI ACEH ISSN: 0215-3017 BMKG Polonia SELASA, Pahing, 1 September 2009 /11 Ramadhan 1430 H ● No: 22899/A Tahun Ke-63 Terbit 24 Halaman ● Harga Eceran: Rp 2.500,- (belum termasuk ongkos kirim) Kursi Tergantung Pleno JAK ARTA (Antara): Ketua Komisi Pemilihan Umum (KPU) Abdul Hafiz Anshary mengatakan, ke- putusan diumumkan tidak- nya penetapan alokasi kursi anggota DPR beserta calon terpilihnya tergantung pa- da hasil rapat pleno KPU. “Diumumkan atau tidak ter- gantung pleno. Pleno sebelum- nya memutuskan, tidak akan mengumumkan sebelum ada putusan Mahkamah Konstitusi (terkait hasil pemungutan atau penghitungan ulang),” katanya di Gedung KPU, Jakarta, Senin (31/8). Putusan terkait hasil pemu- ngutan dan penghitungan ulang oleh MK akan dibacakan besok, Selasa 1 September 2009. Ketua KPU mengemuka- kan, setelah adanya putusan Antara tersebut, KPU dapat menetap- JEMBATAN TALI. Dua warga menyeberangi sungai kan alokasi kursi maupun calon dengan menggunakan jembatan tali yang terbuat kabel terpilih dari daerah pemilihan listrik di desa Blang Mie Kecamatan Mane Pidie, Minggu yang oleh MK sebelumnya di- (30/8). Jembatan tali yang dibuat sekitar 1970 itu masih perintahkan untuk melakukan menjadi sarana penyeberangan bagi warga di daerah pemungutan atau penghitu- pedalaman Aceh. ngan ulang. Dalam kesempatan itu Ke- tua KPU membantah anggapan Seniman Dukung Pemerintah bahwa KPU mengulur-ulur atau menunda pengumuman pe- Patenkan Kesenian Aceh netapan alokasi kursi DPR dan calon terpilihnya. BANDA ACEH (Antara): Penyanyi dan Seniman Aceh, Menurut dia, KPU tidak Rafly Kande menyatakan mendukung upaya Pemerintah pernah secara resmi menyam- Aceh mempatenkan berbagai jenis kesenian hasil karya paikan akan mengumumkan anak bangsa daerah tersebut. perolehan kursi pada 21 atau “Kita dukung gagasan mempatenkan karya bangsa yang 24 Agustus. sedang dan akan dilakukan pemerintah guna menjaga dan “Tidak benar kalau KPU memelihara kesenian yang kita miliki,” katanya di Banda dikatakan menunda. Kita tidak Aceh, Senin (31/8). pernah menunda, pada Jumat Hal itu disampaikan terkait isu tentang adanya klaim (21/8) KPU telah menetapkan, Malaysia terhadap sejumlah karya anak bangsa, yakni dan pada Senin (24/8) dilakukan Waspada/Muhammad H. Ishak kesenian dan adat budaya Indonesia seperti angklung, tari pengecekan ulang,” katanya pendet, dan batik. menegaskan. PERLIHATKAN BB: Terlihat Kapolres Aceh Timur AKBP Drs Ridwan Usman memperlihat Senjata Api (Senpi) jenis FN buatan Jerman bersama 11 amunisi Lanjut ke hal 2 kol. 1 serta satu magazen yang ditemukan usai terjadi laka lantas di Desa Paya Naden, Kecamatan Madat, Kabupaten Aceh Timur, Provinsi Aceh, Senin (31/8) Lanjut ke hal 2 kol. 1 dini hari. Baca Halaman Dalam 15 Rekanan Pengadaan Senpi Buatan Mantan Bupati Pidie Divonis Bebas Senjata Masuk Daftar Hitam Jerman Diamankan JAKARTA (Antara): Menteri daan persenjataan dari yang prosedur pengadaan alat utama IDI, Aceh Timur (Waspada): Senin (31/8) sekira pukul 00:10. hingga patah.Warga yang men- Pengadilan Negeri (PN) Sigli, memvonis bebas Pertahanan Juwono Sudarsono sudah direncanakan dan di- sistem senjata. Jajaran Mapolres Aceh Timur Selain itu petugas juga mene- dengar dentuman keras lang- mantan Bupati Pidie Ir. H. Abdullah Yahya, MS dan mengemukakan, pihaknya telah anggarkan. “Selama ini Departemen berhasil mengamankan sepu- mukan 11 butir amunisi di dua sung mendatangi lokasi dan wakilnya Drs. H. Djalaluddin Harun pada sidang menengarai ada 15 perusahaan Presiden juga meminta agar Pertahanan terus melakukan cuk senjata api jenis FN buatan tempat yang berbeda. Semen- membantu mengevakuasi kor- Tindak Pidana Korupsi (Tipikor), Senin (31/8). rekanan pengadaan alat utama Departemen Pertahanan terus Jerman, di Desa Paya Naden, tara dua pelaku berhasil melari- ban ke Puskesmas terdekat. Satu sistem senjata yang masuk da- memantau dan menertibkan Lanjut ke hal 2 kol. 6 Kecamatan Madat, Aceh Timur, kan diri. Informasi yang diper- jam kemudian petugas dari Ma- lam daftar hitam. oleh menyebutkan, penemuan polsek Madat dan Satuan Lantas “Itu data terakhir yang se- senpi itu berawal dari dua pela- Pos Julok tiba di lokasi menga- mentara kami data dari sekian banyak rekanan pengadaan alat utama sistem senjata selama 4.245 Tunjangan Sertifikasi ku dengan menggunakan mobil sedan BK 3 YR mengalami kecelakaan dengan menye- mankan kedua jenis kendaraan yang terlibat guna pengusutan lebih lanjut. ini,” katanya, ketika dikonfirmasi ruduk sepeda motor jenis Vega Kepada petugas warga me- ‘Alaqah Oleh Drs H Ameer Hamzah Antara di sela-sela rapat kerja jajaran kementerian politik, hukum dan keamanan dengan Guru Depag Tergadaikan R BL 5432 DU yang kendarai Safrizal, 20, warga Desa Lubok, Kecamatan Pante Bidari, Aceh milik mobil melarikan diri ke arah pemukiman warga sesaat setelah tabrakan itu terjadi. Iqra’ bismi Rabbikal ladzi khalaq. Khalaqal inshaana Komisi I DPR di Jakarta, Senin KOTA LHOKSEUMAWE menyanyangkan sikap pejabat kemudian Agustus. Namun ti- Timur. Karena curiga dengan dengan min alaq (Bacalah dengan nama tuhamu yang (31/8). ( Waspada): Ketua I Koalisi Departemen Agama (Depag) dak ada ada tanda janji itu dapat Kronologis kejadian yang mobil sedan yang ditinggalkan menciptakan. Menciptakan manusia dari segumpala Beberapa saat sebelumnya, Barisan Guru Bersatu (Kobar- terhadap guru terabaikan. Buk- terealisasi. diperoleh Waspada kemarin pemiliknya lalu polisi mela- darah) (QS. Surah al-’Alaq:1—2). Menhan Juwono Sudarsono GB) Kota Lhokseumawe, Drs tinya dana sudah tersedia dan Menurut Muhammad Is- menyebutkan, Minggu (30/8) kukan penggeledahan terhadap bertemu Presiden Susilo Bam- Muhammad Ismail, melalui berkas para guru sudah dikirim, mail, tak tanggung-tanggung, sekira pukul 21:15 dari arah Kota mobil itu. Akhirnya di dalam Manusia pertama (Nabi Adam) diciptakan Allah dari bang Yudhoyono untuk menje- siaran pers yang dikirimkan ke namun perhatian pemerintah pada tahun 2007, jumlah guru Idi (timur) menuju Kota Lhok- mobil ditemukan sebutir amu- tanah (turab), Nabi Isa ibnu Maryam dari ruh (tanpa ayah), laskan seputar pengadaan per- Waspada menyatakan prihatin terhadap guru di kalangan De- yang dinyatakan lulus sertifikasi seumawe (barat) melaju sebu- nisi aktif jenis senpi FN buatan tetapi manusia-manusia yang lain Allah menciptakan dari senjataan dan penjualan senjata terhadap guru di lingkungan partemen Agama (Depag) ber- mencapai 4.245 orang. Namun ah mobil sedan dengan kece- luar negeri. proses perkawinan antara seorang pria dan seorang wanita. oleh PT Pindad. Depag. Hingga kini belum ada beda dengan guru di lingkungan hingga kini dana tunjangan itu patan tinggi. Sesampai di lokasi Petugas yang bertambah Proses kejadiannya disebut dalam al-Quran Khalaqal insaana Ia mengemukakan, Presi- sinyal realisasi tunjangan ser- Departemen Pendidikan Nasio- belum diterima mereka, bah- mobil menyeruduk sepeda mo- curiga lalu menyisir sekitar lokasi. min ‘alaq (menciptakan manusia dari segumpal darah (‘alaq). den Yudhoyono meminta agar tifikasi guru dibayar, meskipun nal. Hal ini terlihat dalam me- kan pihaknya menduga dana tor yang dikendarai Safrizal. Warga yang berkerumunan juga Dalam ayat lain Allah berfirman: Bukankah dia dulu Departemen Pertahanan dan pusat berniat membantu me- realisasi 4.245 tunjangan ser- itu diinapkan di rekening Kanwil Lokasi yang gelap membuat membantu petugas dalam pe- setetes mani yang ditumpahkan ke dalam rahim TNI dapat menggunakan angga- nyejahterakan para guru dengan tifikasi guru Depag Provinsi Aceh Depag Aceh sejak dikucurkan sopir mobil hilang kendali dan nyisiran itu. Hasilnya ditemukan Lanjut ke hal 2 kol. 1 ran secara akuntabel, transparan menyediakan dana tersebut. beberapa kali yang pernah di- spontan oleng ke kanan jalan, dan efektif, jangan ada penga- Disebutkan, pihaknya juga janjikan tertunda yaitu Juli Lanjut ke hal 2 kol. 3 lalu menghantam tiang listrik Lanjut ke hal 2 kol. 3 Tak Hanya Langgar Kode Etik 16 Saksi Kasus Tewasnya Mahasiswa Antasari Juga Diduga Korupsi Diperiksa MEDAN (Waspada): Tim Berkas Kasus Pembunuhan 10 September penyidik Kepolisian Daerah JAKARTA (Waspada): Tim Kuningan, Jaksel, Senin (31/8). (Polda) Sumatera Utara (Su- pengawas internal KPK dikabar- “PI (pengawas internal) KPK mut) telah memeriksa 16 saksi kan tidak hanya menemukan tidak hanya menemukan pe- terkait tewasnya Hendra Syah- dugaan pelanggaran kode etik langgaran kode etik. Ada duga- putra, taruna tingkat pertama yang dilakukan Ketua KPK non- an pidana korupsi yang akan di- Akademi Teknik dan Kesela- aktif Antasari Azhar. Temuan tangani KPK,” kata peneliti ICW matan Penerbangan (ATKP) berkembang pada arah dugaan Adnan Topan Husodo. Medan, Senin (31/8) siang. Pe- korupsi. Menurut Adnan, informasi meriksaan ini guna mengum- Hal ini terungkap setelah tersebut sudah diperoleh KPK pulkan sejumlah keterangan koalisi LSM yang terdiri dari ICW dari beberapa sumber. Namun yang guna mengusut motif ke- dan PSHK berdialog dengan hingga saat ini belum bisa matian Hendra, yang diduga penasihat KPK terkait kondisi dijelaskan lebih lanjut karena kuat akibat penganiayaan. Jadwal Imsakiyah Ramadhan 1430-H Untuk Banda Aceh Para saksi itu dari staf aka- & Sekitarnya. KPK pasca Antasari Azhar di Gedung KPK, Jl HR Rasuna Said, Lanjut ke hal 2 kol. 1 demi, taruna senior dan taruna Selasa, 11 Ramadhan 1430 H/1 September 2009 ddari angkatan korban sendiri. Berbuka : 18.47 Wib Mereka menjalani pemeriksaan Imsak : 05.06 Wib di ruang Unit Tipidum, Direk- Internet torat Reserse dan Kriminal Deddy Corbuzier Tahu Di Mana Lanjut ke hal 2 kol. 1 Noordin M Top, Asalkan... erampang Serampang MENTALIS Deddy Corbuzier (foto) para pelaku teror bersembunyi usai men- mengaku mengetahui di mana lokasi datangi Mabes Polri, terkait pemanggilan persembunyian para pelaku teroris yang atas kasus atraksi penembakan di salah selama ini meresahkan masyarakat, ter- satu stasiun televisi, Senin (31/8). masuk Noordin M Top, gembong teroris nomor Namun, ketika ditanya lebih lanjut di - Nanti Noordin wahid yang paling dicari Tim Densus 88 Anti- mana lokasi para pelaku teroris itu, ia men- gak Top Teror. jawab: “Semua tergantung bayarannya. “Tahu lah,” jawabnya yakin ketika dita- nya apakah bisa meramal di mana lokasi Lanjut ke hal 2 kol. 3 Lanjut ke hal 2 kol. 6 - He... he... he...
  • 2. 2 Berita Utama WASPADA Selasa 1 September 2009 Kursi Tergantung Pleno ... Ketika diklarifikasi mengenai waktu pengumuman Ribuan Pramuka Aceh kursi DPR, Hafiz tidak menjawab dengan rinci, ia menu- turkan, hal tersebut akan diputuskan dalam pleno. “Saya tidak katakan tanggal 2 September (akan ‘Tunas Ramadhan’ Di Sabang mengumumkan). Tanggal 2 kita akan menetapkan hasil BANDA ACEH (Antara): Ribu- (baca Alquran), Musabaqah Tila- (alokasi kursi) pascaputusan MK untuk Lampung, Kepu- an pramuka dari 23 kabupaten/ watil Quran (MTQ), dan berbagai lauan Riau, Sumatera Utara,” tegasnya. kota di Provinsi Aceh ambil bagian kegiatan keagamaan lainnya,” ka- Sebelumnya, pada Jumat 21 Agustus KPU menggelar dalam sebuah silaturahmi (Tunas ta dia menambahkan. pleno tertutup untuk membahas alokasi kursi tahap Ramadhan) di Kota Sabang, sela- Para peserta “Tunas Rama- ketiga dan tindak lanjut putusan MK terkait perselisihan ma sepekan. dhan” itu akan berbaur dan me- “Para kontingen dari seluruh nginap di rumah masyarakat yang hasil pemilu. kabupaten dan kota di Aceh sudah tersebar di sejumlah desa/kelura- Anggota KPU Andi Nurpati setelah rapat pleno menyatakan ikut ambil bagian da- han di kota Sabang, Pulau Weh. tersebut mengatakan, KPU telah selesai menghitung alo- lam agenda tahunan Tunas Rama- Pada bagian lain, Muhammad kasi kursi dan calon terpilihnya, kecuali untuk di bebe- dhan’ itu, “kata Ketua Kwartir dae- Nazar juga menyatakan Aceh me- rapa daerah pemilihan seperti Lampung, Kepulauan rah (Kwarda) Gerakan Pramuka rupakan salah satu calon kuat Riau, dan Sumatera Utara, karena hasil pemungutan Aceh, Muhammad Nazar di Banda tempat pelaksanaan Perkemahan atau penghitungan ulang di daerah tersebut belum di- Aceh, Senin (31/8). Wirakarya 2011. putuskan oleh MK. Agenda silaturahmi dan syiar “Kami berharap pelaksanaan Lalu, pada Senin 24 Agustus, KPU melakukan peme- Islam itu merupakan rutinitas di- agenda nasional tersebut bisa ter- riksaan ulang terhadap penghitungan yang telah dilaku- gelar pramuka sebagai rangkaian laksana di Aceh. Pesertanya tentu kan sebelumnya. menyemarakkan bulan suci Ra- saja dari seluruh Indonesia. Jadi madhan dan akan diberlangsung satu penghormatan besar masya- Andi menuturkan, KPU akan mengumumkan pene- pada 2 September 2009. rakat Aceh jika bisa melaksanakan tapan alokasi kursi dan caleg terpilih setelah putusan MK Dipilihnya Sabang sebagai lo- Perkemahan Wirakarya yang bia- tentang hasil pemungutan atau penghitungan ulang. kasi “Tunas Ramadhan”, menurut sanya dibuka presiden,” kata dia Muhammad Nazar yang juga Wa- menambahkan. Tak Hanya Langgar ... kil Gubernur Aceh bertujuan un- Wagub menawarkan lokasi tuk memperkenalkan kota wisata untuk pelaksanaan Perkemahan masih dalam proses penelitian. “Ini yang membuat Ko- Antara itu agar lebih dekat kepada ma- Wirakarya itu di kawasan Taman mite Etik agak lama dibentuk,” tegas Adnan. MUZAKIR MANAF: Ketua Komite Peralihan Aceh (KPA) Propinsi Aceh Muzakir Manaf (tengah) didampingi syarakat di provinsi ujung paling Hutan Rakyat (Tahura), daerah Wakil Ketua KPK M Jasin tidak membantah hal ini. Ketua KPA wilayah Pase Tgk. Zulkarnain (kiri) dan Walikota Lhokseumawe Munir Usman (kanan) menyak- barat Indonesia tersebut. yang berbatasan antara Kabupa- Namun ia menegaskan, komite etik hanya akan mengu- sikan pelantikan 45 anggota DPRK Aceh Utara yang baru di gedung DPRK setempat, Senin (31/8). Sedikit- Selain itu, kesepakatan bersa- ten Aceh Besar dan Pidie. sut soal pelanggaran kode etik. Jika ada temuan unsur nya 70% kursi DPRK Aceh Utara dikuasai anggota dari partai lokal di Aceh. ma antara para pimpinan Kwar- “Kalau saya lebih cenderung pidana maka bukan menjadi wewenang tim untuk cab dan Kwarda se Aceh juga me- di dekat Tahura, sebab lokasinya DPRK Aceh Utara Diminta mengusut. mutuskan kota “titik nol” sebelah mudah dijangkau di lintasan ja- barat Indonesia tersebut sebagai lan negara Banda Aceh-Medan. “Yang pasti hanya nanti Komite Etik hanya menguru- tempat pelaksanaan Tunas Rama- Lokasi tersebut juga sangat si soal tersangkut paut pelanggaran kode etik,” ucapnya. dhan 2009. strategis untuk dikembangkan 10 September “Banyak agenda syiar Islam sebagai kawasan wisata masa Jaksa Agung Hendarman Supandji mengatakan, su- dalam agenda silaturahmi Tunas mendatang,” kata Muhammad rat dakwaan tersangka pembunuhan berencana ter- hadap Direktur PT PRB Nasrudin Zulkarnaen, Anta- sari Azhar, yang juga Ketua Komisi Pemberantasan Tuntaskan Sejumlah PR Penting Ramadhan, diantaranya tadarus Nazar. Korupsi (nonaktif ), akan segera rampung 10 September mendatang. “Itu harapan saya,” ujar Hendarman di sela-sela rapat LHOKSEUMAWE (Waspada): Para anggota DPRK Aceh Utara tara DPRK Aceh Utara Ridwan M. Yunus di gedung dewan setempat. ngan baik ikhlas dan menjujung tinggi demokrasi serta peka terha- PR Anggota Dewan kerja dengan Komisi I DPR RI tentang perkembangan terakhir masalah terorisme, Senin (31/8) di Gedung DPR, Jakarta. yang baru saja dilantik, Senin (31/8), diminta tuntaskan sejumlah PR dan tugas penting Lebih lanjut dikatakannya anggota DPRK Aceh Utara perio- de 2004-2009 telah melaksanakan dap tuntutan aspirasi masyara- kat,” pinta Ridwan Yunus. Adapun anggota DPRK Aceh Baru Menumpuk Menurut Hendarman, dugaan Antasari adalah otak lainnya yang ditinggalkan tugas-tugas sesuai fungsinya. An- Utara yang dilantik sekaligus di- ACEH UTARA (Waspada): Zai- pergantian anggota dewan. Be- di balik pembunuhan berencana tersebut didasarkan anggota dewan yang lama. tara lain DPRK sesuai fungsi legi- ambil sumpahnya kemarin ber- nal Jimbron, Ketua Lembaga Swa- berapa persoalan penting yang pada alat-alat bukti, saksi, serta keterangan terdakwa lasi telah menghasilkan beberapa jumlah 45 orang terdiri dari 32 daya Masyarakat-Rincong Aceh, sudah disebutkan mohon disele- yang turut terlibat dalam kasus tersebut. Hal itu tertuang dalam pengan- produk hukum (Qanun) baik da- orang dari Partai Aceh, 4 orang Senin (31/8) mengatakan, Peker- saikan dengan baik,” pinta Zainal Ketika ditanya lebih lanjut, Hendarman menolak me- tar Rapat Paripurna Istimewa Pe- lam bentuk inisiatif dewan mau- dari Partai Demokrat, dan masing- jaan Rumah (PR) untuk anggota Jimbron. rincinya. “Nanti lihat saja dalam persidangan, ya,” tam- ngucapan Sumpah Anggota DPRK pun usulan esekutif. masing 1 orang dari PBB, PKS, dewan baru Aceh Utara menum- Dilanjutkan, para anggota bah Hendarman.(m27/dtc/kps) Aceh Utara hasil pemilu 2009 yang “Kami mengharapkan agar tu- SIRA, PDIP, PAN, PSI, Golkar, PPD, puk. Untuk itu para dewan harus dewan baru juga diminta benar- dibacakan pimpinan rapat semen- gas ini dapat saudara jalanan de- dan PPP. (b15) bekerja ekstra ketat, agar semua benar berpihak kepada rakyat dan PR dapat terselesaikan. bukan kepada golongan atau ke- Seniman Dukung ... Dikatakannya, beberapa PR lompok. Hal itu disebabkan pa- Pelantun lagu “asoe nanggroe” itu mengatakan, upaya pendataan dan mematenkan seluruh kesenian yang tersebar di 23 kabupaten/kota Aceh merupakan Irwandi Berhentikan 20 Anggota DPRK Simeulue yang belum terselesaikan yakni pembangunan jalan di hampir se- luruh kecamatan di Aceh Utara, peningkatan mutu pendidikan, ra dewan telah berani menerima amanah dan kepercayaan dari rakyat Aceh, khususnya Aceh Uta- ra. Semoga dengan hadirnya ge- langkah tepat yang patut diberikan dukungan. SIMEULUE (Waspada): Melalui pembangunan jembatan, pem- nerasi baru di gedung DPRK Aceh Menurut dia, banyak kesenian Aceh yang kini di- sebuah surat keputusan (SK), No- berdayaan ekonomi masyarakat Utara, mampu memberi peruba- pelajari di negeri jiran Malaysia, sehingga dikhawatir- mor: 171.2/498/2009 yang dibaca- miskin, pembangunan rumah dua- han ke arah lebih baik. kan bisa diklaim sebagai budaya mereka lagi di masa kan oleh sekretaris Dewan Perwa- fa, dan sejumlah persoalan lain. “Selama ini, para anggota de- mendatang. kilan Rakyat Daerah Kabupaten “Kami pikir, sekaranglah saat- wan banyak memberi janji semu. “Kita harus segera mematenkan berbagai karya (DPRK) Simeulue, Syamsuir Danil, nya para dewan menepati janji ke- Akibatnya, banyak pekerjaan tak masyarakat Aceh seperti kesenian dan adat budaya, SH pada sidang rapat paripurna is- pada masyarakat, agar masyarakat terselesaikan dengan baik,” sebut termasuk kerajinan tangan warga provinsi ini,” katanya. timewa DPRK Simeulue, Senin (31/ tidak merasa dibohongi setiap Zainal.(cmun) Gubernur Aceh Irwandi Yusuf sebelumnya menyata- 8) Gubernur Aceh Irwandi Yusuf kan akan berupaya mempatenkan kesenian dan budaya atas nama Presiden Republik Indo- yang kini mulai kabur kekhasannya di provinsi paling ujung barat Sumatera itu. nesia memberhentikan secara res- mi 20 anggota DPRK Simeulue pe- Presiden Sering Diancam “Aneka seni dan budaya yang berkembang dalam masyarakat, kita pelihara kelestariannya. Semuanya riode 2004—2009. Berikut nama-nama 20 anggota DPRK Simeulue yang diresmikan Via SMS 9949 akan dipertimbangkan, namun ada prioritasnya,” kata pemberhentian masa keanggotaan JAKARTA (Antara): Seorang mengancam. Ibu Negara dan Pre- Gubernur Irwandi Yusuf. tahun 2004-2009. Elydar Oesman guru dari sebuah sekolah di Pan- siden menerima, ada satu sms Budaya masyarakat Aceh seperti tari-tarian saat ini, deglang, Banten, berkali-kali me- dari orang yang sama mengan- (PAN), Drs. Mandar M. Adam menurutnya sudah mulai kehilangan kekhasannya kare- ngirim pesan ancaman keselama- cam berkali-kali,” ujarnya. (PAN), Age Harun (PAN), H. Rabu- na telah dimodifikasi dengan tarian modern. din HS (PBR), Sardinsyah (PBR). tan kepada Presiden Susilo Bam- Menurut Andi, pesan pendek Lalu T. Anantha Jhoni (PKPI), bang Yudhoyono melalui layanan tersebut berkali-kali mengancam 16 Saksi Kasus ... Rosmaida (PKPI), Rosnawati (PBB), Waspada/Zafrullah pesan singkat (SMS) 9949 yang di- keselamatan Presiden dan berkata Erly Hasyim, SH, S.Ag (PBB), Azha- 20 Anggota DPRK Simeulue periode 2009-2014, termasuk salah satu sedikan presiden untuk menam- dengan kalimat yang amat tidak (Direskrim) Polda Sumut, Jl. Medan-Tanjung Morawa, pung laporan masyarakat. pantas. Akhirnya, lanjut dia, pe- ruddin Agur, S.Pd (GOLKAR), Asdar- wartawan harian ini barisan belakang dua dari kiri, Rahmad, bersiap sejak pukul 11.00 WIB. Juru Bicara Kepresidenan Andi san pendek berisi ancaman itu di- mansyah Mas (Golkar), Tgk. Hasan- mengambil posisi menjelang pengucapan sumpah/janji pada sidang Dalam pemeriksaan berlangsung, turut hadir Di- Mallarangeng di Kantor Kepresi- laporkan kepada pihak yang ber- sanusi (PPP), Kasmanuddin (PPP), rapat paripurna istimewa di gedung DPRK setempat, Senin (31/8). denan di Jakarta, Senin (31/8) me- wenang. rektur ATKP Medan Bambang Wijaya Putra, guna mene- Taufiq (PDI-P), Rapian SE (PDIP), mani sejumlah saksi dalam memberikan ketarangan ngatakan, ancaman itu disampai- Setelah polisi melakukan in- Ir. Zukrin Abidin (PPDK), Tgk. Tajri Isnurul Syamsul Arif, SH, M.Hum. lainnya dengan asal partai terma- kan guru tersebut terus menerus vestigasi dan Presiden Yudhoyono kepada tim penyidik. Lubis (PPDK), Sarman H. NK Satu dari 20 anggota DPRK Si- suk satu wartawan harian ini. 1 selama sebulan terakhir karena akhirnya memberikan maaf, pe- “ATKP Medan memberikan ruang seluas-luasnya (PPIB), Hasdianyasin Sarmadiah meulue yang dilantik kemarin, Aryaudin Partai Aceh (Partai Lo- depresi mengingat keluhannya ngirim pesan pendek itu pun di- kepada pihak penyidik dalam melakukan pemeriksaan (PD), Muhammad Hasbi M (PKPB). wartawan harian ini Rahmad. Tu- kal), 2. Marjakub Partai Aceh (Par- mengenai masalah perumahan- bebaskan oleh polisi. untuk mengusut kasus ini,” kata Bambang. Di sisi lain dalam waktu dan su- juh lagi anggota DPRK Simeulue tai Lokal), 3. M. Johan Jalla (GOL- nya yang terlewati Saluran Udara Pengirim pesan itu pun, me- Satu jam sebelumnya, tim penyidik juga memeriksa rat keputusan yang sama pula Ir- periode 2004-2009 yang telah di- KAR), 4. Iduarmin MK, SH (PD), 5. Tekanan Ekstra Tinggi (SUTET) nurut Andi, telah menyampaikan ayah korban, Isnanto, sebagai pihak yang pertama kali wandi meresmikan pengangkatan berhentikan dan kemudian diang- Rahmad (PPI), 6. Tgk. Hasan Sa- tidak mendapat tanggapan. penyesalan dan permohonan ma- menerima dan mengetahui kondisi jenazah Hendra 20 anggota DPRK Simeulue perio- kat lagi. M. Asdarmansyah Mas, SE nusi (PPP), 7. Rasmanudin H. Raha- “Sebulan terakhir, ada sms af melalui faksimili yang dikirim- Syahputra di Rumah Sakit Umum Pusat (RSUP) Haji de 2009-2014. Kemarin pengang- (GOLKAR), Sardinsyah (PBR), M. min, SE (PKS), 8. Kamaria (PKPB), awalnya marah-marah, kemudian kan oleh kuasa hukumnya. Adam Malik Medan, sebelum dibawa ke rumah duka di katan 20 anggota DPRK Simeulue Andi (PBR), Elydar Oesman (PAN), 9. Hasbi BA (PPRN), 10. Asna- Desa Bunut, Kisaran, Kabupaten Asahan, dua pekan lalu. dilanjutkan langsung dengan pe- Hasdianyasin Sarmadiah S,SP (PD), wi (PBB), 11. Ir. Mawardi Nasra, Kepala Polda Sumut Irjen Pol Badrodin Haiti menga- takan, tim penyidik saat ini sedang mengumpulkan in- ngucapan sumpah/janji oleh Ke- tua Pengadilan Negeri Sinabang, Taufiq (PDI-P), Rapian SE (PDI-P). 13 Anggota DPRK Simeulue MM (PIS), 12. Aryani, S.Pd (PDK), 13. M. Khoni B.Sc (PMB).(b07) Presiden Canangkan Arsip Masuk Desa formasi dari sejumlah saksi untuk mengetahui motif di JAKARTA, (Waspada): Presiden menjadi tonggak tertibnya penge- balik tewasnya Hendra Syahputra, termasuk menung- Susilo Bambang Yudhoyono men- lolaan arsip pemerintahan di ting- ng jumlah total 164 orang. sekolah apakah dibebankan juga gu hasil visum dari RSU Pirngadi Medan. 4.245 Tunjangan ... “Kami hanya bertugas mele- JTP nya 24 jam. canangkan Arsip Masuk Desa kat pedesaan seperti pertanahan, (AMD) di Gedung Arsip Nasional kelahiran, data kependudukan, “Sejumlah saksi sudah diperiksa, termasuk ayah pusat sejak Januari 2009 lalu. ngkapi berkas para guru, semen- Muhammad Ismail mengkri- Republik Indonesia, Jakarta, Senin penerima dana BLT, dan DPT agar korban sendiri. Polda juga sedang menunggu hasil visum Kasie Madrasah dan Pendidi- tara proses pencairan wewenang tisi, “Jangan sampai Depag kem- (31/8). persoalan kisruh DPT tidak ter- dari tim forensik. Biasanya hasil visum diperoleh sekitar kan Agama (Mapenda) Depag Kota Kanwil Depag provinsi, hanya sa- bali disorot sebagai lembaga yang paling tidak becus dalam menge- Pencanangan AMD ditandai ulang pada Pemilu 2014. sepuluh hari setelah kuburan korban dibongkar,” kata Lhokseumawe, Salman SPd, M.Ag ja berkas-berkas itu akan diveri- dengan pemberian laptop secara Selain mencanangkan AMD, Badrodin. ketika dimintai tanggapannya me- fikasi ulang oleh pihak Kanwil,” lola dana para guru, karena sela- ma ini Depag sudah dicap jelek simbolis kepada lima Kepala Desa Presiden juga meresmikan Diora- Pemeriksaan terhadap 16 saksi dari pihak ATKP dila- ngaku secara administrasi berkas ujar Salman. dari 33 desa di 33 provinsi se Indo- ma Sejarah Perjalanan Bangsa. guru-guru di lingkungan Depag Diakuinya, ada beberapa ken- oleh semua kalangan, bahkan kukan setelah keluarga Hendra Syahputra melakukan orang awam saja sudah tahu. Apa- nesia. Program AMD merupakan Diorama mengungkapkan proses pengaduan karena mencurigai kematian korban tidak Kota Lhokseumawe sudah selesai dala yang butuh perbaikan, dian- lagi dana sertifikasi ini jumlahnya sistem informasi pengelolaan ar- dinamika bangsa dari masa ke wajar. Kecurigaan tersebut timbul karena keluarga me- dikirim ke Kanwil Depag NAD. tarantanya adalah jam tatap muka mencapai puluhan miliar dan su- sip pedesaan yang merupakan masa yang ditampilkan melalui nemukan sejumlah luka pada jenazah korban, sesaat se- Rincinya, katanya, guru non PNS (JTP) yang belum sampai 24 jam. dah dikucurkan oleh pemerintah struktur pemerintahan paling perpaduan arsip, seni, dan tek- belum dimakamkan. sebanyak 21 orang, yang PNS seba- Hanya saja, ada sedikit masalah pusat sejak Januari lalu. Anehnya bawah. nologi. Diorama dibuka untuk nyak 94 orang, pendidikan agama bagaimana kalau statusnya kepa- hingga kini belum diterima tun- Program AMD diharapkan umum setiap hari. (kps) non PNS 6 orang dan PNS 43 ora- la sekolah, maupun wakil kepala jangan tersebut, ini bergantung ‘Alaqah ... kepada Kanwil Depag NAD Rah- (QS. al-Qiyamah:37). Ketahuilah, sesungguhnya kami telah man TB, mau menunda atau 15 Rekanan Pengadaan ... den, Madat. pembenahan dan penertiban dalam prosedur pengadaan alat utama menciptakan kamu dari tanah, kemudian dari setetes mani Senpi Buatan Jerman ... Kapolres mengatakan, senpi mencari jalan merealisasinya.” (nutfah), kemudian dari segumpal darah (‘alaqah), kemudian Kabid Mapenda Kanwil Depag sistem senjata, termasuk dalam kaitannya dengan pihak ketiga,” ujarnya. sepucuk senpi jenis FN warna asal luar negeri itu diduga keras NAD, Tatang Laksana kepada war- Hal itu, lanjut Juwono, penting terus dilakukan karena masih banyak dari segumpal daging (mudghah)...(al-Hajj:5) Dalam Surah putih popor kayu made in Jerman digunakan pelaku dalam aksinya tawan via handphone memban- rekanan atau pihak ketiga yang kerap melakukan penyimpangan, al-Mursalat disebutkan manusia diciptakan dari air yang hina. merek power di atas kandang ayam selama ini di pantai timur Aceh tah semua tudingan di atas. Dika- dengan menawarkan barang dan jasa militer yang tak sesuai dengan Menurut ahli kandungan (bidan dan dokter), ‘alaq atau miliki seorang warga. Saat ditemu- khususnya di perairan Aceh Ti- takannya, pihaknya sama sekali yang telah ditetapkan. ‘alaqah itu awalnya adalah sperma laki-laki yang terpancar kan senpi masih memiliki sarung- mur. Ketika disinggung identitas “Penyimpangan itu, terjadi hampir di setiap lini. Jadi, perlu terus tidak mengendapkan dana tunja- masuk dalam rahim perempuan, lalu bercampur dengan ovum. nya itu dimasukkan ke dalam pelaku, Ridwan Usman menolak ngan itu, dengan dalih bahwa dipantau dan ditertibkan,” ujarnya. Mani yang terpancar itu sangat banyak sampai 300 juta sper- sarung. Tujuh amunisi ditemukan menyebutkan demi penyelidikan masih banyak berkas yang belum Tentang ke-15 rekanan yang masuk daftar hitam dimaksud, Mente- matozoa, tetapi yang akan membuahi umumnya hanya pada sarungnya dan tiga di dalam dan pengejaran pelaku, namun diverifikasi. Bahkan berkas dari ri Pertahanan Juwono mengatakan belum bisa dipublikasikan. satu saja. magazen. nama pelaku telah dikantonginya. Aceh Barat belum sampai ke Kan- Dari hasil pembuahan ini terbentuklah zygot. Zygot ini Kapolres Aceh Timur, AKBP “Barang bukti berupa sepucuk wil. Namun demikian ia mengaku berkembang melalui bembelahan diri, yaitu satu menjadi akan mencairkan dana paling Deddy Corbuzier Tahu ... Drs. Ridwan Usman didampingi senpi, 11 amunisi, satu sepeda dua, dua menjadi empat, empat menjadi delapan, delapan Waka Polres Kompol Junaidi ketika motor, dan satu unit mobil sedan lambat akhir Agustus ini. Gue kerja bukannya hobi,” kilah Deddy. menjadi enam belas dan seterusnya sehingga menjadi sel- dikonfirmasi Waspada kemarin serta beberapa dokumen penting “Tidak benar kami mengen- Disinggung pula soal apakah pihak Mabes Polri telah meminta dapkan dana itu, memang sudah bantuannya untuk membantu menangkap para pelaku teror tersebut, sel yang banyaknya 64 sel. membenarkan pihaknya menga- termasuk identitas pelaku kita ada namun berkas para guru ha- Deddy juga tak mau menjawab tegas. “Yah itu tadi, tergantung baya- Dalam keadaan inilah zat calon manusia ini mencapai mankan sepucuk senpi buatan jer- telah kita amankan guna pengu- rus diverifikasi dulu apabila tidak rannya,” jawab singkat. rongga rahim untuk bersarang atau melekat seperti lintah. man bersama 11 amunisi. Diduga sutan lebih lanjut,” terang Kapol- lengkap akan kita kembalikan ke Mentalis identik dengan tampilan layaknya Kaisar Ming dalam film Inilah yang disebut ‘alaq atau ‘alaqah. Demikian tulis Prof Dr keras senpi itu miliki salah satu pe- res Ridwan Usman seraya menan- daerah untuk dilengkapi terlebih animasi Flash Gordon itu, kerap mencuri perhatian publik saat mela- Maurice Bucaille dalam buku: Bibel, Quran dan Sain Modern. laku yang menabrak korban di lin- daskan hasil yang diperoleh yang dahulu, setelah semuanya sudah kukan aksinya, seperti berhasil menebak headline surat kabar Kompas Maha benar Allah yang menciptakan. Menciptakan manu- tasan jalan negara Medan-Banda kesekian juga tak terlepas dari beres maka dana itu kita cairkan pada tahun 2003 dan 2008 lalu. Ia juga berhasil menebak hasil quick sia dari segumpal darah. Aceh persisnya di Desa Paya Na- bantuan masyarakat.(cmad) segera,” ujar Tatang.(cmun) count salah satu lembaga survei usai Pilpres, Juli lalu. (kps)
  • 3. WASPADA Selasa, 1 September 2009 Luar Negeri 3 Serangan Taliban Bakar 12 Truk NATO Di Pakistan NATO, sehingga memicu keba- bahwa ratusan truk, banyak yang sejak gerilyawan Baluchistan QUETTA, Pakistan karan dan dengan cepat menelan dimuati dengan persediaan munculpada2004gunameminta (Antara/AFP): Ledakan bom lebihdari12kendaraan,jelaspolisi NATO, telah menunggu di sisi otonomi politik dan bagian lebih ChamanSardarHasanMusakhel. perbatasan Pakistan pada dua besar dari keuntungan dari di kota Chaman di Pakistan “Sekarang, sulit untuk me- hari terakhir karena perselisihan sumber alam wilayah itu. barat-dekat perbatasan nyebutkan jumlah tepatnya ken- dengan para pejabat pajak yang Pakistan telah dihantam oleh daraan yang rusak akibat keba- berhubungan dengan pemerik- serangkaian ledakan bom terkait- Afghanistan membakar karan itu karena upaya sedang saan barang. Taliban, ketika kekhawatiran beberapa truk yang berisi berlangsung untuk memadam- Dia menambahkan bahwa meningkatbahwagerilyawansulit kan kebakaran tersebut,” ujar tidakadaorangyangtelahmenya- menuntut balas atas serangan bahan persediaan untuk Musakhel, yang menambahkan takan bertanggung-jawab atas militer terhadap mereka di tiga pasukan NATO di Afghani- bahwabelumadalaporanmenge- insidendiChaman,saahsatukota distrik Pakistan baratlaut. nai korban manusia dalam sera- penting di provinsi Baluchistan, Bagian terbesar dari pasokan stan, kata polisi. ngan Minggu (30/8) malam itu. yang kaya akan minyak dan gas dan peralatan yang diminta oleh Chaman adalah satu dari dua dan berbatasan dengan Iran dan tentara asing di seberang perba- tempat perlintasan bagi pasokan Afghanistan. Seorang jurubicara tasan adalah diangkut melalui untuk pasukan asing pimpinan- paramiliter Korps Perbatasan, daerah suku Khyber di Pakistan Bom itu ditempatkan di NATO dan AS yang memerangi Murtaza Baig, mengkonfirmasi baratlaut, tempat gerilyawan bawah mobil tangki yang mem- gerilyawan di Afghanistan. insiden itu. Taliban telah melakukan serang- bawa bahan bakar untuk tentara Musakhel mengatakan Ratusan orang telah tewas kaian serangan terhadap truk. The Associated Press Yang Dipertuan Agung Sultan Mizan Zainal Abidin (kanan) dan PM Najib Razak Inggris Hancurkan Helikopter PERAYAAN ULANG TAHUN KEMERDEKAAN melambaikan bendera Malaysia pada perayaan Ulangtahun ke-52 Kemerdekaan Malaysia di Gedung Parlemen di Kuala Lumpur, Malaysia, Senin (31/8). Peringatan Hari Nasional Malaysia pekan ini telah diwarnai dengan berbagai masalah rasial Di Afghanistan Karena Rusak MALAYSIA di tengah kecemasan kelompok etnis minoritas. LONDON, Inggris (Antara/ oleh Taliban. Sebelumnya bulan bahwa seorang prajurit Inggris pengorbanan yang lebih besar Reuters/AFP): Pasukan Inggris inipasukanjugamenghancurkan tewas dalam ledakan di Afghani- daripada ini.” Keluarga dekat Vietnam Beri Amnesti Perayaan Ultah Kemerdekaan di Afghanistan menghancurkan salah satu helikopternya setelah sebuah helikopter Chinook Inggris yang jatuh setelah keba- stan selatan pada Sabtu. Prajurit Marinir itu sedang melakukan prajurit itu telah diberi tahu me- ngenai kematiannya. Lebih 5.000 Tahanan rusak ketika melakukan penda- karan mesin. Kementerian itu patroli jalan kaki di Gereshk di Prajurit itu tewas ketika Per- HANOI, Vietnam (AP): Vietnam akan membebaskan lebih 5.000 tahanan sebagai Malaysia Berlangsung Sederhana ratan,dalaminsidenkeduasema- cam itu dalam sebulan ini, demi- kian diumumkan Kementerian tidak menyebutkan berapa ba- nyak helikopter Chinook Inggris yangmasihberadadiAfghanistan provinsi Helmand, sebuah markas Taliban, ketika ia tewas akibat ledakan tersebut. dana Menteri Inggris Gordon Brown melakukan kunjungan mendadak ke Helmand pada bagian dari amnesty tahunan, namun tidak KUALA LUMPUR, Malaysia (Antara): kali diadakan di kawasan gedung parlemen. Pertahanan Inggris. namunmengatakan,mitra-mitra Seorang jurubicara Satuan Sabtu untuk melihat pasukan untukseorangpendetayangsejumlahsenator Peringatan Hari Kemerdekaan ke-52 Para menteri hadir menggunakan baju Empat orang awak dan 15 NATO akan berikan perlin- Tugas Helmand Letkol Nick Inggris.Dengankematianmarinir AS kampanyekkan untuk dibebaskan, kata KerajaanMalaysiayangjatuhpada31Agustus safari biru kelam lengan pendek dan meng- prajurit yang berada di dalam dungan jangka pendek sebelum Richardson mengatakan, “Mari- itu, jumlah prajurit Inggris yang seorang pejabat Senin (31/8). 2009 dirayakan secara sederhana dan singkat, gunakan topi dengan simbol angka 1 (satu) heliopter Chinook itu selamat Chinook itu digantikan. nir ini mengorbankan jiwanya tewas di Afghanistan menjadi 208 Presiden Nguyen MinhTriet akan mem- 30 menit, di gedung parlemen karena jatuh yang menjadi motto pemerintahan Najib tanpa cedera setelah“pendaratan Kementerian Pertahanan demi negara ini dan kebebasan sejak invasi pimpinan AS pada pada bulan Ramadhan (puasa) dan merebak- Tun Razak 1 Malaysia, sementaraYang Diper- keras” di dekat Sangin di provinsi Inggris juga mengumumkan rakyat Afghanistan, tidak ada 2001. bebaskan5,459tahananuntukmemperingati nya H1N1. tuan Agung mengenakan pakaian angkatan Hari Nasional yang jatuh pada Rabu (2/9), Helmand, yang rusak bagian Upacara ulangtahun kemerdekaan ke- darat. bawah, hidung dan baling-baling kataWakil Menteri Keamanan Publik Le The 52 ini dipimpin olehYang Dipertuan Agung Upacara kemerdekaan yang dilakukan Tiem kepada wartawan pada satu konferensi pers. Malaysia Mizan Zainal Abidin dan dihadiri oleh PM Malaysia Najib Tun Razak, seluruh secara sederhana dan singkat itu meliputi penghormatan kepada Yang Dipertuan depan, sehingga pesawat itu tidak bisa diterbangkan lagi. Wartawan Sri Lanka Dihukum 20 Tahun Penjara Namun, Tiem mengatakan pendeta Pasukan yang dibawa ke menteridanparadutabesardihalamanparkir Agung sambil menyanyikan lagu kebangsaan daerah itu bisa melanjutkan ope- KOLOMBO, Sri Lanka (AP): di tahun 2006 dan 2007 menge- kan untuk menciptakan Katholik Nguyen Van Ly, yang dihukum gedung parlemen Malaysia, Kuala Lumpur, Negaraku.Yang Dipertuan Agung kemudian Satu pengadilan Sri Lanka Senin cam tindakan pemerintah dalam kekacauan di masyarakat. Hakim delapan tahun penjara di tahun 2007 karena rasi mereka dan awak Chinook Senin (31/8). memeriksa pasukan upacara setelah itu (31/8) menjatuhkan hukuman perang itu dan menuduh pihak juga menyatakan wartawan itu melakukan kegiatan anti-pemerintah setelah Para mantan PM Malaysia seperti Maha- disusul pengibaran bendera Malaysia. tersebut diangkut dengan sebuah helikopter lain. Kementerian 20 tahun penjara berdasarkan berwenang tidak mengijinkan bersalah mendapatkan uang dari dia ikut merencanakan pesta pro demokrasi, thir Mohamad dan Abdullah Badawi tidak Biasanya diadakan parade dari masing- hukum anti-terorisme terhadap masukknya bahan pangan dan publikasi artikel yang melanggar tidak akan dibebaskan kali ini karena kurang- ada yang hadir. Begitu pula tokoh oposisi masing tentera perang dan instansi Malaysia, Pertahanan Inggris mengatakan Minggu (30/8), tidak ada bukti seorang wartawan karena me- barangkebutuhanpentinglainnya hukum anti-teror. Sri Lanka me- nya ‘rasa bersalah’. (m18) Anwar Ibrahim dan Lim Kit Siang tidak hadir namun kali ini hanya dilakukan parade nyiarkan artikel yang mengecam ke wilayah kekuasaan Tamil naklukkan pemberontak Macan pada upacara kemerdekaan yang pertama bendera oleh para pelajar Malaysia. yang menunjukkan bahwa insi- den itu disebabkan oleh aksi perang pemerintah atas pem- sebagai alat perang. Tamil Mei lalu guna mengakhiri AS Bebaskan Lebih musuh. berontak Macan Tamil. Artikel tulisan J.S. Tissai- Hakim Pengadilan Tinggi DeepaliWijesundaramengatakan 25 tahun perjuangan mereka un- tuk menciptakan negara mer- 5.000 Tawanan Irak Pakistan: 30 Taliban Tewas Chinookitukemudiandihan- curkan untuk mencegah agar helikopter tersebut tidak dikuasai nayagam itu yang disiarkan di majalah Northeastern Monthly artikel Tissainayagam melanggar hukum anti-teror karena dituju- deka. Konflik tersebut menewas- kan 80.000 – 100.000 orang.(m18) BAGHDAD, Irak (Antara/AFP): Militer AS mengatakan, mereka telah membebaskan Dalam Pertempuran Di Swat lebih 5.000 tawanan Irak sejak awal tahun ini, sejalan dengan perjanjian keamanan yang ISLAMABAD, Pakistan (AP): Tentara untuk menguasai kembali wilayah yang ditandatangani antara Baghdad danWash- Pakistan menewaskan sedikitnya 30 militan dicaplokmilitantTaliban.Begitupun,serangan ington. Taliban dalam pertempuran di Lembah Swat bunuh diri dan pertempuran kecil masih “SejakJanuari,1.179tahanantelahdiserah- setelah bom bunuh diri di luar kantor polisi terus terjadi. terimakan kepada pemerintah Irak dengan menewaskan17calonpolisi,katapihakmiliter Korban tewas dalam serangan bunuh surat perintah penangkapan atau penahanan Senin (31/8). diriMinggumeningkatmenjadi17jiwasetelah yang sah, dan 5.236 tawanan telah dibebas- Para tentara mengejar para militant seorang korban cedera akhirnya meninggal kan,” kata satu pernyataan Minggu (30/8). setelah pemboman itu mendapat perla- dunia, kata pejabat rumahsakit Ikram Khan. Perjanjian Status Kekuatan (SOFA), yang wanandibeberapawilayahdanpertempuran Pembom bunuh diri menyusup ke halaman ditandatanganiantaraIrakdanAS,November berlangsung dari malam sampai Senin pagi, kantor polisi di kota utama Mingora dan lalu, meminta berkas semua tahanan di kata jubir tentara Kolonel Akhtar Abbas. meledakkan bom di dekat sukarelawan yang penjara Amerika yang akan diserahkan “Pasukan keamanan berhasil mengepung menjalani latihan. Serangan itu paling kepada pemerintah Irak, yang kemudian sekelompokmilitandisanadanpertempuran mematikan sejak militer menguasai sebagian dapat memutuskan nasib mereka. bergelora,” katanya, sambil menambahkan besar Swat Juli lalu. Secara keseluruhan, 8.947 orang masih 30 militan tewas. Pejabat Pakistan menudingTaliban seba- ditahan di tiga penjara yang dikelola oleh Satu pernyataan tentara terpisah menga- gai pelaku pemboman, dengan mengatakan pasukan AS di Kamp Cropper dan Kamp takan seorang tentara tewas dalam pertem- kelompok itu melancarkan serangan untuk Taji, yang berada di Baghdad dan sekitarnya, puran di tiga wilayah berbeda. Militer me- membalas kematian pemimpin mereka serta Kamp Bucca —yang terletak di Irak ngatakan pihaknya memperkuat keamanan dalam serangan rudal CIA dekat perbatasan selatan, jelas pernyataan itu. di Swat setelah operasi selama tiga bulan Afghanistan.(m18) Kolombia Ingatkan Pemimpin Amerika Selatan, Uribe Tertular Flu Babi BOGOTA, Kolombia (AP): sepenuhnya baik-baik saja saat pertama yang diketahui telah rutinnya setelah bekerja dari Presiden Kolombia Alvaro Uribe ini,” kata Palacio. terserang flu babi. Dia pulih awal rumah selama sekitar satu pekan menderita flu babi dan para peja- Presiden Kosta Rika Oscar Agustus dari gejala ringan virus sewaktu menjalani perawatan. batmengingatkanparapemimpin Arias adalah kepala pemerintah itu dan kembali menjalani tugas (m07) Amerika Selatan yang bertemu dengannya di satu KTT tentang infeksi virus H1N1, demikian menurut pihak berwenang Minggu (Senin 31/8 WIB). Presiden Uribe, 57, merasa- kan adanya gejala demam Jumat, hari yang sama dengan satu per- temuan para presiden Amerika Utara di Bariloche, Argentina, dan dia ditegaskan mengalami serangan flu babi sekembalinya di Kolombia, demikian menurut Menteri Perlindungan Sosial Diego Palacio. Uribe,seorangsekutupenting AS di Amerika Latin, dianggap pasien berisiko tinggi dan akan terus bekerja dari komputernya, demikian menurut sejumlah pejabat. Para pemimpin yang ber- temu dengan Uribe pada pertemuan puncak itu telah dibe- ritahu mengenai infeksi yang dialami Uribe, kata Velasquez. “Presiden terserang gejala penyakit ini, kemajuannya positif saat ini,” kata Palacio. Dia me- nyatakan Uribe terus melaksana- kan tugas normalnya sebagai Presiden kendati menjalani perawatan medis dan dikaran- tinakan secara sukarela. “Dia (Presiden) bekerja melalui telefon dan Internet,” kata jurubicara pemerintah Cesar Velasquez pada hari yang sama. “Kami, pejabat pemerintah, mengadakan kontak dengan Presiden. Saya tiga menit lalu menerima keterangan paling akhir mengenai kondisinya, dan kami diberitahu bahwa ia
  • 4. 4 Nusantara WASPADA Selasa 1 September 2009 DPR Keberatan Harga Raskin Dinaikkan JAKARTA (Waspada): Ko- Pada rapat dipimpin ketua Postur anggaran dengan pemerintah daerah, misi IV DPR RI menyatakan Komisi Arifin Junaedi itu, dengan Sementara Komisi VIII me- sehingga dapat dicapai target dan keberatan atas usulan kenai- lantang politisi dari Sumut ini nilai postur anggaran 2010 be- sasaran sesuai direncanakan. kan harga jual beras untuk menyatakan keberatan, terlebih lum berpihak pada pemberda- Menurutnya, dalam me- masyarakat miskin (raskin) raskin memang merupakan hak yaan sosial, karena alokasi nyusun rencana kerja dan ang- pada 2010. Keberatan itu di- masyarakat. “Kalau harga tebus anggaran yang tersedia tidak garan tahun 2010 hendaknya sampaikan saat rapat dengar dinaikkan, semakin nyata bahwa sebanding dengan jangkauan disusun proposional dengan pendapat (RDP) dengan pemerintah menjadi rentenir masalah kesejahteraan sosial indikator rasa keadilan, jumlah Perum Bulog di DPR Jakarta, bagi masyarakat,” tandasnya. yang hendak diatasi. Disebut- penduduk, permasalahan sosial Senin (31/8). Sementara harga jual raskin kan, alokasi anggaran Ditjen daerah setempat serta mem- dinaikkan lanjutnya, harga Pemberdayaan Sosial Depsos pertimbangkan daya serap. “Kita sudah setujui harga pokok produksi (HPP) petani 2010 justru turun Rp67,038 juta Komisi VIII juga sepakat jual raskin Rp1.600. Tolong selalu diasumsikan tetap. Hal atau turun 0,01% dibandingkan dengan Dirjen Pemberdayaan jangan diutik-utik. Ini kewajiban ini semakin membenarkan ke- anggaran 2009. Sosial Depsos dalam menyusun negara, pemerintah jangan san pemerintah adalah rentenir Hal itu terungkap pada rincian RKA-KL 2010 lebih berdagang,” tegas Idham, dimata petani. “Kok selalu terus rapat dengar pendapat Komisi memfokuskan pada program anggota Komisi IV dari Fraksi saja diasumsikan tetap, apakah VIII DPR dengan Dirjen pemberdayaan komunitas adat PDIP. Menurutnya, dengan pemerintah tidak pernah meli- Pemberdayaan Sosial Depsos terpencil (KAT) untuk diperluas harga Rp1.600 saja, masyarakat hat kondisi lapangan,” tanyanya. dalam pembahasan rencana jangkauannya di daerah perba- terutama di daerah banyak yang Sebagai keluarga petani yang kerja anggaran kementerian/ tasan dengan negara tetangga ‘menangis’ karena tidak mampu masih aktif, Idham mengaku lembaga (RKA-KL) 2010. dan pulau-pulau terpencil dan Antara menebus beras raskin, apalagi tahu persis berapa HPP yang Wakil Ketua Komisi VIII, terluar, serta perbatasan antar UJI MAKANAN: Tiga orang petugas melakukan tes laboratorium pada produk daging segar di salah satu pusat perbelanjaan jika harga itu dinaikkan hingga dikeluarkan petani hingga men- Chairunnisa mendesak Dirjen daerah, sehingga out put dari di Bogor, Jawa Barat, Senin (31/8). Tes laboratorium itu untuk menguji makanan yang layak atau tidak untuk dikonsumsi manusia. 35 persen. capai panen. “Saya tidak men- Pemberdayaan Sosial agar program itu dapat meningkat- dorong HPP menjadi berapa, dalam melaksanakan program kan kesejahteraan, memperkuat tapi tolong pemerintah meneliti dan anggaran 2010 meningkat- semangat kebangsaan dan SMK Dukung di lapangan itu seperti apa,” kan koordinasi lintas sektor atau ketahanan sosial masyarakat Pemerintah Diminta Membangun Pengembangan tukasnya Laporan ke: 20 antar departemen, termasuk perbatasan.(aya) Infrastruktur Aceh Ekonomi Kreatif JAKARTA (Waspada): Seko- DOMPET PEDULI UMMAT WASPADA JAKARTA (Waspada): Ang- menyangkut bidang Komisi V. Kepada Menhub Jusman taan Wapres Jusuf Kalla, dalam lah Menengah Kejuruan (SMK) Setiap sedeqah yang kita salurkan di jalan Allah akan menjadikan pelindung kita dari gota Komisi V DPR Marzuki Marzuki menyatakan, dia Syafii Djamal, Marzuki meminta susunan kabinet sudah ada 4 menjadi salah satu elemen api neraka. Salurkan Zakat, Infaq dan Shadaqah Anda ke lembaga yang Amanah, Daud meminta pemerintah se- khawatir jika pemerintah agar pembngunan pelabuhan menteri berasal dari Aceh, ma- pendidikan yang mendukung Profesional & Transparan gera membangun infrastruktur mengabaikan pembangunan di beberapa kab/kota harus sak tidak mampu membangun pengembangan ekonomi Transfer via bank, AC. Peduli Ummat Waspada di seluruh Aceh, guna mendu- infrastruktur yang sejak terjadi dibangun dengan APBN 2010. Aceh.” kreatif. Hal itu sesuai instruksi presiden (inpres) No. 6/2009 Zakat Infak/Sedekah kung kemajuan Aceh lahir dan tsunami belum tersentuh, Dia juga meminta Menpera Sementara, anggota Komisi tentang pengembangan eko- BMI 211.00002.15 BMI 211.00044.15 bathin. “Saya berharap kepada terutama di kawasan pantai Yusuf Asyari dan Menteri PDT V lainnya menyoroti rusaknya nomi kreatif di Indonesia. BSM 006.0022407 BSM 006.0008321 Menteri Pekerjaan Umum Joko barat. “Minimal dibutuhkan Lukman Eddy membangun jalan darat lintas timur dan barat Direktur Pembinaan SMK BCA 022.1750828 BNI 005.7504808 Kirmanto segera mempriori- Rp800 miliar untuk pembangu- perumahan di Aceh. Sumatera. Begitu juga di daerah Departemen Pendidikan Nasio- BNI Syariah 0092687629 Bank Sumut 100.02.04.034144.5 taskan pembangunan infra- nan jalan dan jembatan di Mengenai pembangunan lain, para anggota dewan mene- nal (Depdiknas), Joko Sutrisno Bank Mandiri 106.0002203803 struktur di Aceh, karena BRR seluruh Aceh,” ungkapnya. pelabuhan international Sabang, gaskan perlunya keadilan pem- belum berhasil membangun- Politisi dari Fraksi Partai dia minta UU No. 37 tentang ba- bangunanjalanberasaskanNKRI. mengatakan, ada 14 bidang pe- ZIS terpublikasi 1 Januari 2009 s/d laporan 19 Rp 516.288.170 nya,” ujar Marzuki Daud dalam Golkar (FPG) itu mengatakan, dan pengelola pelabuhan bebas Selain itu, mereka meng- ngembangan ekonomi kreatif rapat kerja gabungan Komisi sebaiknya untuk APBN 2010 Sabang (BPKS) tidak dicabut. ingatkan Menhub segera me- yang digariskan pemerintah ZIS ZIS V DPR RI dengan Menteri PU, pembangunan infrastruktur “Kalau UU-nya dicabut, kawa- ngeluarkan PP terhadap Pelin- lewat inpres 6/2009 yakni Rp 31.950.700 Menteri Perhubungan, Menneg Dinas Bina Marga Provinsi Aceh san itu tidak berarti lagi,” katanya. do. “Tanpa PP, Pelindo sudah periklanan, arsitektur, pasar seni, kerajinan, desain, fashion, film 1343. PT. IKL - Medan Rp 15,360,000 1373. H. Erwin Rajasah - IPM Socfindo Rp 100,000 Perumahan Rakyat, Menneg bisa meningkat dari anggaran Menanggapi laporan Men- menjadi raja kecil di pelabuhan dan video, fotografi, games/ 1344. LPI Dompet Dhuafa - Jakarta Rp 9,900,000 1374. H. Husni Nasution - IPM Socfindo Rp 100,000 Daerah Tertinggal dan Basarnas 2009. Begitu juga pembangu- teri Negara Daerah Tertinggal dan banyak merugikan pemakai 1345. Sabaruddin Lubis - Medan Rp 2,500,000 1375. H. Pepep Permadi - IPM Socfindo Rp 100,000 di Jakarta, Kamis (27/8). nan jaringan irigasi harus men- mengatakan Aceh Utara sudah jasa pelabuhan. PP itu perlu animasi, musik,seni pertunju- kan, penerbitan, radio dan te- 1346. Trisno Sumantri - BSM Medan Rp 300,000 1376. Marzuki - IPM Socfindo Rp 100,000 Raker gabungan itu dalam jadi prioritas merata di seluruh maju, Marzuki mengkoreksi dikeluarkan bahwa yang berhak 1347. H. Ismali Andrian-IPM Socfindo Rp 250,000 1377. Bambang S. Hidayat-IPM Socfindo Rp 100,000 rangka membicarakan masalah Aceh, sehingga meningkatkan penilaian itu cuma di kotanya bukan sepenuhnya Pelindo,” levisi serta program komputer. 1348. Sujarwo - Kanwil Direktorat Pajak Sumut I 1378. Drs. Usman - PT. PP. Lonsum Rp 75,000 anggaran dengan pemerintah pendapatan petani. saja. “Saya mengulang pernya- Efiardi.(j07) “Dari semua bidang itu, Rp 249,750 1379. Hasan Bisri Kasyhuri-IPM SocfindoRp 75,000 hampir seluruhnya sudah men- 1349. Kusno - Kanwil Direktorat Pajak Sumut I 1380. H. Gogor Samaritaan-IPM SocfindoRp 70,000 jadi bidang kehalian yang diajar- Rp 249,750 1381. Adji Indra Prapanca-IPM SocfindoRp 62,500 Komponen Bangsa Harus Ikut Berantas Terorisme kan secara khusus di seluruh SMK di Indonesia,” kata Joko 1350. Kamal Sidik - PT. PP. Lonsum Rp 200,000 1351. H. Emmir Pramudya - PT. PP. Lonsum 1382. Rahmi Putri - PT. PP. Lonsum Rp 60,000 1383. Drs. Rahmat Nauli, M.Si/Unimed - Pbk BNI di Jakarta, Senin (31/8). Rp 200,000 Rp 50,000 JAKARTA (Waspada): Se- rapkan aksi terorisme di Indo- dapat terjadi karena adanya pelibatan TNI,” katanya. Dikatakannya, saat ini ada 1352. H. Syafril - IPM Socfindo Rp 200,000 1384. H. Akhmad Khairi Lubis - PT. PP. Lonsum jumlah anggota Komisi I DPR nesia segera berakhir. Dia meni- ketidakadilan. Semakin kompleksnya per- 7.800 SMK di Indonesia. Dari 1353. Hamba Allah - Waspada Medan Rp 200,000 Rp 50,000 meminta pemerintah melibat- lai sampai saat ini aksi terorisme Sementara, Menkopol- masalahan terorisme, Widodo jumlah itu, sekira 4.800 dianta- 1354. Andri Setiawan - Kanwil Direktorat 1385. Syafii Harahap - PT. PP. Lonsum Rp 50,000 kan seluruh komponen bangsa belum dapat diatasi karena hukamWidodo AS menjelaskan mengajak kalangan DPR mem- ranya memiliki program Pajak Sumut I Rp 184,950 1386. Dewi Saviah Lubis-PT. PP. Lonsum Rp 50,000 memberantas aksi terorisme seluruh komponen bangsa tidak bahwa pelibatan TNI dalam pertimbangkan dilakukannya kehalian yang masuk daftar 1355. Wendra - Kanwil Direktorat Pajak Sumut I 1387. Dani Ariadi - IPM Socfindo Rp 50,000 di Indonesia. Hal itu disampai- dilibatkan. “Terorisme tidak upaya pemberantasan teroris- revisi UU No. 15/2003 tentang program pengembangan Rp 178,000 1388. Zulfan Fahmi Lubis-IPM Socfindo Rp 50,000 kan saat rapat kerja Komisi I dapat diatasi hanya dengan satu me harus dipayungi undang- pemberantasan tindak pidana industri kreatif. 1356. Yose Rizal - IPM Socfindo Rp 175,000 1389. Nina Safrina - Kanwil Direktorat Pajak Sumut I DPR dengan jajaran Menko- sektor saja,” tegasnya. undang. “TNI akan dilibatkan terorisme. “Revisi itu utamanya SMK juga bersiap melebar- 1357. M. Rafik - PT. PP. Lonsum Rp 150,000 Rp 46,000 polhukam, dipimpin Ketua Ko- Hal senada disampaikan bila ada permintaan dari Polri,” untuk hal-hal yang terkait de- kan akses dengan mendirikan 1358. Erwanda Surya - IPM Socfindo Rp 150,000 1390. Dona - Kanwil Direktorat Pajak Sumut I misi Theo L Sambuaga didam- Pupung Suharis (F-PDIP). Dia kata dia menyebutkan, permin- ngan posisi serta peran intelijen SMK Terbuka (SMKT). Pada ta- 1359. Heru Darmawan-IPM Socfindo Rp 150,000 Rp 46,000 pingi Wakil Ketua Yusron Ihza mengusulkan agar presiden taan bantuan itu harus pada dan Polri agar dapat secara hun ajaran baru 2010, sedikitnya 1360. Drs. H.M. Rusli Pulungan & Almh. Hj. Nurinah Srg 1391. Dra. Martina Restuati, M. Si/Unimed - Pbk BNI Mahendra, Sidarto Danusubro- segera membuat instruksi khu- skala dan eskalasi ancaman teror maksimal dan efektif mena- - Medan Rp 130,000 Rp 40,000 60 ribu lulusan SMP Terbuka 1361. Irwan Sa’ban - IPM Socfindo Rp 120,000 to, Arief Mudatsir Mandan dan sus menangani terorisme. “Saya tertentu. “Contohnya pemba- ngani terorisme,” katanya. 1392. Khairina Masitah - Kanwil Direktorat Pajak bisa mendaftar ke SMKT. SMKT 1362. Abdi Timur - Kanwil Direktorat Pajak Sumut I Sumut I Rp 38,500 Guntur Sasono di ruang rapat mengusulkan presiden mem- jakan kapal di laut lepas, pem- Widodo menegaskan bah- akan berlokasi di beberapa titik Komisi I, Senin (31/8). buat instruksi khusus terhadap bajakan pesawat terbang, pe- wa terorisme sebagai kejahatan Rp 103,250 1393. Yulian Kamahendra-IPM SocfindoRp 30,000 dan menempati bangunan serta 1363. Prof. Haidar Putra Daulay/IAINSU - Pbk BMI 1394. Rosmiati Lubis-IPM Socfindo Rp 30,000 Anggota Komisi I, Afifuddin penanganan terorisme,” kata- nyanderaan di daerah terpencil kemanusiaan yang luar biasa alat yang ada di SMK Rintisan Rp 100,000 1395. Dr. Hj. Siti Zubaidah/IAINSU - Pbk BMI Thaib (F-PG) mendesak peme- nya. Dalam pertemuan itu, dan penggunaan senjata merupakan ancaman nyata, Sekolah Berstandar Interna- 1364. M. Harry Nuryadin - PT. PP. Lonsum Rp 25,000 rintah menggunakan seluruh Pupung menyatakan sepakat pemusnah massal.” aktif dan serius. Karenanya, sional (RSBI) Rp 100,000 1396. Abd. Rahman - IPM Socfindo Rp 25,000 komponen yang dimiliki untuk bila pemerintah melibatkan TNI Widodo mengatakan bahwa untuk mengatasinya dibutuh- “Untuk sementara, baru ada 1365. Ahmad Dahlan Harahap - PT. PP. Lonsum 1397. Dwijo Gunarso - IPM Socfindo Rp 25,000 memerangi terorisme. ”Banyak menangani aksi terorisme. peraturan yang melibatkan TNI kan komitmen seluruh kom- di 5-10 titik. Tentunya baru di Rp 100,000 1398. Muhammad Fuad - IPM Socfindo Rp 25,000 komponen bangsa yang mam- “Saya setuju TNI dilibatkan.” dalam penanganan teror yakni ponen bangsa dan masyarakat. beberapa kota besar seperti 1366. Mhd. Rezky Prananda - PT. PP. Lonsum 1399. Syahrizal - IPM Socfindo Rp 25,000 pu, tapi tidak dilibatkan. Misalkan Nurhayati Assegaf (F-PD) UU No. 2/2002 tentang kepo- Komitmen itu perlu diwujudkan Jakarta, Medan, Surabaya dan Rp 100,000 1400. Dra. Nurmalis, M. Si/Unimed - Pbk BNI TNI dan alim ulama,” katanya. menilai terorisme merupakan lisian dan UU No. 34 tentang dalam kerja nyata yang kontri- Makassar. Tujuannya agar siswa 1367. Kurniaty - PT. PP. Lonsum Rp 100,000 Rp 20,000 Kata dia, dengan meman- kejahatan yang berkaitan TNI. “UU itu memberikan ruang butif sesuai profesi masing- SMPT bisa meneruskan sekolah 1368. Fahrizal - PT. PP. Lonsum Rp 100,000 1401. Dr. H. Fachruddin, MA/IAINSU - Pbk BMI faatkan komponen bangsa dengan kelompok. Salah satu perumusan bersama tentang masing dalam upaya bersama sesuai minat dan keahliannya,” 1369. Mhd. Waras - PT. PP. Lonsum Rp 100,000 Rp 10,000 memberantas terorisme, diha- penyebab aksi teror kata dia, mekanisme dan prosedur secara nasional.(aya) kata Joko.(dianw) 1370. Dr. H. Amiur Nuruddin, MA/AINSU - Pbk BMI 1402. Mhd. Aswin - Pbk BMI Rp 10,000 Rp 100,000 1371. Dr. Hj. Dahlia Lubis, M.Ag/IAINSU - Pbk BMI Catatan Peristiwa Penting Agustus 2009 Rp 100,000 1372. Eko Dermawan - IPM Socfindo Rp 100,000 3 Agustus: Gaji PNS Dan TNI-Polri Naik Lima Persen keterangan persnya di RS Polri Sukanto, Kramat Jati, Jakarta Timur, Rabu (12/ Jumlah laporan ke: 20 Rp 33.478.700 Presiden Susilo Bambang Yudhoyono mengungkapkan gaji pegawai negeri 8). Kepastian mayat Ibrohim setelah melalui test DNA yang diambil dari keluarga sipil dan prajurit TNI serta Polri, dan pensiunan pada tahun 2010 akan dinaikkan Ibrohim. “Setelah dibandingkan DNA dengan keluarga di Cilimus, istri dan kedua PENYALURAN DANA BULAN JULI 2009 rata-rata lima persen, guna memperbaiki penghasilan mereka. “Alokasi anggaran putra serta putrinya, hasilnya sesuai 100 persen. Almarhum adalah Ibrohim,” NO KETERANGAN JUMLAH antara lain untuk memperbaiki penghasilan aparatur negara dan pensiunan kata Eddy Saparwoko. Mantan Kepala Dokes Polda Metro Jaya itu mengatakan, melalui kenaikan gaji pokok dan pensiunan pokok, pemberian gaji dan pensiunan tes DNA pembanding juga telah dilakukan pihak kedokteran RS Polri dengan 1. Bantuan musafir untuk Abd. Manaf Sitanggang, Desa Batu Karang, Kec. Payung, Kab. Karo Rp 100,000 bulan ke-13, kenaikan uang makan/lauk pauk bagi TNI-Polri dari Rp35.000/ keluarga Noordin M Top di Johor Bahru Malaysia dan Cilacap serta Klaten, 2. Bantuan pendidikan untuk Yodi K.L. Effendi, Jl. A.R. Hakim Gg. Keluarga No. 432-F Medan Rp 350,000 hari menjadi Rp40.000/hari kerja,” kata Presiden ketika menyampaikan Pidato Jawa Tengah. Namun hasilnya negatif. “Sama sekali tidak ada yang sesuai DNA 3. Bantuan pengobatan untuk Rahmah, Jl. Jermal No. 15 Medan Rp 200,000 Pengantar RAPBN 2010 dan Nota Keuangan di depan Rapat Paripurna Luar jenazah itu dengan keluarga Noordin M Top,” kata Edy. 4. Bantuan pengobatan untuk Rasima, Jl. Amaliun Gg. Abadi No. 262-D Medan Rp 200,000 Biasa DPR di Jakarta, Senin (3/8). Pidato pengantar RAPBN biasanya disampaikan 5. Bantuan pendidikan untuk Fadli Adha, Jl. Amaliun Gg. Abadi No. 5 Medan Rp 240,000 pada tanggal 15 atau 16 Agustus, yakni beberapa hari menjelang peringatan 18 Agustus: KPU Tetapkan SBY-Boediono Presiden-Wapres Terpilih 2009 6. Bantuan pengobatan untuk Nuraisyah, Jl. Kp. Aur Lembah No. 3 Medan Rp 500,000 hari ulang tahun Republik Indonesia. 5- Komisi Pemilihan Umum (KPU) di Jakarta menetapkan pasangan Susilo 7. Bantuan pengobatan untuk Nurhalizah, Jl. Kp. Aur No. 18 Medan Rp 500,000 8. Bantuan mustahik untuk M. Ridwansyah, Jl. Persatuan No. 11 Medan Rp 350,000 Bambang Yudhoyono-Boediono, sebagai presiden dan wakil presiden terpilih 9. Bantuan pengobatan untuk Cancim. Jl. Kp. Aur No. 26 Medan Rp 500,000 4 Agustus: Mbah Surip ‘Tak Gendong’ Meninggal Dunia 2009. Penetapan presiden dan wakil presiden terpilih ini tertuang dalam Surat 10. Bantuan pendidikan untuk Teguh Mafazie, Jl. Karya Jaya Medan Rp 350,000 Penyanyi lagu fenomenal “Tak Gendong” Mbah Surip, 60, Selasa (4/8) sekitar Keputusan KPU Nomor 373/Kpts/KPU/2009 tanggal 18 Agustus 2009 yang 11. Bantuan pengobatan untuk Jamiluddin, Jl. Sampul No. 30 Medan Rp 400,000 pukul 10:30 meninggal dunia, dalam perjalanan ke Rumah Sakit Pusat Pendidikan ditandatangani oleh Ketua KPU Abdul Hafiz Anshary dan dibacakan dalam 12. Bantuan pendidikan untuk Nurhayati, Jl. Tuar Gg. Tuar III No. 27 Medan Rp 300,000 Kesehatan (Pusdikkes), Kramat Jati Jakarta Timur. Mbah Surip memiliki nama Rapat Pleno Terbuka KPU. Pada pemilu presiden dan wakil presiden 5 Juli 2009, 13. Bantuan pendidikan untuk Yuni F.Y. Lubis, Jl. KPUM Deli Tua Rp 650,000 lengkap Urip Ariyanto, lahir di Mojokerto, Jawa Timur, 5 Mei 1949 merupakan pasangan SBY-Boediono memperoleh suara tertinggi yaitu 73.874.562 suara 14. Bantuan mustahik untuk Hasan Basri, Jl. Bromo Lr. Syarif No. 15 Medan Rp 425,000 penyanyi beraliran Reggae yang belakangan ini sangat populer dengan lagu atau 60,80 persen dari total suara sah nasional 121.504.481 suara. Sementara, 15. Bantuan pendidikan untuk Rahmat Fauzi, Jl. Pelajar Timur Gg. Melati No. 7 Medan Rp 405,000 karyanya yang berjudul “Tak Gendong”. Mbah Surip pernah mendapatkan pasangan lainnya yakni pasangan Megawati Soekarnoputri-Prabowo Subianto 16. Bantuan pengobatan untuk Dian Suci Lestari, Jl. Puri Gg. Nangka No. 13 Medan Rp 300,000 penghargaan rekor Museum Rekor Dunia Indonesia (MURI) untuk kategori memperoleh 32.548.105 suara atau 26,79 persen dan pasangan Jusuf Kalla-Wiranto 17. Bantuan pendidikan untuk M. Reza Saputra, Jl. Puri Gg. Kalek No.22 Rp 300,000 menyanyi terlama. Dalam perjalanan musiknya, Mbah Surip telah mengeluarkan meraih 15.081.814 suara atau 12,41 persen. Sesuai dengan ketentuan dalam 18. Bantuan pendidikan masuk SMP untuk calon siswa SMART EI T.A 2009/2010 Rp 7,250,000 beberapa album musik. Album rekamannya dimulai dari tahun 1997 diantaranya, Undang-Undang Pemilihan Presiden Nomor 42 Tahun 2008 pasal 159, pasangan 19. Bantuan pend. untuk anak asuh dr. Hj. Rayati Syafrin Rp15,360,000 Ijo Royo-royo (1997), Indonesia I (1998), Reformasi (1998), Tak Gendong (2003) calon terpilih adalah pasangan calon yang memperoleh suara lebih dari 50 persen 20. Bantuan mustahik untuk Nariawati, Jl. Kp. Aur Lembah Medan Rp 300,000 dan barang Baru (2004). Lagu “Tak Gendong” itu sendiri konon diciptakan pada dari jumlah total suara sah dalam pemilu presiden dan wakil presiden, dengan 21. Bantuan mustahik untuk Darliana Nasution, Jl. Kp. Aur Lembah Medan Rp 350,000 tahun 1983 saat Mbah Surip bekerja di Amerika Serikat. Sementara Presiden sedikitnya 20 persen suara di setiap provinsi yang tersebar di lebih dari setengah 22. Beasiswa Prestasi Rp 6,150,000 Susilo Bambang Yudhoyono mengucapkan belasungkawa atas meninggalnya jumlah provinsi di Indonesia. Perolehan suara pasangan nomor urut dua SBY- 23. Honor dai bulan Juli 2009 Rp 3,000,000 Mbah Surip dan mengharapkan semangat berkesenian Mbah Surip bisa terus Boediono tercatat lebih dari 50 persen dari total suara sah nasional dengan 24. Bantuan pendidikan untuk Aulia Fitrah Sitepu, Jl. Bunga Baldu bulan Juli 2009 Rp 100,000 dilanjutkan. perolehan suara di 33 provinsi di atas 20 persen sehingga memenuhi syarat untuk 25. Honor dai di RRI Gunungsitoli bulan Juli 2009 Rp 160,000 ditetapkan sebagai presiden-wapres terpilih, kata Ketua KPU Abdul Hafiz Anshary. 26. Bantuan program anak jalanan Yaspend Fatimah Az-Zahra bulan Juli 2009 Rp 300,000 27. Honor guru RSK Secanang Belawan bulan Juli 2009 Rp 500,000 6 Agustus: WS Rendra Meninggal Dunia Setelah sempat sakit-sakitan, akhirnya penyair WS Rendra meninggal dunia. 25 Agustus: SBY ‘Tegur’ Malaysia Soal Tari Pendet JUMLAH Rp 39.540.000 Budayawan tersebut meninggal setelah sempat keluar dari RS yang merawatnya. Presiden Susilo Bambang Yudhoyono berharap Malaysia menggunakan niat Rendra meninggal pada Kamis (6/8) pukul 22:10 di RS Kelapa Mitra, Kelapa baik untuk menyelesaikan masalah penggunaan tari pendet dalam promosi Gading, Jakarta. Penyair bersuara serak ini sebelumnya dirawat di Rumah Sakit wisata Malaysia. “Ini pelajaran yang sangat baik. Saya berharap niat baik In- Penerimaan dan Pemanfaatan Dana Penerimaan Pemanfaatan Saldo Mitra Keluarga, Kelapa Gading. Rendra masuk rumah sakit akibat jantung koroner donesia untuk menjaga hubungan baik dimiliki juga oleh Malaysia sehingga Periode Mei 2000 s.d Desember 2007 4.197.061.507 3.709.066.585 487.994.922 yang dia alami. Sebelumnya pria kelahiran Solo tahun 1935 itu sempat dirawat kerja sama yang selama ini baik terjaga tidak terganggu,” ujar Presiden dalam Periode 1 Januari s.d Desember 2008 712.917.041 489.562.714 223.354.327 di RS Cinere sejak Kamis, 25 Juni. Namun karena kondisinya tidak membaik, jumpa pers di Kantor Presiden, Jakarta, Selasa (25/8). Sebelum jumpa pers, Rendra lantas dirujuk ke RS Harapan Kita, lalu dirujuk lagi ke RS Mitra Keluarga. Presiden menerima laporan serta penjelasan dari Menteri Kebudayaan dan Total 4.909.978.548 4.198.629.299 711.349.249 Rendra sebenarnya sudah meninggalkan rumah sakit hanya beberapa saat setelah Pariwisata JeroWacik dan Menteri Luar Negeri HassanWirajuda. Presiden mengemu- Mbah Surip meninggal dunia. Rendra bahkan sempat mengizinkan Mbah Surip kakan, protes yang telah disampaikan Indonesia ke Malaysia atas penggunaan dimakamkan di komplek pemakaman Bengkel Teater di Citayam, Depok. tari pendet untuk promosi wisata Malaysia tidak berlebihan. “Ini sudah terjadi Konsultasi Zakat Bersama Ustadz M. Nuh Abdul Muis beberapa kali dan protes ini untuk kebaikan pada masa depan,” ujar Presiden. SMS: 08126526295 12 Agustus: Mayat Di Temanggung Ibrohim Presiden menyebut, di Malaysia saat ini ada sekitar 1,8 juta warga negara Indonesia e-mail: peduliummat@waspada.co.id Jenazah pria yang tewas dalam aksi pengepungan dan penembakan disertai yang bekerja di jajaran kedutaan besar dan konsulat jenderal, belajar, dan sebagai Hubungi Kami: peledakan bom di rumah Mohzari di Temanggung, Jawa Tengah oleh puluhan tenaga kerja Indonesia. Sebelumnya Menteri Kebudayaan dan Pariwisata Jero anggota Detasmen 88 Mabes Polri selama 18 jam, ternyata seorang penata bunga Wacik mengatakan telah mengirimkan nota protes kepada pemerintah Ma- Lembaga Amil Zakat Provinsi Sumatera Utara Peduli Ummat Waspada Hotel Ritz Calrton bernama Ibrohim. Bukan gembong teroris Noordin M Top laysia terkait kasus penggunaan Tari Pendet oleh Malaysia dalam iklan pariwisatanya. Jl. Brigjen Katamso No. 1 Medan telp. 061-4511936 - 4150858 (evi) Fax. 061-4511936 E-mail: peduliummat@waspada.co.id yang selama ini menjadi incaran pihak kepolisian. Identitas jenazah Ibrohim Dalam surat tersebut, Jero juga mengurai kasus akui-mengakui budaya Indonesia Khusus Kodya Medan, ZIS diatas Rp 500.000,- kami siap menjemput (4511936 - 08126375062) itu dipastikan Kepala Puslabfor Mabes Polri Brigjen Pol. Eddy Saparwoko dalam sepanjang dua tahun terakhir, dan meminta tanggapan dari pihak Malaysia.
  • 5. WASPADA Selasa 1 September 2009 Sport 5 07.00 Siapa Lebih Berani 07.30 Inbox 07.00 Masquerade 07.00 Pororo The Little 07.00 KiSS Vaganza 07.05 Indonesia This 07.30 Musik : Derings 08.30 Bunga Rampai 07.00 Back At Barnyard 07.30 I Gosip 09.00 Musik : Dahsyat 09.30 Halo Selebriti 07.30 Layar Pagi Penguin 08.30 Kid’s Song Morning 09.00 Sinema Liburan 09.00 Kabar 9 08.00 Go Diego Go 08.00 Selamat Pagi 11.00 Silet 10.00 Sinema Pagi 09.00 Cerita Pagi 07.30 Dino Babies 09.30 FTV Drama 07.30 Metro Xin Wen 11.00 Insert 09.30 Kabar Pasar 09.00 Obsesi 09.00 Dorce 12.00 Seputar Indone- 12.00 Liputan 6 Siang 10.30 Nekad’z 0 8 . 0 St a r K i d s Ya 11.30 Patroli 08.05 Healthy Life 12.00 Reportase Siang 10.30 Pariwara 10.00 Bukan Sinetron 10.0 Dengarlah Aku sia 12.30 Luping 11.00 Sidik Iyalah 12.00 Fokus Siang 09.05 Archielago 12.30 Missing Lyrics 11.00 Opini 11.00 Dimas & Raka 10.30 60 Minutes 12.30 Sergap 13.30 Kasak Kusuk 12.00 Layar Kemilau 09.00 Espresso 12.30 Happy Song 10.00 Kreasi 13.30 Bioskop Indonesia 12.00 Kabar Siang 12.00 Abdel & Temon 11.30 Redaksia Siang 13.00 Musik : Hits 14.30 Playlist 13.30 Sinetron Taaruf 10.00 Heboh 14.30 KiSS Sore 10.30 The Interview 15.30 Insert Sore 13.00 Kabar 13.00 Global Siang 12.00 I Gosip Siang 15.00 Cek & Ricek 16.30 Kepompong 14.30 Go Show 11.30 Topik Siang 15.30 FS : BBF 11.05 Expedition 16.00 Orang Ketiga The Ramadhan 14.30 Spongebob 12.30 Bocah Petualang 15.30 Seputar Indone- 17.00 Liputan 6 Petang 15.00 Ninja Warrior 12.00 Musik : Klik 17.00 Amira 11.30 Megapolitan Series 13.30 Expose 15.30 Aku Tahu 13.00 Laptop Si Unyil sia 17.30 Para PencariTuhan 16.30 Dag Dig Dug 13.30 Transformer 1 8 . 0 0 Ta n g i s a n 12.05 Metro Siang 16.30 Reportase Sore 14.00 Kamus Kuliner 16.00 Dapur Aisyah 13.30 Jalan Sesama 16.00 Mata Mata 19.00 Melati Untuk Nunggu Bedug Galaxy Force Isabella 13.30 Metro Highlights 17.00 Suami Suami Takut 15.00 Kabar 15 16.30 Bukan Buka Biasa 14.00 Tom & Jerry 16.30 Minta Tolong Marvel 18.00 Ben 7 15.30 Mantap 19.00 Jiran 14.30 Metro Sore Istri 16.00 Tabligh Akbar 18.00 Bolu 15.00 Asal Usul Fauna 17.00 Baim Anak Sholeh 20.30 Cinta Fitri 19.00 Ingat Ingat Lupa 15.00 Topik Petang 20.00 Inayah 15.30 Public Corner 17.45 Mukjizat Shadaqoh 17.30 Kabar Petang 18.30 Berita Global 15.30 Jejak Petualang 17.30 Manohara 21.30 Terlanjur Cinta 20.00 Maharani 17.00 SBY 22.00 FS : BBF 16.30 Inspirasi Ramadhan 18.30 Dengan Hati 19.00 Bang One Show 19.00 Big Movies 16.00 Redaksi Sore 19.00 Cinta Dan 22.30 Gala Sinema 21.00 Bengkel Hati 18.30 Kena Deh 00.00 FS : The Hos- 17.05 Ensiklopedia Islam 19.00 Bioskop Indonesia 19.30 JanjiWakil Rakyat 21.00 Abdel & Temon 17.00 Risalah Unyil dan Anugerah 00.30 Liputan 6 Malam Ramadhan 19.00 Segeerr pital 19.30 Suara Anda 21.00 Bioskop Trans TV 20.30 Telusur Bukan Superstar Rahasia Sunnah 20.30 Isabella 01.00 Buser 22.00 Riang Jenaka 20.00 4 M 01.00 Fokus Malam 20.30 Inside 23.00 Bioskop Trans TV 21.00 Apa Kabar Indo- 22.00 Big Movies 18.30 On The Spot 22.00 Deddy Corbuzier 01.30 Jangan Menyerah 23.00 Nekad’z 21.30 Tawa Sutra 02.30 Anak 21.05 Top Nine News 01.30 Reportase Malam nesia Malam 00.00 F1 Sensation 20.00 Opera Van Java Master Mentalis 02.00 Para PencariTuhan 23.30 Asep Show 23.00 4 Lawan Satu Membawa Berkah 21.30 Auto Zone 02.00 Sketsa Ramadhan 22.00 World Report 01.00 MTV Insomnia 21.00 OKB 23.30 Box Office Movie 00.00 Jejak Rasul 00.00 Topik Malam 03.30 Sahur Sahur 22.05 Today’s Dialogue 02.30 Saatnya Kita Sahur 23.00 Highlight Ngajak Sahur 21.30 Wara Wiri Ramadhan 01.00 Seputar Indone- 01.00 Cerita Dinihari 00.30 Lensa Olahraga Show 23.05 Secret Operations Barclays Premier 04.00 Jejak Sang Khalifah 22.00 Bukan Empat Mata sia Malam 02.00 Hur, Sahur! Malam 23.30 Metro Sports League 23.30 Begadang 01.30 UEFA 01.00 Kungfu Komeng 00.05 Metro Malam 01.00 World Report 00.30 Sport 7 Malam 02.00 Dahsyatnya Sahur 02.00 Happy Sahur 03.05 Tafsir Al Mishbah 02.30 Kabar Sahur 01.00 Redaksi Malam 04.00TakAdaYang Abadi 04.00 Sukses Syariah 02.00 Sketsa Ramadhan 02.30 Saatnya Kita Sahur CATATAN Jadwal acara TV di atas bisa diubah sewaktu-waktu oleh stasiun TV yang bersangkutan tanpa pemberitahuan **m30/B Gelar Termudah Lorenzo *Pedrosa, Rossi Jatuh Klasemen MotoGP Valentino Rossi (Italia/Yamaha) 212 poin INDIANAPOLIS, AS (Was- mendapat sambutan dari para Jorge Lorenzo (Spanyol/Yamaha) 187 pada): Pembalap Spanyol, Jorge pendukung di negaranya sendiri Casey Stoner (Australia/Ducati) 150 Lorenzo, meraih kemenangan dengan menempati posisi ketiga Dani Pedrosa (Spanyol/Honda) 141 ketiganya musim ini di MotoGP bersama Ducatinya guna me- Colin Edwards (AS/Yamaha) 123 Indianapolis,Senin(31/8)dinihari lengkapi pembalap yang naik ke Andrea Dovizioso (Italia/Honda) 120 WIB, setelah pimpinan kejuaraan podium. Hasil ini juga menjadi Alex de Angelis (San Marino/Honda) 88 Valentino Rossi dan peraih pole pencapaian terbaik Hayden Loris Capirossi (Italia/Suzuki) 86 Dani Pedrosa terjatuh. musim ini. Randy de Puniet (Perancis/Honda) 84 Lorenzo, memenangi dua Rossi memulai balapan ter- Marco Melandri (Italia/Kawasaki) 79 dari empat balapan pertama, sebutdengankeunggulan50poin mencapai garis finish dengan ke- dari Lorenzo, tetapi kini tinggal Rossi terjatuh dari kendara- Pedrosa, mendominasi sesi unggulan9,43detikdaripembalap 25 poin, sementara balapan kini annya pada akhir putaran kesem- latihan dan kualifikasi di Indiana- SanMarino,AlexDeAngelis,untuk tinggal lima kali lagi. Sukses juara bilan ketika ia berusaha mengejar polis Motor Speedway, sebelum- mengejar ketinggalannya di berarti kemenangan ketiga bagi Lorenzo yang sedang memim- nya sudah terjatuh dari kendara- kejuaraan dunia dari rekan Lorenzo tahun ini atau jika diga- pin. Juara dunia delapan kali itu annya di putaran keempat ketika setimnya, Valentino Rossi, yang bung dengan jumlah kemenang- kembali mengendarai sepeda sedang memimpin. Dia kembali untuk pertama kalinya musim an Rossi berarti kedelapan bagi motor Yamahanya, tetapi me- memasuki balapan dan berhasil ini gagal finish. tim Fiat Yamaha dari 12 seri ngundurkan diri dua putaran finish di posisi ke 10. (ant/rtr/ Pembalap AS, Nicky Hayden, bergulir. kemudian. h09) AP Kesalahan Murni Jorge Lorenzo (kiri) melewati garis finish pada MotoGP Indianapolis nyaris tanpa kesulitan. Karena Rossi Lorenzo. Pembalap Italia ini ini. terjungkal dari motornya ke trek Rossi juga mengungkapkan rumput di lap kesepuluh, Senin bahwa dia kesulitan untuk tetap (31/8) dinihari WIB. bertahanmenempelrekansetim- Namun Rossi mengakui nya, Jorge Lorenzo. Akhirnya bahwa itu adalah kesalahannya motogp Indianapolis dimenangi AP setelah menganalisa data yang oleh Lorenzo yang bertahan di Valentino Rossi terjatuh hingga memberi kemenangan mudah ada. “Saya sedikit melebar di di posisi terdepan. bagi rekan setimnya Jorge Lorenzo pada MotoGP Indianapolis, Turn1dandiakhirsaatmengerem “Saya tidak mendapatkan Senin (31/8). di trek yang kotor,” ujarnya. setingan yang optimal. Ketika “Faktanya saya berada di luar Lorenzo melewati saya, saya INDIANAPOLIS, AS (Was- Pembalap Yamaha ini sekitar 1,5 meter karena saya segera berpikir bahwa sulit untuk pada):Valentino Rossi gagal me- mengakui bahwa kecelakaan itu berusaha kembali ke racing line dapat tetap mempertahankan nyelesaikan lomba setelah me- murni karena kesalahannya. setelah melakukan kesalahan. jarak dengannya karena dia lebih ngalami kecelakaan di Indiana- Rossi terjatuh di Indianapolis Saya mengerem di permukaan cepat,” ungkap Rossi. polis. saat berada di belakang Jorge yang kotor,” kata pembalap Italia (m33/vvn) Birdie Penentu Hur OREGON, AS (Waspada): Hur melakukan pitching dari Pada putaran terakhir, Hur Pegolf putri Korea Selatan MJ Hur jarak dua meter dan Petterson mencatat skor 65 pukulan tujuh (foto) mencetak birdie playoff melancarkan chipping tujuh di bawah par, maka secara to- lubangkeduauntukmengalahkan meter melewati bendera. Ketika tal empat putaran dia membuku- Suzann Pettersen dan Michele pegolf Norwegia itu kehilangan kan 203 pukulan 13 di bawah par Redman sekaligus memenangi birdie, Hur justru melangkah dan dan skor total itu sama dengan turnamen LPGA Safeway Classic, membuatputting solid guna me- Pettersen dan Redman setelah Senin (31/8). mastikan gelar Tur LPGA keduanya pada putaran keempat Redman lebih dulu tersingkir pertamanya. mencatat 67 pukulan. dari playoff dan kemudian Hur “Saya bekerja sangat keras. Pegolf AS Michelle Wie (66 dan pegolf Norwegia saling ber- Sebelum turnamen ini, saya pergi pukulan), Ai Miyazato dari Jepang hadapan di hole ke-17 par empat ke Korea dan banyak berlatih. (70) dan pegolf Korsel Seon Hwa di Pumpkin Ridge. Bola Hur jatuh Itu yang membuat saya bisa Lee (70) berbagi tempat di posisi kerough kiri dekat green, sedang- mencatatskorbagusditurnamen tie keempat dengan total skor 205 kan bola Pettersen masuk ke ini,” kata Hur yang meraih hadiah pukulan 11 di bawah par. (m33/ kolam. utama 255.000 dolar AS. ant/afp) AP Musyafry Ikut Jejak Bendol J A K A RTA ( Wa s p a d a ) : setelahstriker bertubuh mungil rumput bersama Bajul Ijo. mereka lakukan, termasuk Gerbong pemain timnas senior ini menolak teken kontrak de- “Kami memang sudah deal perekrutan Musyafry. Hal ter- Indonesia tampaknya mulai ngan Persebaya Surabaya. Pa- dengan Musyafry, hanya saja sebut konon sesuai permintaan bergerak ke Persija Jakarta. Hal dahal, dia sudah menemui kata dia akhirnya batal bergabung Bendol selaku Direktur Teknik itu seiring dengan masuknya pe- sepakat dengan manajemen karenamengikutijejakpelatihnya mereka yang baru. latih Benny Dollo sebagai Direk- Bajul Ijo. Hal ini pun dibenarkan di timnas ke Jakarta. Kami “Bang Benny (Dolo) me- tur Teknik Macan Kemayoran. Asisten Manajer Persebaya memang tidak bisa berbuat ba- mang meminta kami untuk Terbukti, satu pemain Me- Cholid Goromah. nyak. Bagaimana pun, ini adalah tidak membeberkan persiapan rah Putih yang ramai dibicara- Menurutnya, penolakan hak dia sebagai pemain,” beber yang saat ini sedang dilakukan. Terlebih menyangkut siapa saja kan saat ini adalah Talaohu Musyafry ke Persebaya karena Goromah, Minggu (30/8). pemain yang akan direkrut. Abdul Musyafry (foto). Konon pemain yang bersangkutan Sayang, kepastian bakal ber- Beliau memang memang tidak mantan bomber Persiba Balik- mengikuti jejak pelatih timnas gabungnya Musyafry ke Persija ingin ada publikasi. Katanya papan ini sudah dipastikan ke Persija, meski se-belumnya sulit dikonfirmasi. Pasalnya, nanti ada saatnya,” jelas Ferry bermain di Persija. sudah menyatakan kesediannya manajemen tim ibukota ini Indrasjarief, mantan Asisten Dugaan itu semakin kuat, dan menemui kata sepakat me- menutup rapat persiapan yang Manajer Persija. (yuslan) Liga Ancam Berlakukan Bank Garansi JAKARTA (Waspada): PT depan, khusus bagi mereka yang keuangan musim lalu, tidak me- kutan, tetap ingin tampil di Liga Indonesia (Liga) selaku pe- belum memenuhi tiga dari miliki tunggakan utang atau Superliga musim depan. laksana regulasi kompetisi se- empat item penilaian yang ada denda serta melampirkan ran- Masih kata Joko, dari hasil pakbola non amatir di tanah air di aspek finansial. cangan keuangan untuk satu verifikasi sementara yang dila- mengancam bakal menerap- Hal itu, lanjut Joko, guna musim ke depan, bank garansi kukan, tiga tim terancam di-ca- kan aturan bank garansi bagi menjaga jangan sampai ada tim tentu tidak perlu diberlakukan,” but lisensinya. Mereka adalah tim kontestan Superliga yang mundur di tengah kompetisi aki- tegas Joko. Persitara Jakarta Utara, Pelita tidak bisa memenuhi syarat bat krisis keuangan. Dengan Namun demikian masih Jaya, dan Persija Jakarta. 11 Tim finansial. bank garansi itu, dipastikan jadi kata Joko, sekiranya hingga lainnya dipastikan valid, tapi Direktur Kompetisi Liga, jaminan klub tidak akan terken- batas akhir verifikasi pada Senin masih harus menyempurnakan Joko Driyono menyatakan, pi- dala dengan masalah finansial. (31/8), tiga item tersebut tidak data dari lima aspek, yakni in- haknya bakal menerapkan bank “Jika klub bisa memenuhi bisa dipenuhi, bank garansi frastruktur, personel dan admi- garansi bagi tim kontestan tiga item penilaian aspek finan- sebesar Rp5 miliar mutlak harus nistrasi, legal, finansial dan Superliga edisi kedua musim sial, yakni melampirkan laporan ada. Itu sekiranya klub bersang- suporting. (yuslan)
  • 6. 6 Sport WASPADA Selasa 1 September 2009 Diego Curi Perhatian ROMA (Waspada): Hasil Minggu (Senin WIB): Pemain yang baru diboyong AS Roma vs Juventus 1-3 Atalanta vs Genoa 0-1 Juventus, Diego Ribas da Cagliari vs Siena 1-3 Cunha, mencuri perhatian Chievo Verona vs Lazio 1-2 Fiorentina vs Palermo 1-0 pada pertandingan keduanya Napoli vs Livorno 3-1 di Liga Seri A, Minggu (Senin Parma vs Catania 2-1 Sampdoria vs Udinese 3-1 WIB). Hasil Sabtu (Minggu WIB): AC Milan vs Inter Milan 0-4 Playmaker yang dibeli Si Bari vs Bologna 0-0 Nyonya Tua dariWerder Bremen itu menyumbang dua gol yang Klasemen Seri A: membawa kemenangan 3-1 Sampdoria 2 2 0 0 5-2 6 Super Juve atas AS Roma di Juventus 2 2 0 0 4-1 6 Stadion Olimpico. Genoa 2 2 0 0 4-2 6 Pemain pengatur irama per- Lazio 2 2 0 0 3-1 6 mainanasalBrazilitubenar-benar Inter Milan 2 1 1 0 5-1 4 menunjukkankemampuanyang Parma 2 1 1 0 4-3 4 oleh para pendukungnya diha- AP Fiorentina 2 1 1 0 2-1 4 rapkan mampu menjembatani Bintang kemenangan Juventus Diego Ribas da Cunha (kanan) Siena 2 1 0 1 4-3 3 jurang pemisah dengan juara merayakan golnya ke gawang AS Roma dengan sesama pemain Napoli 2 1 0 1 4-3 3 Italia, Inter Milan. Brazil Felipe Melo di Stadion Olimpico, Minggu (Senin WIB). Palermo 2 1 0 1 2-2 3 “IniberkatlingkungandiJuve, AC Milan 2 1 0 1 2-5 3 pelatih Ciro Ferrara, rekan satu dan kemudian menggiringnya 30 meter dan kiper Gianluigi Bari 2 0 2 0 1-1 2 tim saya, dan para pendukung menuju kotak penalti sebelum Buffon sedikit tidak sadar Bologna 2 0 2 0 1-1 2 yang membuat saya betah,” kata melewati John Arne Riise dan menangkap bola. Udinese 2 0 1 1 3-5 1 Diego kepada televisi Sky. kemudian menjebloskan bola ke Tetapi,Diegokebalimembuat Livorno 2 0 1 1 1-3 1 Setelah akhir pekan lalu pojok gawang lawan. Juve unggul di babak kedua Cagliari 2 0 1 1 1-3 1 membantu Juve meraih keme- Daniele De Rossi menama- setelah ia mendapat umpan Catania 2 0 0 2 2-4 0 nangan 1-0 atas Chievo di pertan- kan kedudukan untuk tuan ru- matang dari Vincenzo Iaquinta. Chievo 2 0 0 2 1-3 0 dingan pembukaan liga Italia, mah 10 menit kemudian, meski- Rekan senegaranya Felipe Atalanta 2 0 0 2 0-2 0 Diego mencetak gol di babak pun dengan cara yang berbeda. Melo, yang juga dibeli mahal oleh AS Roma 2 0 0 2 3-6 0 pertama melalui serangan Saat debutan Juve, Felipe Melo, Juve dari Fiorentina, memantap- seorang diri yang gemilang. bersitegang dengan wasit, Roma kan gol kemenangan pada masa Del Piero, mempunyai banyak Kesalahan bek Marco Cas- segera melakukan tendangan injury time. kesempatan untuk menambah setti memungkinkan Diego bebas. Gelandang Italia, De Rossi, Juve yang kembali tidak kemenangan,tetapitidakberhasil. AP merebut bula di tengah lapangan melepaskan tendangan dari jarak diperkuat oleh kapten Alessandro (h01/ant/rtr/ap) Serangan bomber Bordeaux Marouane Chamakh (tengah) berusaha digagalkan kiper Marseille Steve Mandanda (kanan) dan bek Souleymane Diawara (kiri) di Stade Velodrome, Minggu (Senin WIB). Minggu,30Agustus: HerthavWerderBremen HamburgvsFCKoeln Sabtu,29Agustus: 2-3 3-1 Bordeaux Ke Puncak Tahan Marseille LeverkusenvsVfLBochum 2-1 BayernMunichvsWolfsburg 3-0 EFrankfurtvsBDortmund 1-1 HanovervsHoffenheim 0-1 Schalke04vsSCFreiburg 0-1 PARIS (Waspada): Girondins penalti dan melepaskan tenda- Cheyrou melayangkan ten- VfBStuttgartvsNuremberg 0-0 Hasil Minggu (Senin WIB): Bordeauxmerebutkembaliposisi ngan ke sudut dalam jaring dangan setengah voli yang Jumat,28Agustus: puncak klasemen Ligue 1 melalui melewati Ludovic Butelle. mengenai msitar gawang pada Marseille vs Bordeaux 0-0 selisih gol, setelah menahan im- Peguy Luyindula menghasil- menit ke-64. Paris SG vs Lille 3-0 BM’GladbachvsMainz 2-0 bang 0-0 tuan rumah Olympique kangolkedua13menitmenjelang Marseille hampir membayar Toulouse vs Valencs 0-1 Klasemen Bundesliga: Marseille, Minggu (Senin WIB). pertandingan usai ketika Chris- mahal untuk peluang mereka Hasil Sabtu (Minggu WIB): Hamburg SV 4 3 1 0 12-5 10 Hasilitusekaligusmengakhiri tophe Jallet menyiapkannya yang hilang ketika pemain tengah Boulogne vs Auxerre 0-0 Leverkusen 4 3 1 0 10-3 10 laju 14 kemenangan beruntun untukberdueldenganButelledan Bordeaux asal Brazil menyundul FC Lorient vs Le Mans 1-0 Werder Bremen 4 2 1 1 9- 6 7 Bordeaux, termasuk 11 kemena- ia menyelipkan bola melalui masuk ke jaring dari sudut pada Sochaux vs Monaco 1-0 FC Schalke 4 2 1 1 5- 2 7 ngan yang membawa mereka bawah badan kiper. menit ke-90 tetapi usahanya Nice vs Montpellier 0-3 M’Gladbach 4 2 1 1 7- 7 7 meraih gelar pertama dalam 10 Jalletmenambahkemalangan dibatalkan karena pelanggaran Lyon vs AS Nancy 3-1 E Frankfurt 4 1 3 0 5- 4 6 tahun musim lalu. Butelle ketika ia memvoli umpan di area penalti. Racing Lens vs Rennes 2-2 VfL Wolfsburg 4 2 0 2 7- 8 6 Setelah empat pertandingan, silang Stephane Sessegnon dan “Kami agak beruntung. Kami St Etienne vs Grenoble 1-0 Bayern Munich 4 1 2 1 6- 4 5 sang juara bersama Paris St Ger- masuk melalui kedua kaki kiper mendapat poin dan kami tidak VfB Stuttgart 4 1 2 1 5- 5 5 Klasemen Ligue 1: main dan Olympique Lyon tersebut pada tambahan waktu. kecewa,” kata manajer Bordeaux Hoffenheim 4 1 2 1 2- 2 5 semuanya mengumpulkan 10 Laurent Blanc kepada saluran Bordeaux 4 3 1 0 11-3 10 Mainz 4 1 2 1 5- 6 5 poin dengan tim yang mendapat Agak beruntung televisi Canal Plus. Paris SG 4 3 1 0 10-4 10 AP B Dortmund 4 1 2 1 4- 6 5 Lyon 4 3 1 0 9- 3 10 promosi Montpellier dan Mar- Marseille memberi penghor- Pelatih Marseille Didier Montpellier 4 2 2 0 8- 3 8 Paolo Guerrero (kanan) melepaskan tendangan yang membobol gawang FC Koeln di Hamburg, Hanover 4 1 1 2 3-3 4 seille dua poin di bawahnya. matan kepada Robert Louis- Deschamps menambahkan: “Ini Jerman, Minggu (Senin WIB). VfL Bochum 4 1 1 2 5- 8 4 Marseille 4 2 2 0 4- 1 8 Posisi teratas berubah tiga Dreyfus,pemegangsahamutama pertandingan tingkat Liga Cham- Lens 4 2 1 1 7- 7 7 Freiburg 4 1 1 2 4-10 4 kali selama akhir pekan ketika mereka yang meninggal pada 4 pion. Kami berusaha mendorong Hertha Berlin 4 1 0 3 4- 6 3 Lorient 4 2 1 1 5- 5 7 Guerrero Angkat Hamburg Nuremberg FC Koeln 4 0 2 2 2- 5 2 4 0 1 3 2- 7 1 Lyon merebut tempat pertama pada Sabtu dengan kemenangan kandang 3-1 atas AS Nancy sebe- Juli, sebelum pertandingan dimulai di Stade Velodrome. Upacara yang panjang itu ke depan tetapi Bordeaux lebih menguasai dalam pertandingan” Pada pertandingan lain, . Boulogne Nancy Rennes 4 2 1 1 3- 4 7 4 2 0 2 9- 6 6 4 1 3 0 7- 4 6 lum PSG merebutnya pada membuat para pemain dari ke- Minggu,Valenciennes mencatat Sochaux 4 2 0 2 4- 5 6 BERLIN (Waspada): Paolo sejumlah pertandingan dimana Menit 66, dia menggandakan dragonmenjegalmantanpemain Minggu ketika mereka menun- dua tim menjadi lamban mene- kemenangan pertama mereka Monaco 4 2 0 2 3- 5 6 Guerreromencetakduagoluntuk poin Hamburg sama dengan golnya sehingga membuat Ham- Brazil dan Bayern Munich Ze dukkan Lille 3-0. mukan ritme permainan mereka. musim ini di kandang Toulouse, Toulouse 4 1 1 2 4- 4 4 mengangkat Hamburg SV ke Bayer Leverkusen hanya bertaut burg unggul lewat satu tembakan Roberto. Pertandingan lain hari PemaintengahJeremyClem- Dua peluang terbaik bagi menundukkan pesaing dalam Le Mans 4 1 1 2 5- 7 4 posisi puncak klasemen semen- dalam perbedaan gol, kedua tim yang membelok mengenai Minggu itu menghasilkan lima Nice 4 1 1 2 3- 8 4 ent mencetak gol pertama PSG Marseille terjadi ketika usaha Liga Eropa itu 1-0. tara Bundesliga setelah menang itu memperoleh 10 poin dari Youssef Mohamad. gol dalam 35 menit terakhir. Valencs 4 1 0 3 4- 7 3 pada menit ke-28 ketika ia me- striker asal Brazil Brandao Toulouse berada di urutan 3-1 atas FC Koeln, Minggu (Senin empat pertandingan mereka di Adil Chihi memperkecil Mesut Ozil membuatWerder Etienne 4 1 0 3 2- 6 3 WIB). pembukaan musim. selisih gol lewat tembakannya unggul terlebih dahulu di menit manfaatkan sepenuhnya kele- melalui tendangan keras kaki kiri 13denganempatpoinsementara Lille 4 0 1 3 2- 7 1 Werder Bremen naik ke posisi Penyerang Peru itu mem- dari jarak 30 meter menit 76, dua ke-57 dan Tim Borowski mem- mahan elakan dari sudut, me- membentur gawang pada menit Valenciennes di posisi 16 dengan Auxerre 4 0 1 3 0- 6 1 ketiga ketika bek Brazil Naldo bukagolmenit19lewattembakan menit setelah masuk sebagai buatnya menjadi 2-0 dengan ngendalikan bola di tepi area ke-35 dan pemain tengah Benoit tiga poin. (h01/ant/rtr/ap) Grenoble 4 0 0 4 2- 7 0 memberi mereka kemenangan kaki kirinya ke arah pojok bawah pemain pengganti. menyarangkan umpan Marko 3-2 atas Hertha Berlin di pertan- gawang Cologne setelah David PiotrTrochowski melesakkan Marin di menit ke-74. dingan lain Minggu. Guerrero menambah koleksi golnya menjadi empat gol dari Jarolimmemanfaatkankesalahan yang dilakukan pemain Cologne Pierre Wome. tendangan penalti bagi Hamburg pada sisa waktu empat menit setelah kiper Cologne Farid Mon- Lukasz Piszczek membalas- kan satu gol dari jarak dekat na- mun tiga menit kemudian Naldo 60 Fans Palermo Ditahan WIB). Pihak berwenang Italia melakukan tindakan keras menjejaki secara digital para penggemar itu, telah menimbulkan protes dari melesakkan gol enam menit ROMA (Antara/Reuters): kota itu sebelum terhadap para ‘hooligan’ sejumlah kelompok suporter. kemudian. Patrick Ebert men- Sekitar 60 fans Palermo pertandingan Liga Seri A tetapi rencana pemerintah Fiorentina menang 1-0 cetak gol bagi Hertha di menit- untuk mengeluarkan “kartu dalam pertandingan tersebut. Valencia Pukul ditahan polisi Florence antara Palermo melawan menit akhir. (h01/ant/rtr/ap) setelah pecah kerusuhan di Fiorentina, Minggu (Senin suporter” nasional yang akan 10 Pemain Sevilla MADRID (Waspada): Gol Juan Mata dan Pablo Hernandez memberikan kemenangan 2-0 ValenciaatasSevillayangbermain dengan 10 orang dalam pertan- dingan pembukaan musim La Liga Primera, Minggu (Senin WIB). Kesempatan-kesempatan Sevilla untuk mencetak gol pupus diMestallabeberapasaatsebelum babak pertama usai, ketika striker asal Mali, Frederiz Kanoute, men- dapat kartu kuning kedua karena mengganjalsecarakerasterhadap kaptenValencia,CarlosMarchena. Dua menit setelah babak kedua dimulai, Mata menjebol gawang Andres Palop dan Her- nandez mengukuhkan kemena- nganValencia melalui golnya 10 menit menjelang petandingan usai. Atletico Madrid mengawali pertandingannya dengan awal AP yang kurang baik pada hari Ming- Juan Mata (kiri) merayakan golnya ke gawang Sevilla dengan gu, ketika mereka dihancurkan rekannya David Villa di Mestalla Stadium, Valencia, Spanyol, 0-3 di Malaga. Minggu (Senin WIB). Villarreal bermain imbang 1-1diOsasuna,timpromosiXeres menambah kemenangan di 60. kalah 0-2 di Real Mallorca dalam menitke-60.SundulanXaviTorres Hasil Minggu (Senin WIB): pertandingan pertama mereka melengkapi kemenangan Ma- Real Mallorca vs Xerez 2-0 di liga papan atas Spanyol, Athle- laga di menit ke-89. Malaga vs Atl Madrid 3-0 tico Bilbao mengalahkan Espa- Real Madrid memulai Osasuna vs Villarreal 1-1 nyol 1-0, dan Roberto Soldado pertandingan pembuka musim R Santander vs Getafe 1-4 mencetak “hat-trick” untuk dengan kemenangan 3-2 atas Ath Bilbao vs Espanyol 1-0 membawa kemenangan Getafe Deportivo Coruna hari Sabtu. Valencia vs Sevilla 2-0 4-1 atas Racing Santander. Kemenangan Real Madrid Almería vs Valladolid 0-0 Nabil Baha memberi keung- diperoleh berkat gol Raul Gon- Hasil Sabtu (Minggu WIB): gulan kepada Malaga di menit zalez,tendanganpenaltiCristiano Real Madrid vs Deportivo 3-2 ke-34 melalui tendangan voli Ronaldo, dan tendangan jarak Zaragoza vs Tenerife 1-0 akrobatik dan Manu Torres jauh Lassana Diarra di menit ke- (h01/ant/afp/rtr)
  • 7. WASPADA Selasa, 1 September 2009 Sport 7 MU, Spurs Dominasi Hughes Puji Benteng Citizens Three Lions LONDON (Waspada): Tim tamu tidak akan diper- LONDON (Waspada): Pelatih Mark Hughes memuji benteng pertahanan Manchester City yang belum kebobolan satu Minggu, 30 Agustus: Portsmouth vs Man City Everton vs Wigan Ath 0-1 2-1 kuat playmaker utama mereka Aston Villa vs Fulham 2-0 Bek Wes Brown dan kiper Luka Modric. setelah dia menga- gol pun dalam tiga laga awal Liga Premier Sabtu, 29 Agustus: lami patah tulang pada fibula saat musim ini. Ben Foster dari Manchester bermain untuk Spurs melawan Blackburn vs West Ham 0-0 Birmingham, Sabtu lalu. Bolton vs Liverpool 2-3 United serta pemain Stoke City vs Sunderland 1-0 PeluangMichaelOwenuntuk Tottenham vs Birmingham 2-1 Tottenham Hotspur Peter bisabermaindiputaranfinalPiala “Kami belum pernah kebobolan dan itu memberi peluang kepada tim untuk Wolves vs Hull City 1-1 Crouch dan Aaron Lennon, Dunia juga mengalami sedikit Chelsea vs Burnley 3-0 hambatan ketika Capello men- memenangi pertandingan,” jelas Hughes dipanggil lagi masuk skuad coret namanya. Bomber MU setelah The Citizens menaklukkan Port- smouth 1-0 lewat gol tunggal Emmanuel Klasemen Liga Premier: Inggris pada Minggu (Senin berusia 29 tahun itu merupakan pemain yang menduduki posisi Adebayor pada Minggu di Fratton Park. Chelsea 4 4 0 0 10-2 12 WIB). keempat dalam daftar pencetak Kokohnya sistem pertahanan Joleon Tottenham 4 4 0 0 11-4 12 gol terbanyak. Lescott cs disempurnakan oleh barisan Man United 4 3 0 1 8- 2 9 Namun Capello tidak cukup depan untuk mencatat kemenangan Man City 3 3 0 0 4- 0 9 kompromi dengan kondisi dan beruntun di markas The Pompey yang Stoke City 4 2 1 1 3- 4 7 Pemanggilan itu sekaligus terkenal sulit. “Fratton Park tempat yang Arsenal 3 2 0 1 11-4 6 mencerminkan dominasi MU performa mantan striker Liver- Liverpool 4 2 0 2 9- 7 6 pool tersebut. Capello mengata- sulit, tapi kami menguasai permainan. Kami danSpursdalamskuadTheThree memimpin dan seharusnya pantas menang Aston Villa 3 2 0 1 5- 3 6 Lions untuk pertandingan mela- kan telah memutuskan untuk Sunderland 4 2 0 2 4- 5 6 memasukkanbintangTottenham dengan 2-0,” tambah pelatih asal Wales itu. wan Slovenia dan Kroasia bulan City sebenarnya mampu mencetak gol Burnley 4 2 0 2 2- 5 6 depan. Jermain Defoe yang lebih fit pada West Ham 3 1 1 1 3- 2 4 musimini.KiperDavidJamesjuga kedua melalui sontekan Micah Richards. Pelatih Fabio Capello me- Namun wasit menilainya terjebak offside Birmingham 4 1 1 2 2- 3 4 manggil kembali Brown untuk tampak tersingkir dari tim. Wolves 4 1 1 2 2- 4 4 saat menerima bola silang mendatar. menggantikan rekan setimnya Hull City 4 1 1 2 4- 8 4 Skuad Inggris: “Menurut pendapat saya, gol Richards Fulham 3 1 0 2 1- 4 3 di United Rio Ferdinand yang cukup sah dan dia tak offside. Tapi kami cedera untuk pertahanan semen- Kiper: Ben Foster (Man Utd), Everton 3 1 0 2 3- 8 3 Robert Green (West Ham), Paul tetap bersyukur karena bisa memenangi tiga Wigan Ath 4 1 0 3 3- 8 3 tara Foster, yang sudah pulih dari laga awal adalah hal luar biasa,” tegas cedera, menggantikan pemain Robinson (Blackburn) Blackburn 3 0 1 2 1- 4 1 Belakang: Glen Johnson Hughes. Bolton 3 0 0 3 2- 5 0 Birmingham City Joe Hart, (h01/bb/bbc/rtr) setelah ia kehilangan pertan- (Liverpool), Wes Brown (Man Portsmouth 4 0 0 4 1- 7 0 dingan persahabatan melawan Utd), Matthew Upson (West Belanda pada 12 Agustus. Ham), JohnTerry (Chelsea, capt), Crouch dan Lennon, yang Joleon Lescott (Man City), Ashley keduanya mencetak gol dalam Cole (Chelsea), Wayne Bridge kemenangan 2-1 atas Birming- (Man City) ham pada Sabtu, kembali terlibat Tengah:ShaunWright-Phillips setelahtampilmengesankanpada (Man City), Aaron Lennon awalmusimbagiTottenhamyang (Tottenham), David Beckham bergabung di posisi puncak Liga (Los Angeles Galaxy/USA), Premier setelah memenangai Gareth Barry (Man City), Frank empat pertandingan pertama Lampard (Chelsea), Michael mereka. Carrick (Man Utd), Steven Pemain ArsenalTheoWalcott Gerrard (Liverpool), Ashley tidak dimasukkan sementara Young (AstonVilla), James Milner pemulihandaricederapunggung (Aston Villa) AP yang sejauh ini membuatnya Depan:Wayne Rooney (Man Trio Tottenham Hotspur; Peter Crouch (atas), Jermaine Defoe dan Aaron Lennon . Utd), Emile Heskey (AstonVilla), absen pada musim berjalan. Tim yang terdiri atas 24 pada 5 September dan kualifikasi Inggris telah memenangi tempat mereka pada babak fi- Jermain Defoe (Tottenham), pemainituakanberkumpulpekan PialaDuniaGrupEnammelawan seluruh ketujuh pertandingan nal tahun depan di Afrika Selatan Carlton Cole (West Ham), Pe- depan sebelum pertandingan Kroasia diWembley pada 9 Sep- kualifikasiPialaDuniayangsudah jika berhasil mengalahkan ter Crouch (Tottenham). persahabatan melawan Slovenia tember. digelar dan akan memastikan Kroasia. (h01/ant/rtr/afp) Maradona Tambah 7 Pemain Domistik BUENOS AIRES (Antara/ United Jonas Gutierrez menarik Pareja (Espanyol), Nicolas Ota- Reuters): Pelatih Argentina Diego diri pada pertengahan pekan mendi, Sebastian Dominguez, Armando Maradona (foto) me- karena cedera. Emiliano Papa (Velez Sarsfield) nambah tujuh pemain berbasis Tengah: Javier Mascherano domestik dalam skuadnya, Revisi Skuad Argentina (Liverpool), Fernando Gago (Real Minggu (Senin WIB). Kiper: Sergio Romero (AZ Madrid), Maximiliano Rodriguez Skuad tersebut disiapkan Alkmaar), Juan Pablo Carrizo (Atletico Madrid), Jesus untuk pertandingan kualifikasi (RealZaragoza),MarianoAndujar Datolo (Napoli), Mario Bolatti Piala Dunia melawan Brazil di (Catania) (Huracan), Juan SebastianVeron kandang sendiri pada Sabtu Belakang: Nicolas Burdisso, (Estudiantes), Sebastian Bataglia depan dan bertandang ke Para- Javier Zanetti (both Inter Milan), (Boca Juniors) guay empat hari kemudian, kata Gabriel Heinze (Olympique Depan: Lionel Messi (Barce- Asosiasi Sepak Bola Argentina Marseille), Fabricio Coloccini lona), Sergio Aguero (Atletico (AFA). Pemain tengah Newcastle (Newcastle United), Nicolas Madrid), CarlosTevez (Manches- ter City), Ezequiel Lavezzi (Napoli), Diego Milito (Inter Milan), Lisandro Lopez (Olym- Hull Permanenkan pique Lyon), Eduardo Salvio (Lanus). AP AP Bek Baru City Joleon Lescott (depan) membuktikan kapasitasnya ketika duel dengan pemain Portsmouth McShane Tommy Smith di Fratton Park Stadium. LONDON (Antara/Reuters): Hull City mempermanenkan kontrak bek asal Irlandia Paul 6 4 3 5 1 9 McShane dari rivalnya Sunder- land. 9 5 8 7 2 4 “Tigerstelahmerampungkan 1 7 2 3 6 8 penandatanganan kontrak Paul 4 6 1 8 9 2 McShane dari Sunderland 5 3 9 1 4 7 dengan biaya transfer yang tidak diungkapkan,” demikian Hull 8 2 7 6 5 3 dalamlamanwww.hullcityafc.net 3 9 4 2 8 5 yang dikutip Senin (31/8). 7 1 5 9 3 6 McShane, 26, yang memulai 2 8 6 4 7 1 karirnya di Manchester United dan musim lalu menghabiskan waktu di Hull sebagai pemain pinjaman, menandatangani kontrak empat-tahun dengan klub itu. Sudoku Isi kotak kosong dengan angka 1 sampai 9. Tidak boleh ada pengulangan angka mendatar, menurun, maupun di dalam kotak 3x3 bergaris tebal. Tidak ada keterlibatan matematika, hanya perlu pertimbangan dan logika. Jawaban di kolom 8. 1 6 8 9 3 5 7 8 5 4 1 7 6 2 4 9 7 4 5 8 2 8 1 3 3 7 5 4 7 9 5 1 1 3 4 2
  • 8. 8 Sport WASPADA Selasa 1 September 2009 Fisichella Akui Bisa Menang SPA Meraih posisi kedua di nilai mobil yang dimilikinya “Dia berhasil memimpin FRANCORCHAMPS, Sirkuit Spa-Francorchamps jauh lebih cepat daripada yang hanya karena KERS di awal Belgia (Waspada): menjadi hasil yang bersejarah dimiliki Raikkonen. balapan, dan ini agak me- Pembalap Force India bagi Force India. Ini adalah “Jelas, pastinya ini hasil nyedihkan karena saya lebih Giancarlo Fisichella poin pertama yang diraih yang bagus untuk kami. Tar- cepat daripada dia. Saya ber- menegaskan dirinya Force India musim ini. Selain get terpenting adalah men- hasil mempertahankan ke- seharusnya bisa itu, ini adalah hasil terbagus cetak beberapa poin, dan me- cepatan, meski berada di bela- mengalahkan Kimi Fisichella sejak 2005. ngakhiri posisi kedua dengan kangnya, kami melakukan Raikkonen pada Pembalap asal Italia ter- delapan poin adalah hari yang strategi yang sama karena balapan di GP Eropa. sebut mengaku dirinya me- indah, tapi sebenarnya Anda saya mengakhiri balapan di Fisichella mengaku miliki peluang yang sangat tahu saya lebih cepat daripada posisi kedua,” pungkas dirinya lebih cepat besar untuk memenangkan Raikkonen,” ujar Fisichella, Fisichella. daripada Raikkonen. pertandingan. Fisichella me- Senin (31/8). (m33/ini) AP Giancarlo Fisichella (depan) mengakui lebih cepat dari Kimi Raikkonen. Nadal Datang Tiga Hari Penentuan Nasib Badoer SPA FRANCORCHAMPS, Untuk Menang Belgia (Waspada): Ferrari akan menentukan nasib Luca Badoer dalam tiga hari ke de- pan akan kelayakannya me- NEW YORK, neruskan kiprah menggan- AS (Waspada): Ra- tikan Felipe Massa. fael Nadal (foto) Demikian dikatakan bos sempat istirahat tim Stefano Domenicali, Senin sekitar dua bulan (31/8). Massa yang sedang untuk memulih- dalam penyembuhan mene- kan cedera tend- mui neurolog ahli cedera ken- initis di kedua lu- daraan bermotor di Miami un- tutnya. Tak heran tuk melanjutkan pemeriksaan jika performanya cedera kepala yang mengan- di lapangan tidak cam kehidupannya saat me- AP seperti ketika di- ngikuti GP Hungaria bulan rinya masih menjadi pemain nomor satu dunia. lalu. Ferrari mengatakan da- Meskipun demikian, Nadal tak mau bermanja diri. lam pernyataan mereka bah- Petenis Spanyol tersebut yang kini menempati peringkat wa pertemuan tentang pem- tiga dunia, siap tampil all-out di grand slam AS Terbuka balap itu akan diadakan Se- AP AFP yang mulai Senin (31/8) ini. Malah dia bertekad untuk lasa ini. Massa diharapkan Luca Badoer (kiri) diramal akan segera diganti pembalap Jenson Button (kiri) dan Lewis Hamilton seolah tak percaya gagal finish pada GP Belgia, menjadi juara walaupun kondisinya belum fit 100 persen. dapat berlaga kembali di kam- lain. Minggu kemarin. “Saya tidak takut. Saya memang absen sekitar dua pung halamannya Oktober, bulan dan kemudian (bulan ini) bisa menembus per- tetapi sebagian lain menga- wartawan setelah Kimi Raik- dan pemilik Force India Vijay empatfinal di Montreal Masters dan masuk semifinal di takan itu terlalu cepat. konen membuahkan keme- Mallya mengatakan sebegitu nangan pertama Ferrari ta- Hamilton Ikhlas Cincinnati Masters,” ungkap petenis berusia 23 tahun Test driver Badoer, tampil jauh belum ada pendekatan asal Mallorca itu kepada harian Spanyol, El Pais. kembali setelah absen satu hun ini di Belgia. dari tim juara itu. “Saya tahu, di sini (AS Terbuka), bisa masuk perempat dekade, menggantikan Massa Pembalap Italia, Giancarlo “Ferrari belum ada men- final atau semifinal, merupakan hasil yang sangat bagus. dalam dua lomba terakhir dan Fisichella, yang menempati datangi saya. ‘Fisi’ juga belum Tetapi saya datang untuk menang,” tambah peraih enam mennyentuh garis finish di urutan kedua dari posisi pole mendatangi saya, manajernya urutan belakang. Perlombaan untuk tim Force India, dise- juga belum. Ini semua hanya SPA kecelakaan di tikungan Romain Grosjean. “Salah gelar grand slam tersebut. but-sebut terkait dengan tim berikutnya diadakan di kan- spekulasi,” kata Fisichella. FRANCORCHAMPS, pertama Les Combes. satu race terburuk,” Nadal yang tahun ini berhasil meraih gelar Australia dang Ferrari, Monza, pada 13 Kuda Jingkrak itu tetapi Do- Domenicali juga memban- Belgia (Waspada): MP4-24 nya terjebak keluhnya pada BBC. Terbuka, akan mengawali langkahnya di AS Terbuka ini September. menicali tidak bersedia mem- tah laporan di media Italia Tereliminasi dari antara pembatas dengan “Start yang sangat melawan Richard Gasquet, yang kembali tampil di arena “Tentang apa yang akan bahas spekulasi itu, kecuali yang menyebutkan juara du- pertarungan sejak lap STR4 Jaime Alguersuari. buruk, tapi saya harus tenis setelah menjalani hukuman akibat kasus kokain. kami lakukan pada perlom- memujinya. nia dua kali Fernando Alonso pertama GP Belgia 2009, Sementara itu, pada mengikhlaskannya. Saya Dia mengakui, pertarungan melawan petenis Perancis baan mendatang, akan kami Pembalap yang akan da- dari Renault akan berada di Minggu (30/8), Lewis saat yang bersamaan seperti sandwich (diapit) itu sangat berat. beritahukan dalam tiga hari tang ke Ferrari harus mewu- dalam mobil Ferrari di Monza. Hamilton memilih dirinya juga coba di tikungan pertama dan “Dia memiliki potensi menjad salah satu petenis terbaik ini,” kata Domenicali kepada judkan impian jadi kenyataan (ant/rtr/h09) bersikap tenang. menghindar dari tabrakan kehilangan bagian sayap dan jika dia memiliki hari yang baik, maka akan terjadi Pembalap McLaren itu di depannya yang depan,” bebernya. pertarungan yang sangat sulit dan ketat. Tetapi saya yakin, mengatakan dirinya tidak melibatkan Jenson Button “Lalu mobil Jenson jika bermain baik maka saya memiliki peluang untuk bisa menghindar dari dan pembalap Renault berputar-putar di Turn 5, mengalahkan Gasquet,” ungkapnya. saya memilih mundur. Eh, (m33/ant/afp) saya malah ditabrak... Pasang Iklan ☎ 4528431 Saya coba menghindari tabrakan tapi saya malah HP. 081370328259 menjadi salah satu korban,” lanjut pembalap Email: iklan_waspada@yahoo.co.id Inggris 24 tahun itu. (m33/rtr) P.T. MADU AGUNG Jl. Balige No. 39/41 Medan - Indonesia Tel.: +62 (61) 4572636 PENGUMUMAN Dengan ini diberitahukan bahwa pada tanggal 18 (delapan belas) Agustus 2009 (dua ribu sembilan) telah diadakan Rapat Umum Luar Biasa Para Pemegang Saham dari perseroan terbatas “P.T. MADU AGUNG”, berkedudukan di Medan, sesuai dengan akta BERITA ACARA RAPAT tertanggal 18 (delapan belas) Agustus 2009 (dua ribu sembilan) nomor 23, yang dibuat di hadapan KALAM LIANO, Sarjana Ekonomi, Sarjana Hukum, Spesialis Notaris, Magister Kenotariatan, Notaris di Sunggal, Kabupaten Deli Serdang. Bahwa dalam rapat tersebut telah diputuskan: 1. Pembubaran perseroan terhitung sejak pada hari dan tanggal rapat tersebut. 2. Persetujuan pembebasan dan penyelesaian sepenuhnya kepada Direksi perseroan dari segala tindakan dan pengurusan yang telah dilakukan. PIMPINAN DAN ANGGOTA DPRK PERIODE 2004 - 2009 3. Mengangkat tuan Hamzah Topaz sebagai likuidator dari perseroan yang telah dibubarkan tersebut. Mengucapkan: Untuk segala urusan yang berhubungan dengan pembubaran perseroan tersebut, para pihak yang berkepentingan dapat menghubungi alamat kantor perseroan yang terletak di Medan, Jalan Balige No. 39/41, selambat-lambatnya dalam jangka waktu 1 (satu) bulan terhitung sejak tanggal pengumuman ini. Sunggal, 1 September 2009 Atas Pelantikan Hormat kami, P.T. Madu Agung Anggota DPRK Langsa hasil Pemilu 2009 dto. HAMZAH TOPAS Periode 2009-2014 Direktur Utama di aula Gedung DPRK Langsa, Senin 31 Agustus 2009 Dan Kami mohon maaf kepada semua pihak atas segala kekurangan selama kami bertugas. Ttd. Mawardinur, S.Ag H. Rusli Nya’an (Ketua) Yuniar (Wakil Ketua) (Wakil Ketua) PDAM TIRTA MON PASE Kabupaten Aceh Utara Mengucapkan Selamat atas Pelantikan PEMERINTAH KOTA LANGSA Anggota DPRK Aceh Utara Mengucapkan: Masa Bakti 2009-2014 Oleh Ketua Pengadilan Negeri Lhoksukon Atas Pelantikan a/n Mahkamah Agung RI Pada hari Senin 31 Agustus 2009 Anggota DPRK Langsa hasil Pemilu 2009 di Aula DPRK Aceh Utara Periode 2009-2014 Serta terimakasih yang setinggi-tingginya kepada di aula Gedung DPRK Langsa, Senin 31 Agustus 2009 SELURUH ANGGOTA DPRK ACEH UTARA Ttd. PERIODE 2004-2009 atas pengabdian dan darma bakti selama ini Drs. Zulkifli Zainon, MM Drs. H. Saifuddin Razali, MM, MPd (Walikota) (Wakil Walikota) Ttd RIZAL EFENDY SYAIFULLAH, SH, MH, MM Plt Direktur Umum (Sekda Kota)
  • 9. WASPADA Selasa 1 September 2009 Medan Metropolitan 9 Gubsu: Disiplin PNS Pemko Minim MEDAN (Waspada): Gubernur Sumatera Utara pakai topi dan barisan tidak rapi. izin,” paparnya. diinginkan. “Lakukan segera per- (Gubsu) H Syamsul Arifin, SE meminta Pegawai Negeri Inilah yang harus diperbaiki,” Ketidaksembarangan dalam baikandenganbekerjalebihmak- ucapnya. mengeluarkan izin dimaksudkan simal. Jangan ada keraguan dan Sipil (PNS) jajaran Pemerintah Kota (Pemko) Medan Selainmeningkatkandisiplin, Gubsu adalah, agar Pemko atau ketakutan,”pungkasnya. untuk meningkatkan disiplin dalam melaksanakan Syamsul juga meminta kepada Pemrpov tidak hanya mendapat Sementara itu, PenjabatWali- tugas maupun waktu bekerja. Karena dengan adanya jajaranPemkoMedanuntuktetap pajak semata saja. Kedua, bukan kota Medan Rahudman Hara- kompak dalam menghadapi era ungkapan sebagai membenci hap mengatakan, memang disi- kedisplinan, maka apa yang menjadi tujuan selama golobalisasi. Bila tidak kompak, investasi. plin PNS Pemko Medan masih ini dapat tercapai. maka aset Sumut akan dibawa “Kitabukanantiinvestasi,tapi minim dan hal itu sudah sama- ke luar. Dia juga meminta tidak jangan sampai kita mendapat sama dilihat. Hal inilah ke depan- “Disiplin itu dimulai dari diri Syamsul mengatakan, disi- sembarangan dalam menge- pajaksaja,hasilnyasemuadibawa nya akan diatasi secara bertahap. sendiri, bukan karena keinginan plin PNS jajaran Pemko Medan luarkan izin. ke luar. Apalagi Presiden sudah “Persoalan disiplin masih gubernurdanbukandalamkegia- masih minim, baik dari kelengka- “Legislatif dengan eksekutif mengatakan gunakan modal lemah,masihbanyakpejabatese- tan tertentu saja. Dengan disiplin, panpakaianmaupunsikapketika haruskompak,begitujugadengan negeri,” terangnya. lon III yang belum sadar dengan maka apa yang menjadi tujuan berbaris. Hal ini bisa dilihat aparat kepolisiannya. Dengan Kepada PNS Medan dia juga ini,upacaratidakpakaitopi.Inilah dalam bekerja bisa tercapai,” kata langsung,masihbanyakPNSyang kompak kita bisa mencegah mengingatkan, tidak ada istilah yang akan dibenahi secara berta- Syamsul dalam memimpin apel tidak pakai topi dinas, atribut persaingan bisnis di era golobali- anak ayam kehilangan induk lagi. hap,dibinadandievaluasimelalui pagi di halaman KantorWalikota lengkap dan lainnya. sasi dan menjaga apa yang kita Sebab, induknya sudah datang. pimpinan SKPD-nya masing- Medan sekaligus menyerahkan “Saya lihat PNS Dinas Perhu- miliki. Untuk itu jangan semba- Bekerjalah dengan maksimal, masing. Dengan begitu masalah bantuan dua unit mobil truk bungan(Dishub)KotaMedanba- rangan dalam mengeluarkan lakukan hal yang positif apa yang ini bisa diatasi,” tandasnya. (h10) sampah kepada Pemko Medan, risan ketiga tadi dari depan. PNS Waspada/Surya Efendi dan satu unit untuk Kabupaten itu berdiri sambil lipat tangan, TRUK SAMPAH: Gubsu H Syamsul Arifin, SE didampingi PjWalikota Medan Rahudman Harahap, Langkat, Senin (31/8). plengak-plengok. Sudah tidak Gudang Logam Dibobol Maling Sekda Dzumi Eldin dan Bupati Langkat Ngogesa Sitepu menyalami para penyapu jalan dari Dinas Kebersihan di Balaikota Medan usai penyerahan truk pengangkut sampah sumbangan BRI melalui Pemprovsu, Senin (31/8). Medan dapat 2 unit sedangkan Langkat 1. Tiga Pencuri Dibekuk MEDAN (Waspada): Gudang Saat diperiksa ternyata bahan bersama barang bukti kaca spion Logam No.35 di Jalan PasarVIII, baku logam yang ditaksir seharga sedan Vios. MEDAN (Waspada): Polsekta Medan Baru membekuk tiga tersangka kasus pencurian di dua lokasi, Jumat (27/8). Satu diantara mengaku anggota Polri. Pajak Gambir Tembung, milik AsengaliasSukidin,50,Jumat(28/ mencapai Rp50 juta itu telah raib. Kasus ini kemudian dilaporkan Kasat Reskrim Poltabes Me- dan, Kompol Gidion Arif Setiya- Masyarakat Nias 8) dinihari, dibobol kawanan ma- korban ke Polsekta Percut Sei wan, didampingi Kanit Ranmor Pertama ditangkap tersangka JS, 28 dan MAM, 32, keduanya penduduk Jalan Teratai Lingkungan III Pulo Secanang, Kel. Medan Belawan. Mereka pada 26 Agustus 2009 dengan mengendarai sepeda ling. Dalam aksi tersebut, maling berhasilmenggondolbahanbaku Tuan. Petugas yang menerima AKP A. Said Ritonga, Jumat (28/ 8), kepada wartawan menjelas- Tuntut Penuntasan Korupsi motor Yamaha Jupiter MX BK 4425 CN melakukan pencurian di untuk pembuatan logam yang laporan tersebut langsung turun kannya, kejadiannya berawal rumah kost Jalan Abdul Hakim, Pintu IV Kampus USU. Dari tempat ditaksir seharga mencapai Rp50 ke Tempat Kejadian Perkara malam itu petugas sedang mela- MEDAN (Waspada): Ratusan bobroknya kinerja Kepala Kejak- senilai Rp9,3 miliar untuk kost itu kedua tersangka menyikat HP Nokia tipe 7610 warna hitam juta. (TKP), untuk melakukan penye- kukan patroli rutin. masyarakatNiastergabungdalam saan Negeri Nias. “Copot Kajari penyediaan barang dan jasa, milik korban Fitri Anggi Jayanthi, 21, mahasiswi. Informasi di Poltabes Me- lidikan.Setibanyadilokasi,petugas SaatmelintasdikawasanJalan Forum Masyarakat Nias Peduli Gunung Sitoli Dede Ruskandar kasusDAKpendidikantahun2007 Ketika sedang mencari sasaran lagi ke rumah kost lainnya di dan, pencurian itu terjadi sekira meminta agar cctv yang terpa- Sutrisno, petugas merasa curiga (Formanispe) menggelar unjuk- karenadidugamelindungikorup- senilai Rp20, 5 miliar, kasus Jalan Sei Padang Medan, melintas petugas kepolisian yang sedang rasa di gedung Kejaksaan Tinggi tor.” teriak massa Formanispe perjalana dinas tahun 2007 senilai pukul 02:30, saat hujan turun. sang dibeberapa sudut gudang dengan dua tersangka yang Sumut (Kejatisu), Senin (31/8). serentak. Rp3,9 miliar, dan kasus dugaan melaksanakan razia hunting lalu menghentikan kendaraan kedua Waktu itu gudang milik korban diputar. menaiki sepeda motor tanpa plat tersangka. Saat diinterogasi, HP curian itu berbunyi dan diketahui Mereka menuntut penuntasan Mengantisipasihalyangtidak korupsi DAK pendidikan tahun dijaga Satpam bernama Anton, Begitu diputar rekaman cctv BK melintas, lalu distop. Ketika sejumlah kasus korupsi. diinginkan,aksiituterusmendapat 2008 senilai Rp29 miliar. HP itu hasil kejahatan, petugas langsung menangkap kedua tersangka 33, warga Tembung. Saat men- tersebut, ternyata terlihat ada tiga polisi menanyakan surat-surat dan memboyongnya ke Mapolsekta Medan Baru. Dalam aksi itu, selain mengu- pengawalanketataparatkepolisan “Kasusdugaankorupsisekitar jaga pintu depan, tanpa disadari pria yang tidak dikenal terekam kenderaan, kedua tersangka tidak sung sejumlah poster dan span- dari Polsekta gabungan yakni, Rp50 miliar sudah dilaporkan ke Kemudian petugas membekuk tersangka RMSH, 25, penduduk Anton, para pelaku masuk dari sedang mencuri bahan baku bisa menunjukkannya. Jalan Geraja Lingkungan XII, Kel. Indra Kasih, Kec. Medan Tembung. duk yang intinya menuntut Delitua, Sunggal dan Pancurbatu. lembaga penegak hukum, tapi, Tersangka bersama rekannya mengendarai sepeda motorYamaha belakang dengan merusak atap. logam.Berdasarkanrekamancctv “Polisi kemudian melakukan pemberantasan korupsi di Nias, Telaumbanua mengatakan, apa yang terjadi hingga saat ini RX King saat melintas di Jalan Dr Mansyur melihat korban Adil, Setelah itu kawanan maling itu, petugas langsung melakukan penggeledakandanmenemukan pengunjukrasa meneriakkan yel- kemiskinandankelaparandiNias para pelaku bebas berkeliaran,” 29, penduduk Jalan Kemuning III BlokV, Kel. HelvetiaTengah, sedang masuk dan menggasak bahan pencarian terhadap pelaku. kaca spion mobil. Ketika ditanya, yel dengan berbahasa Nias. disebabkan maraknya korupsi kata Telaumbanua. mengendarai Honda Supra X 125 BK 4726 CM warna hitam. baku logam. Pencuri Kaca Spion kedua mengaku baru saja men- Saat tiba di gedung Kejatisu yang dilakukan pejabat daerah Menanggapi aksi massa, Kasi Selanjutnya kedua tersangka membuntuti dan memepet sepeda Peristiwa baru diketahui Sementara itu, dua tersangka curinya,” jelas AKP Said. sekira pukul 11.00, orator aksi, secara berjamaah. Diduga ada Penkum/HumasKejatisuEdiIsan motor korban sambil mengatakan mereka polisi. Begitu berhenti, ketika Anton yang sedang kontrol pencurian spesialis kaca spion Dalam pemeriksaan di Pol- Sonitehe Telaumbanua, melalui oknum jaksa yang sengaja melin- Tarigan mengatakan kasus ini tersangka mengambil kunci kontak kendaraan korban. ke belakang terkejut melihat atap mobil, Kamis (27/8) malam, tabes kedua tersangka mengaku pengeras suara yang dibawa mo- dungi koruptor di sana. Menu- sedangdidalami.”Tidakadakasus Kemudian korban dibawa tersangka keliling dan saat diperjalanan gudang terbuka dan rusak. Saat ditangkap Reskrim Unit Ranmor telah mencuri kaca spion mobil bil bak terbuka memprotes kiner- rutnya, sejak tahun 2001 Pemkab yang tidak ditindaklanjuti, tapi bertemu petugas Brimobdasu yang sedang melakukan patroli di diperiksa, ternyata sudah ada Poltabes, usai melakukan aksinya Vios yang parkir di Jalan Sutrisno ja Kejatisu yang belum menun- Nias di bawah komando Bupati perlu proses, “ pungkas Tarigan daerah-daerah rawan aksi kejahatan. bahan baku logam yang hilang. di Jalan Sutrisno Medan. Medan. Pengakuan tersangka taskansatupunkasuskorupsiyang Binahati B Baeha diduga sudah seraya menambahkan pihaknya Korban langsung menyuruh tersangka berhenti, akibatnya Lalu penjaga gudang langsung Kedua tersangka BH, 35 dan sudah beberapa kali melakukan dilaporkan ke lembaga tersebut menjadi sarang korupsi. Antara tidak bisa memastikan kasus itu tersangka yang memboceng korban gugup dan terjatuh dari sepeda menghubungipimpinannyayakni ID, 31, warga Jalan STM, kemu- aksinya dan baru satu kali ini “Kami minta Kajatisu segera lain, kasus korupsi bencana alam akan dituntaskan. motor.Sedangkansatutersangkalagi,ImesSamosir,yangmengendarai menuntaskan puluhan kasus Rp3,5 miliar, kasus PT GRUTI Meskitidakpuasdengankete- Aseng. dian diboyong ke Poltabes tertangkap. (m39) korupsi yang melibatkan Bupati tentang penebangan hutan di ranganHumasKejatisuitu,massa sepeda motor Yamaha RX King berhasil melarikan diri. Kapolsekta Medan Baru, AKP M Adenan AS,SH,SIK mengatakan, NiasBinahatiBBaehadanpejabat Hibala, kasus PSDA tahun 2002- Formanispe membubarkan diri tersangka sudah dijebloskan ke dalam tahanan sedangkan satu Buka Puasa Di JRP lainnya, “ teriak Telaumbanua mengawali orasinya. 2003 senilai Rp2,3 miliar, kasus pengadaan mobil dinas tahun dengan tertib.”Kami kecewa dengen penjelasan pihak Kejatisu pelaku lagi masih dalam pengejaran.(m31) Menurut Telaumbanua, 2005 senilai Rp5,3 miliar. tadi, sebab alasan mereka setiap Kurniati Lumpuhkan Perampok Manusia Harus Jauhi Sifat Celaka lambannya penanganan kasus korupsi di Nias tidak terlepas dari Kemudian, kasus aliran dana dari Menko Kesra tahun 2006 kali kami demo tidak berubah itu-itu saja,” ujarnya. (h05) Poltabes Beri Penghargaan MEDAN (Waspada): Manu- Palang Merah Medan, kemarin. Jika zakat fitrah diserahkan MEDAN (Waspada): Poltabes Medan memberikan penghar- gaan kepada Arti Kurniati, 19, atlit Kempo Sumut. sia hendaknya menjauhi lima sifat yang bisa membuat mereka celaka, kata seorang ustadz. Hadir Direktur Jhon Robert Powers (JRP), Indayati Oetomo, seluruh staf dan pegawai dan kepada panitia zakat pada ma- lam takbiran, tentu saja mem- buat petugas kewalahan mem- Pegawai Dishub Kelautan Penghargaan itu diberikan kepadanya di Mapoltabes, Sabtu (29/8), karena berhasil melumpuhkan perampok bersenjata api yang sudah berulangkali melakukan aksinya di berbagai, terutama Yahya Tambunan mengata- kan, lima sifat itu yakni, perta- ma, semakin tinggi ilmu mereka undangan lainnya. “Kerugian manusia yang mengambil sifat ini sangat besar. bagikan pada yang memerlu- kan. Sipenerima juga bingung menggunakan haknya karena Tipu Pencari Kerja Diringkus di Kota Medan. Kapoltabes Medan Kombes Pol. Imam Margono semakin sombong dan cong- Terutama mereka yang semakin sistem jual beli sudah tutup pada MEDAN(Waspada):Reskrim nya. Kemudian IS mengaku bisa Setelah beberapa bulan ke- mengatakan hal itu kepada Waspada melalui telefon selular pada kak. Kedua, semakin tambah kaya semakin pelit atau bakil. 1 Syawal nanti. “Saya sarankan Unit Ranmor Poltabes Medan memasukkankerjaataumenjadi- mudian persisnya Agustus 2009, malamnya. amal ibadahnya tetapi semakin Bersamaan dengan Ramadahan segera memberikan zakat fitrah menangkap oknum pegawai kan PNS di Dishub Kelautan korban yang sudah menunggu “Kita sangat apresiasi terhadap keberanian mahasiswi Unimed ria dalam beribadah. Ketiga, ini, orang muslim harus mem- pada para petugas agar disalur- DinasPerhubungan(Dishub)Ke- Belawan. lama tidak ada kabar dari pelaku itu. Nekat melumpuhkan perampok bersenjata api melalui aksi orang yang bertambah tinggi buang sifat itu. Apalagi Allah kan pada yang berkepentingan.” lautan Belawan yang melakukan Mendengar ucapan tersang- berusaha menemuinya di ru- individu (satu lawan satu),” ujarnya. pangkat dan jabatannya se- melipatgandakan pahala orang Sementara itu, Direktur JRP penipuansebesarRp20jutauntuk ka, Sunyoto mempunyai niat me- mahnya kawasan Belawan. Peristiwa perampokan bersenjata api itu terjadi Minggu (23/ makin tinggi hatinya, keempat yang selalu memberi. Terlebih Indayato Oetomo mengatakan, biaya masuk PNS dalam penyer- masukan anaknya PNS. Kemu- Namun, tersangka sulit ditemui 8) sekira pukul 06.00. Tersangka yang mengendarai sepeda motor orang yang semakin tambah menjelang berakhirnya Rama- kegiatan ini dilaksanakan setiap gapan di kediamannya Belawan, dian korban menanyakan berapa dan sering tidak berada di rumah. mencoba melakukan perampokan terhadap Hj. Delviana Br umurnya semakin banyak dhan, di mana ada kewajiban tahun, selain menjalin kedekatan Minggu (30/8) malam. biaya untuk pengurusan menjadi Merasa telah menjadi korban Sembiring, 54, (ibu kandung Arti Kurniati) yang baru pulang shalat kelakukan buruknya dan kelima membayar zakat diri atau zakat dengan para relasi dan tenaga Tersangka IS, 41, ditangkap pegawai Dishub Kelautan penipuan,tanggal23Agustus2009 Subuh di kawasan Jalan Nusa Indah Kompleks Pemda, Tanjungsari. bertambah hartanya semakin fitrah,” ujarnya. pengajar di sekolah kepribadian ataspengaduankorban,Sunyoto, Belawan. Sunyoto membuat pengaduan Tersangka Budi Santoso, 52, warga Namorambe, Kabupaten tabah pelitnya. MenurutYahya, semestinya ini, program ini sebagai rasa 55, warga Jalan Karya Medan. Selanjutnya tersangka IS ke Poltabes Medan. Deliserdang yang berhasil dilumpuhkan Arti, akhirnya tewas diamuk Yahya menyampaikan hal zakat fitrah itu diserahkan syukur terhadap peningkatan Kasat Reskrim Kompol meminta uang sebesar Rp 20 juta Berdasarkan pengaduan itu, massa. itu dalam tausiyahnya pada beberapa hari menjelang Iduf peserta didik setiap tahun, Gidion Arif Setyawan didampingi kepada korban dengan alasan polisi menangkap tersangka dari Sebelumnya, Arti Kurniati mengaku keberhasilannya melum- acara berbuka puasa bersama Fitri sehingga bisa dimanfa- khususnya untuk kawasan Kota Kanit Ranmor AKP A. Said Rito- untuk biaya pengurusan. Merasa kediamannya.Kemudianoknum puhkan perampok bersenjata api itu karena kehendak Allah SWT. di Jhon Robert Powers Jalan atkan oleh yang memerlukan. Medan. (m36) nga kepada wartawan, Senin (31/ yakin, tanpa banyak tanya lagi, Dishub Kelautan Belawan yang “Tiada daya dan upaya saya untuk melakukan hal itu kalau bukan 8), menyebutkan, peristiwa bera- Sunyoto langsung memberikan disangkakan sebagai pelaku pe- kehendak-Nya.” wal, Oktober 2008, tersangka uang yang diminta pelaku dan nipuan itu diboyong ke koman- Dikatakan, saat perampok memaksa ibunya untuk menyerah- kan perhiasan gelang, Arti langsung melakukan pukulan yang IBS Turki Bantu PA Al Washliyah mendatangikorbandikediaman- dibuat di kwitansi. do untuk diperiksa. (m39) mengarah ke wajah si perampok dan bersamaan dengan tendangan di dada sehingga perampok langsung tersungkur di tanah. “Saya sempat bergumul dengan si perampok dan berusaha MEDAN (Waspada): Pimpi- nan Istanbul International Bro- Kehadiran Mr Serdar Yildirim bersama Mr Mahmut PD Al-Washliyah Kota Medan H Darius, SH.MH dan Pimpinan PT BEST Kuasai merebut senjata api di tangannya. Senjata itu sempat meletus dan therhood and Solidarity Asso- Sami CIL (Country Director IBS) Panti Asuhan Al-Washliyah Pulau saya lihat si perampok berlumuran darah. Tidak berapa lama abang saya (Nata) datang dan merampas senjata api dari tangan perampok ciation (IBS) Turki untuk Asia Pasifik, Mr Serdar Yildirim, membawabantuandariIBSTurki ini disambut warga panti asuhan Brayan Medan, H Hamzah, Mr SerdarYildirim mengemukakan Pabrik Migor Digugat dan membuangnya. Melihat perampok sudah tidak bersenjata mengatakan, anak-anak muslim denganacarapenuhkekeluargaan Insya Allah kegiatan dan bantuan api, akhirnya massa yang menyaksikan kejadian itu langsung seluruh dunia termasuk di Indo- dan Islami, diawali pembacaan ini dapat terus mereka lanjutkan, MEDAN ( Waspada): PT atas perkara No.226/Pdt.G/1989/ berkekuatan hukum tetap,” menghajar si perampok hingga akhirnya tewas,” jelas Arti. (m31) nesia harus diupayakan menda- ayat suci Al-Quran oleh qoriah termasuk akan berupaya mem- Berlian Eka SaktiTangguh (BEST) PN.Mdn jo No.303/Pdt/1990/ tambah Made R Mardanus. pat pendidikan terbaik dalam Nur Misbah Sinaga (Juara MTQN berikan dukungan bidang pendi- digugat di Pengadilan Negeri PT.Mdn jo No.1710/K/Pdt/1991 Dengan demikian, timpal Medan karena dinilai menguasai jo No.288/PK/Pdt/1996, pabrik Kunang, secara hukum penggu- Pengedar CD Porno berbagai aspek agar mampu membuktikanajaranIslamadalah Provinsi Sumut Cabang Qira’ah Sabaah tahun 2008) serta pem- dikan kepada panti-panti asuhan agar anak-anak muslim terus pabrik minyak goreng (migor) migor Mir-Mar yang dibangun gat adalah pemilik sah atas objek Mir-Mar di Desa Pulau Berayan di areal seluas 40.933 M2 adalah perkara yang dikuasai PT BEST Dan Togel Dibekuk Rahmatan Lil Alamin, untuk kebaikan semesta alam. bacaan Shalawat dalam Bahasa Arab dan Bahasa Inggris. memperoleh pendidikan terbaik. Istanbul International Bro- Kota, Medan Labuhan, secara milik PT Munir Hamid. dan seharusnya telah diserahkan ‘’Ini hal penting, diharapkan Mr SerdarYildirim mengaku therhood and Solidarity Asso- tidak sah dan melawan hukum. “Atas putusan itu, objek dan menjadi milik PT Munir MEDAN (Waspada): Polsekta Medan Baru menangkap tiga “Perusahaan berkantor di KL perkaradiperintahkandiserahkan Hamid. tersangka pengedar CD berisi film porno dan judi toto gelap di dua anak-anak muslim senantiasa sangat terharu dan bersyukur ciation Turki ini adalah suatu lokasi berbeda, Sabtu (29/8). mendapatkanpendidikanterbaik dapat membawa langsung lembaga atau asosiasi yang Yos Sudarso Medan itu digugat kepada penggugat, tapi hingga Namun, tambah Mardanus, Tersangka FAT, 24, penduduk Jalan Karya Jaya Gang Eka Prona di manapun ia berada, termasuk bantuan dari IBS Turki ini di bekerjadilapangandalambentuk PT Munir Hamid karena objek sakarangmasihdikuasaitergugat,” hingga saat ini objek perkara di- Kelurahan Pangkalan Masyhur, polisi menyita barang bukti 5 keping para anak yatim di panti-panti tengah-tengah warga panti tugas-tugas kemanusiaan. ‘’Kami pekarapabrikmigoryangdikuasai tambah Kunang didampingi kuasai tergugat hanya berdasar- CD itu. asuhan dan pesantren maupun asuhan yang dinilainya memiliki sudah lama hadir di Indonesia, tergugat sudah dimenangkan rekannya Made R Mardanus, kan penetapan Ketua MA No.01/ Sedangkan, AP 47, penduduk Jalan Binjai Km 10,8 Gang Sama , lembaga sosial lainnya,’’ ujar potensibesarbagipengembangan terutama sejak bencana alam penggugat sesuai keputusan selaku kuasa hukum penggugat Eksekusi/Pdt/Pen/1996 tanggal Desa Payageli, DHM, 44, penduduk Jalan Sekolah DusunV Kecamatan Mahkamah Agung (MA) berke- PT Munit Hamid. 26 Februari 1996, tentang pem- Serdar dalam bahasa Inggris saat sumberdaya umat. ‘’Saya benar- tsunami kami hadir di Nangroe kuatan hukum tetap,” kata M. Lebih jauh Kunang menga- batalan eksekusi yang dilakukan Sunggal Kabupaten Deliserdang, darinya disita 3 lembar potongan menyerahkan bantuan beras, benar seperti merasa di rumah Aceh Darussalam (NAD) dalam kertas berisikan rekapan nomor toto gelap (Togel), 2 unit handphone Intan A Kunang kepada warta- takan, putusan MA itu, juga telah PN Medan atas putusan kasasi minyak goreng, mie instant, sendiri. Indonesia merupakan tugas sosial dan bantuan kema- wan, Kamis (27/8) di Medan. dieksekusi pada 20 Januari 1996 MA. “Inilah salah satu dasar klien berisikan memori pesanan nomor togel, uang Rp87.000. kecap, sirup dan sejumlah bahan negara kedua kami,’’ ujarnya nusiaan, telah membangun ratu- Kapolsekta Medan Baru AKP M Adenan AS kepada Waspada Kunang mengatakan, sesuai oleh Pengadilan Negeri Me- kami keberatan dan melakukan sembako lainnya kepada Panti disambuttepuktangahanak-anak san rumah dari bantuan masya- putusan kasasi MA register dan.”Dengan dieksekusinya upaya hukum dengan menga- mengatakan, penangkapan itu berawal dari informasi masyarakat Asuhan Al Washliyah Pulau panti asuhan tersebut. rakatTurki serta membantu anak menyebutkan di dua lokasi, Jalan Letjen Jamin Ginting dan Jalan No:1710/K/Pdt/1991 tanggal 15 putusan kasasi MA itu, maka jukan gugatan ke PN Medan,” Brayan Medan, Minggu (30/8). DihadapanSekretarisUmum yatim,’’ tuturnya. (h03) Agustus 1995 tersebut diterbitkan putusan tersebut sah dan sudah pungkas Kunang. (h05) Merbau Baru tepatnya di warung kopi, terdapat peredaran CD porno juga berjalan mulus permainan judi togel. Kanit Reskrim Iptu M. Faruk Rozi bersama personelnya dalam tempo setengah jam setelah menerima instruksi berhasil menangkap tersangka. Adenan mengatakan, mereka dijerat pasal 303 Subs 303 SPKs Jangkau 900 Orang Bis KUHPidana dengan ancaman 10 tahun penjara. (m31) Rentan HIV/AIDS Satlantas Poltabes MEDAN (Waspada): Sejak PSK lainnya. Tapi, dari 900 orang pingan,lanjutnya,timmelakukan Razia Malam Hari Juni 2008 hingga Agustus 2009 LSM Sumatera Peduli Kesehatan yang dijangkau yang terinfeksi HIV hanya sekitar 10 persen, pendampingan (lay support) membangkitkansemangatODHA MEDAN (Waspada): Selama bulan Ramadhan Satuan Lalulintas (SPKs) HIV/AIDS telah menjang- mungkin saat diperiksa dengan dan OHIDA untuk hidup dan Poltabes Medan melakukan penindakan di beberapa titik kota Medan, kau sedikitnya 900 orang kelom- mobileVCTatauklinikVCTbelum berani berkarya serta membantu pada malam hari. pok resiko tinggi terkena HIV/ kelihatan, kan masa inkubasinya menjadi ODHA yang berdaya. Informasi di Satlantas, Rabu (26/8), menyebutkan, razia dilakukan AIDS agar mau memeriksakan 5 sampai 10 tahun. “Disinikitamemberikanmotivasi petugas di sekitar Jalan Halat, Iskandar Muda, SM Raja dimulai pukul diri ke Klinik VCT (Voluntary Menurutnya, ini adalah salah kepada pasien yang positif HIV 19:30–20:30.Setiapmelakukanpenindakan,dipimpinseorangperwira. Counselling Testing). Mereka satu program dalam mencegah agar percaya diri dan tidak putus Seperti di Jalan Halat, razia dipimpin Kanit Reg Ident Satlantas yang termasuk resiko tinggi yakni, penularan HIV/AIDS di masyara- asadalammenghadapikenyataan Poltabes, AKP Widodo. Dalam satu malam, Satlantas Poltabes bisa PSK (Pekerja Seks Komersil), kat dari tiga program. Ketiga pro- yang ada,” terangnya. menindak hingga 100 pengendara sepeda motor, terutama yang waria, dan sesama jenis. gram pencegahan itu yakni Lay Sementara itu Peer Educator tidak menggunakan helm dan kaca spion. Hal ini disampaikan Direktur Support (pendampingan), Out- (penyuluhan-red), tugasnya “Sejak dari Ramadhan pertama hingga hari kelima sudah sekitar 500 tilang dikeluarkan,” jelas Widodo, perwira yang memimpin Program LSM SPKs, Hendra, ke- reach (penjangkauan) dan Peer mendatangi daerah-daerah penindakan di lokasi. pada Waspada, di kantornya Jl. Educator (penyuluhan). “Out- jangkauan dengan memberikan Selain itu, lanjutnya, pihaknya juga melakukan razia pada subuh, Bungalau Medan, Kamis (27/8). reach itulah yang melakukan informasi dan membangun terutama ditempat arena balapan liar di Jalan Ngumban Surbakti, Hendramengatakan,daerah- penjangkauan. Kami memiliki 3 kesadaran akan bahaya penu- kawasan Unimed dan Amir Hamzah. daerahyangsudahdijangkauLSM outreach, dimana setiap satu laran HIV/AIDS kepada individu Sementara ditempat lain, pihak Satlantas Poltabes juga ini adalah Jl. Gajah Mada, Djamin outreach setiap bulannya harus atau kelompok dengan harapan membuka counter buka puasa gratis disekitar merdeka walk. Ginting, Simpang Selayang Me- menjangkau minimal 20 orang dapat mengubah prilaku resi- Dalam satu hari counter tersebut bisa menampung hingga 150 Waspada/Surya Efendi dan, Tj. Morawa, dan Jl. Binjai. yang rentan HIV/AIDS perbu- konya serta menjadi rekan dalam orang tukang becak dan para sopir yang tidak sempat pulang BANTUAN TURKI: Pimpinan IBS Turki untuk Asia Pasifik, Mr Serdar Yildirim, menyerahkan “Kami melakukan penjangkauan lannya,” jelasnya. memutuskan mata rantai HIV/ ke rumah untuk berbuka. (m39) bantuan untuk Panti Asuhan Al-Washliyah Pulau Brayan Medan, Minggu (30/8). dioukup-oukupdantempatPSK- Lay Support atau pendam- AIDS. (cmai)
  • 10. 10 Medan Metropolitan WASPADA Selasa 1 September 2009 Konsultasi Zakat Diasuh Oleh: UstadzH.MuhammadNuh Judi Dadu Marak TASBIH RAMADHAN Fidyah (Dewan Syari’ah LAZ Peduli Ummat Waspada) Zakat Dan Kebutuhan Pokok Di Jalan Bakung arigan Oleh: Azhari Akmal Tarig an KoordinatorTim PenulisTafsirYayasan Syekh H. Abdul Halim Hasan Tanya : Assalamu’alaikumWr.Wb. Bapak pengasuh Konsultasi Zakat Polsek T. Morawa Ringkus Pemain Togel yang saya muliakan, Bila seseorang bertani, hasilnya mencapai SELAMA bulan Ramadhan, kata fidyah yakni ber- nishab. Tapi ia masih numpang dan tanggungannya banyak. MEDAN (Waspada): Perjudian dadu (kopyok) perjudian akan diproses kerap muncul di dalam pengajian, ceramah- puasa tiga Apakah ia harus mengeluarkan zakat? Padahal untuk kehidupan hukum,” kata dia, meminta ceramah agama dan artikel-artikel Ramadhan. hari atau selanjutnya ia terjebak hutang konsumtif. Terima kasih atas masih terlihat marak di Medan serta sejumlah seluruh jajaran melakukan razia Kecuali Ramadhan, Kata ini tampaknya jarang bersedekah jawabannya. (08126526xxx) daerah di Sumut. Meski bulan Ramadhan dan atas lokasi-lokasi perjudian di diucapkan atau dituliskan. Agaknya kata fidyah dengan kerap dirazia polisi, permainan judi Medan serta daerah lainnya. terlanjutdipahamidalamhanyadalamkonteks memberi makan enam orang miskin, atau Jawab : Pemain Togel Ramadhan. Pada hal sebagaimana yang akan berkurban dengan menyembelih seekor Wa’alaikumussalamWr.Wb. Di satu sisi kita bersyukur kepada menggunakan papan dan dadu itu masih saja Ditangkap dijelaskanberikutini,katafidyahtidakselamanya kambing. (Shihab: 431). Allah karena hasil pertanian anda telah mencapai nishab, ini berlangsung. karunia Allah SWT. Tetapi pada saat yang bersamaan kami juga Sementara, lima pemain mengacu kepada tebusan bagi orang yang Pada surat Al-Hadid ayat 15 Allah SWT mengajak anda sekeluarga untuk bersabar dalam menghadapi judi toto gelap (togel) warga tidak lagi mampu melaksanakan puasa. berfirman, Maka pada hari ini tidak diterima kenyataan hidup ini. Seperti di Jalan Bakung, Kec. bung, Kab. Serdang Bedagai. Tanjung Morawa, Minggu (30/ Kata fidyah berasal dari kata fadaa, fidaan tebusan dari kamu dan tidak pula dari orang- Sebagaimana anda nyatakan bahwa tanggungan anda berupa Medan Area. Lokasi perjudian Perjudian yang sempat tutup 8) sore, diringkus Unit Reskrim yang berarti menebus atau imbalan. Sedang- orang kafir. tempat kamu ialah neraka. Dialah isteri dan anak-anak cukup banyak. Sehingga beban kehidupan yang mulai tenar, karena selalu itu telah beroperasi lagi. “Sudah Polsek Tanjung Morawa. kanfidyah berarti tebusan. Orang Arab kadang- tempat berlindungmu. dan Dia adalah sejahat- (ma’isyah) anda memang terasa berat. Semoga dengan kesabaran digerebek polisi, masih tetap empat hari bandar judi mem- Kabid Humas Poldasu Kom- kadang bersumpah dengan kata-kata ini. jahat tempat kembali”. Kata fidyah pada ayat dan semangat untuk terus berusaha dan bekerja, Allah memberi saja buka. Lokasinya memang buka lapak disitu, lokasinya salah bes Pol. Baharudin Djafar, Senin Misalnya, ju’iltu fidaka ya rasulullah (biarlah ini berkaitan dengan tebusan atas dosa yang kepada anda sekeluarga rejeki yang halal dan dapat menutupi (31/5) menyebutkan, kelima diriku menjadi tebusanmu wahai Rasulullah). telah dilakukan selama di dunia. Semuanya tidak agak terlindung dari amatan satu rumah diduga milik ban- kebutuhan keluarga. Amin. pemain togel itu diringkus dari Di dalam Al-Qur’an kata fadaa dengan berguna karena hari kiamat sudah menjelang. Pada Ulama’ yang mulia menjelaskan tentang syarat wajib warga, dan selalu ‘dijaga’ warga dar,” kata sumber layak dipercaya Penggunaan kata fidyah di dalam Al-Qur’an segala derivasinya disebut sebanyak 13 kali. zakat, di antaranya adalah :Az-ziyadah ‘anil hajaatil ashliyah sekitar. “Bila ada orang yang kepada wartawan, Senin (31/8). kawasan Pajak Kanan Tanjung Sedangkan kata fidyah disebut 3 kali; surat jelas berkaitan dengan pelanggaran atau dosa (lebih dari kebutuhan pokok) (Al-Fiqhul Islami wa Adillatuhu mencurigakan atau aparat ke- Dia mengatakan, sebelum- Morawa, tidak jauh dari Polsek. Al-Baqarah:184 dan 196. Selanjutnya pada yang dilakukan seseorang baik dalam konteks 2:750). Di antara landasannya adalah sabda Nabi Saw. :”Zakat polisian yang hendak mengge- nya arena perjudian beromset Dari mereka petugas menyita surat Al-Hadid: 15. lebih jelasnya dapat dilihat peperangan ataupun dalam kaitannya dengan hanya dibebankan ke atas pundak orang kaya” (HR. Ahmad rebek lokasi itu selalu ‘tercium’ ratusan juga sekali putar terse- barang bukti uang Rp420 ribu, berikut ini. Pada surat Al-Baqarah:184 Allah ibadah. Jika dihubungkan dengan peperangan, dari Abu Hurairah). Dan firman Allah SWT.:”Mereka bertanya para pemain dan bandar,” te- but sempat tutup, setelah dirazia lima lembar kertas rekap, 12 berfirman, “dan atas orang yang tidak sanggup fidyah berarti tebusan yang digunakan sebagai kepadamu (hai Muhammad) apa yang mereka infaqkan? rang sumber. polisi. Namun ternyata hanya lembar kertas nomor yang (berpuasa) maka baginya fidyah (tebusan) saranauntukmembebaskanseseorangdaristatus- Katakanlah :”Yang lebih dari kebutuhan”.(Al-Baqarah/2:219). Baru-baru ini sebelum bu- beberapa hari, kembali buka. sudah keluar dan 1 buku notes. dalam bentuk makanan bagi orang miskin.” nyasebagaitawananmusuh.Sedangkankaitannya Dalam kaitannya dengan perhitungan zakat kurma, Nabi lan Ramadhan, lapak-lapak “Sejumlah aparat kemungkinan Baharudin menjelaskan, ter- Kata fidyah di sini berkaitan dengan orang- dengan ibadah, fidyah adalah tebusan karena Saw. Bersabda :”Tinggalkanlah sepertiga, bila tidak sepertiga sangka JP merupakan bandar seperempat”. Maknanya sepertiga atau seperempat itu dibebaskan perjudian beromset ratusan juta ‘membeking’ usaha perjudian orang yang tidak memiliki kesanggupan untuk pelanggaran yang kita lakukan terhadap aturan- dari zakat untuk kebutuhan pokok si petani. Maka seseorang tersebut digerebek polisi, namun itu,” terang sumber. togel, yang lainnya, AS, meng- berpuasa. Makna asalnya adalah melakukan aturanyangditetapkannyaataupunketidakmam- bilapunyapenghasilan,dihitungdulukebutuhanpokoknyaberupa hanya beberapa hari saja tutup, Dikatakan, judi dadu yang ambil rekapan dari juru tulis, sesuatu tetapi dengan berat sekali. Hampi- puan kita melaksanakan perintah Allah SWT. sandang (pakaian), pangan (untuk makanan pokok sehari-hari) karena saat ini permainan judi berlangsung setiap hari itu milik ISH penulis togel, IAS mengecek hampir ia tidak lagi mampu memikulnya. Adalah menarik dicermati, dalam kaitannya dan papan (tempat tinggal), jika masih mencapai nishab (batas dikawasanitumasihberlangsung. Ationg. Sedangkan lokasi yang seluruh rekapan dan S sebagai Karenakesulitanyangbersangatanitulah,orang dengan pelanggaran atas aturan Allah SWT, minimal wajib zakat) baru dikeluarkan zakatnya sesuai dengan Lokasi lainnya yang ‘ter- dijadikan tempat bermain dadu penulis. “Kelimanya ditangkap tesebut diperbolehkan berbuka tetapi harus fidyahdiserahkandalambentukmemberimaka- jenis hartanya. cium’ bekas Asrama Widuri di kediaman Ahiam, yang merang- berdasarkan informasi warga,” menebusnya dengan membayar fidyah. nan orang miskin. Tidak disebutkannya kadar Jika perdagangan menurut perhitungan perdagangan yaitu Marendal. Setiap Sabtu dan kap bandar. kata Baharudin menyebutkan, Selanjutnya masih pada surat yang sama atau jumlah yang harus dibayarkan, mengindi- senilai 85 gram emas dengan zakat 2,5 %. Begitu juga pertanian Minggu di tempat itu ada arena Kabid Humas Poldasu pengakuan tersangka omset ayat 196 Allah Berfirman yang artinya, “Dan kasikan bahwa kadar makanan itu berbeda- dengan nishab 5 wasaq, sama dengan 653 Kg padi atau setara diperoleh mencapai Rp2 juta sempurnakanlah ibadah haji dan ‘umrah beda antara satu wilayah dengan wilayah yang dengan 520 kg beras. Kita umpamakan, dari lahan pertanian sabung ayam dan toto gelap Kombes Pol. Baharudin Djafar sekali putaran. karena Allah. jika kamu terkepung (terhalang lain. Lebih dari itu, Allah juga menuntut kita yang anda kelola didapat hasil 1 ton padi/gabah kering. Untuk (togel). “Permainan judi ini dikonfirmasi menegaskan, akan untuk menggunakan akal kita dalam menentu- oleh musuh atau karena sakit), Maka (sem- kebutuhan pengelolaan seperti pupuk, obat/racun, iuran air diduga juga dibeking aparat, menindak para bandar judi ter- “Kini tersangka dijebloskan belihlah) korban yang mudah didapat, dan kan makanan bagi orang miskin yang layak, sawah misalnya sekitar 1 kwintal/ 100 kg jika dinilaikan. karena sudah berlangsung sebut, termasuk bila ada oknum ke sel tahanan Polsek dan dike- jangan kamu mencukur kepalamu, sebelum halal dan baik. Anda dan isteri dengan 5 anak kebutuhan sewa rumah, pakaian lama, namun tidak pernah polisi yang membeking usaha nakan pasal 303 KUHP tentang korban sampai di tempat penyembelihannya. Seharusnya, karena fidyah dilatarbelakangi dasar(harian),makanandengankadarsederhanayangdiperkirakan digerebek,” sebut sumber. perjudian itu. “Kita tegas dengan perjudian dengan ancaman 10 jika ada di antaramu yang sakit atau ada oleh kondisi bersalah karena melanggar atau dalam semusim padi terpakai 5 kwintal. Kalau dihitung demikian, Paling terbaru, lapak dadu ini, bila memang kedapatan tahun kurungan, denda Rp25 gangguan di kepalanya (lalu ia bercukur), ketidakmampuan diri kita sendiri, fidyah harus maka anda tidak terkena wajib zakat, sebab dalam kenyataannya di kawasan desa Ujungram- oknum polisi terlibat dalam juta,” tegasnya.(m11) Maka wajiblah atasnya berfid-yah, Yaitu: diberikan dalam bentuknya yang terbaik. Bukan setelah dikurangi kebutuhan pokok penghasilan anda tidak mencapai nishab. berpuasa atau bersedekah atau berkorban. sekedarnya saja. Masih pantaskah fidyah yang Kata fidyah pada ayat di atas, berkaitan 6onsberasuntukmenebuskesalahankita?Bukan- Namun demikian, seandainya anda menghitung pendapatan kotortanpadikurangikebutuhanpokok,lantasdikeluarkanzakatnya Soal Penertiban Stand Ramadhan Fair dengan haji. Shihab menjelaskan tafsir ayat kah orang yang bersalah bersedia memberi tersebut dengan mengatakan “tetapi jika ada apapunyangdimilikinyaagarialepasdanterbebas Camat, Kasat Pol PP 5 % (sebab biaya tinggi), sungguh ini merupakan kebaikan untuk anda. Sebab dalam ibadah maliyah (ibadah yang bersifat di antara kamu yang sakit, seperti luka atau dari kesalahannya. Bagi saya membayar fidyah mengeluarkan harta) jika dikeluarkan lebih dari yang semestinya, ada gangguan di kepalanya akibat penyakit tidak mesti menunggu pengumuman masjid. itu merupakan kebaikan bagi pelakunya. Semoga Allah atau kutu dan semacamnya yang mengharus- Pikirkanlah makanan yang pantas bagi orang melimpahkan keberkahannya kepada anda sekeluarga dan kita semua, insya Allah. Amin. Tak Mau Disalahkan kan ia bercukur, lalu ia bercukur, maka wajiblah atasnya membayar fidyah, yakni imbalan atas ditinggalkannya suatu aktivitas yang mulia, miskin selama satu hari dan berikanlah ! Mudah- mudahan Allah memaafkan kesalahan kita. Amin. LAYANAN JEMPUT ZAKAT (Khusus Kodya Medan): 77775262 Pembayaran ZIS via Bank MEDAN (Waspada): Camat parkir merupakan tugas Dinas di Jalan Mahkamah, sementara Medan Maimun Arfan Harahap Perhubungan Kota Medan. Se- lewat rel kereta api itu ditangani Zakat BMI BSM 211.00044.15 006.002240.7 Infak/Sedekah BMI BSM 211.00002.15 006.000832.1 danKepalaSatpolPPKotaMedan Musaddad tidak mau disalahkan mentara itu, pihak kecamatan tidak dilibatkan dalam masalah camat. “Itu tugas Camat Medan Maimun bukan tugas kami. Me- IPHI Sumut Buka Bersama BNI Syariah 0092687629 BNI 005.7504808 BCA Bank Mandiri 022.0945383 106.000220380.3 Bank Sumut 100.02.04.034144.5 terkait penertiban pedagang kaki lima (PKL) di arena Ramadhan Fair VI. ini.“Satpol PP dan Dishub tidak berperan. Parkir bayar, PKL ber- tambah. Padahal mereka bertu- reka yang mau melakukan pem- binaannya. Dan itu dijanjikannya di depan Sekda Dzulmi Eldin,” Dan Serahkan Paket Ramadhan Keterangan: Menurut Arfan, terkait per- gas di situ mendapat honor, kami pungkasnya.“Jangan bicara MEDAN (Waspada) : Guber- Helmi, sejumlah ulama di anta- masamendatang,terutamadalam Rubrik ini terbit setiap hari selama Bulan Ramadhan yang dikelola oleh LAZ soalan PKL yang ada di sekitar tidak ada. Tapi, kenyataannya ini Tufoksi, kalau memang mau Peduli UmmatWaspada. Bagi Anda yang ingin konsultasi zakat melalui rubrik nur Sumatera Utara, H Syamsul ranya KH Zulfiqar Hajar serta membantu dhuafa yang tahun arena Ramadhan Fair (lewat rel memang bukan tugas kami,” ditertibkan semua stand-stand Arifin, SE selaku Ketua Dewan PD IPHI Kabupaten Langkat. ini disalurkan kepada 150 orang. ini dapat dikirim ke alamat kami: Jl. Brigjend Katamso No. 1 Medan 20151 (Gedung Harian Waspada) samping Perpustakaan Sumut), ucapnya. itu, serahkan kepada kami, biar Penasihat Ikatan Persaudaraan Dia berharap agar semua “IPHI Sumut mengucapkan Telp/fax. (061) 4511936 / 08126526295 atau e-mail: pihaknya hanya melakukan pe- Dia juga menerangkan, kami selesaikan,” ucapnya. Haji Indonesia (IPHI) Sumut, pihak memberikan dukungan terimakasih kepada semua pihak peduliummat@waspada.co.id ngawasan saja, sedangkan penin- persoalan pendirian 30 stan oleh Sementara itu, PenjabatWali- meminta agar IPHI di masa men- terhadap IPHI, terutama kepada yang telah membantu dalam ke- dakan secara teknis terhadap LPM Kelurahan Aur juga dinilai kota Medan Rahudman Hara- datangharuslebihbagusdanbaik Pj Walikota Medan yang juga lancaranacaraini,sehinggaberja- pedagang yang membandel bukan awal berjualannya PKL di hap mengatakan, Satpol PP, denganmeningkatkankinerjanya. unsur pengurus IPHI Sumut agar lan lancar dan sukses,” sebutnya. “IPHI sudah bagus, tetapi membantu organisasi ini dalam Acara berbuka puasa bersa- Temu Kangen Angkatan 94 merupakan tugas Satpol PP “Siapa yang menertibkan . kawasan itu. Sebab, tidak ada yang bisa menjamin kawasan itu CamatMedanMaimundanDinas Kebudayaan dan Pariwisata akan belum baik. Sebab, predikat baik manajemennya. Sehingga, IPHI ma itu diwarnai pemberian Paket akan diperhitungkan di akhirat Sumut lebih lagi di masa men- Ramadhan kepada 150 orang MAN I Medan sesuai tugas pokok dan fungsi sajalah. Kami hanya melakukan bebas dari PKL. “ tidaknyastanyangdibuat Ada dipanggil untuk menyelesaikan masalah ini. nanti,” katanya dalam sambutan datang. Bulan suci Ramadhan dhuafa dari kalangan bilal mayit, MEDAN (Waspada): Kehadiran Ramadhan Fair dirasakan pengawasan saja, penertiban LPM, tidak menjamin jalan itu “Mereka akan saya panggil pada Buka Puasa Bersama Ke- ini dapat memperbaiki diri kita penggali kuburan, anak yatim- bermanfaat bagi banyak komunitas. Bukan sekadar menikmati bukan urusan kami,” katanya di bebas dari PKL.Yang penting se- untuk segera menyelesaikan luarga Besar PW IPHI Sumut seutuhnya. Tidak saja dalam pitu dan fakir miskin yang berdo- jajanan, namun banyak di antara mereka yang sudah lama tidak Kantor Walikota Medan, Senin karang PKL di sana minta diter- denganGubsudikediamanKetua ibadah, juga hubungan sesama misili di sekitar Jalan Kapten persoalan ini. Jual jilbab, baju bertemu dipertemukan kembali. Seperti halnya alumni siswa (31/8). tibkan,” pungkasnya. PW IPHI Sumut, Jalan Kapten kita. Apalagi, bulan Ramadhan Sumarsono serta PD IPHI kabu- tidak masalah, yang jadi masalah Sumarsono No.76/141 Helvetia menjadikan tempat kita ber- paten/kota. Sedangkan Paket Madrasah Aliyah Negeri (MAN) I Medan angkatan 1994. Dia menambahkan, pener- Sementara itu, Kepala Satpol lokasi berjualannya tidak dibe- Saat bertemu di Ramadhan Fair, mereka kemudian sepakat Medan, Sabtu (29/8). tafakkur. Ramadhan itu bantuan dari tiban PKL dilakukan Satpol PP , PP Musaddad mengatakan, narkan.Iniakandiatasi,”demikian Hadir dalam acara itu, Ketua Sebelumnya, Ketua PW IPHI pengusaha Majestik Bakery. membentuk komunitas Afiliasi 94 (Alumni Agama Fisika Biologi Sosial ’94) MAN 1 Medan. sedangkan untuk pengaturan pihaknyahanyamenertibkanPKL Rahudman. (h10) Umum MUI Sumut Prof Dr H Sumut H Ahmad Husein dalam PenyerahanPaketRamadhan Lebih 15 tahun terpisah jarak dan waktu, Abdurahman Saleh Abdullah Syah MA, Ketua Umum sambutan selamat datangnya itu dilakukan Gubsu H Syamsul berjumpa teman lamanya Risdianto, teman lain seperti Budi R Lubis, Azhari Marzuqie, Budiman Abrar, Sahreni, Agus Susanto dan Hasbullah. Pertemuan ini mereka manfaatkan menjadi benih Pungli Meresahkan MUI Medan Prof Dr H Mohd Hatta, Kakanwil Depagsu Drs H Syariful Mahya Bandar MAP, mengatakan, pelaksanaan buka puasa bersama keluarga besar IPHI Sumut bekerjasama dengan Arifin didampingi Ketua PW IPHI Sumut H Ahmad Husein. Acara itu ditutup doa dibawakan Ketua timbulnya Afiliasi 94 MAN 1 Medan. Dari bincang-bicang itu tercetus ide temu kangen akbar yang akan dilaksanakan Kamis, 24 September 2009 khusus angkatan 94. Pengunjung Ramadhan Fair Kakandepag Medan Drs H Abdul Rahim MHum, Pj Walikota Me- dan Drs H Rahudman Harahap beberapa pihak merupakan keduakalinya.Karenaitu,ujarnya, tradisi yang baik ini hendaknya Umum MUI Sumut H Abdullah Syah. Dilanjutkan Shalat Magrib berjamaah dan makan malam Konfirmasi melalui Risdianto (08126496198). MM, Sekda Medan Drs Dzulmi dapat lebih ditingkatkan lagi di bersama. (m36) “Rekan-rekan yang berkenan hadir diberi batas waktu konfirmasi MEDAN (Waspada): Pe- takankawasansekitarRamadhan taannya parkir illegal itu naik 400 18 September 2009,” kata Risdianto menyebutkan, wadah ini menjadi ngunjung kegiatan Ramadhan Fair parkir gratis. Namun, ke- persen untuk sepedamotor,’’ satu nilai keakraban guna membangun bangsa dan memberikan satu informasi yang bermanfaaat bagi seluruh keluarga besar.(m11) Fair 1430 Hijriah di Jalan Masjid Raya, Medan, resah dan menge- nyataannyadilakukanpengutipan oleh sejumlah remaja maupun tegasnya. DiamemintaketegasanPem- Tiket Pesawat Masih Murah luh dengan adanya kutipan uang pemuda. ko maupun penyelenggara, jika MEDAN (Waspada): Hingga Karena permintaan tiket kaitan, meningkat arus balik dari Santunan Diberikan Kepada parkir liar atau pungli untuk sepedamotor Rp2 ribu dan mobil ‘’Kutipan parkir tersebut sudah berlangsung sejak hari parkir dikutip lakukan secara res- mi dengan karcis retribusi. Kalau minggu kedua Ramadhan, masih lesu harganya juga belum Medan tujuan Jakarta dan kota manajemen Lion Air masih naik. Sementara harga tiket Me- besar lainnya. Panti Asuhan Bani Adam Rp5 ribu sekali parkir. Hal itu diungkapkan sejum- pertamakegiatanRamadhanFair. Jadi, percuma saja spanduk yang yangsekaranginijelas-jelaspungli oleh preman dan berlangsung menjual tiket Rp479 ribu sekali jalan pada rute Medan tujuan dan tujuan Jakarta antara Rp479 ribu yang termurah dan kelas Sementara itu Muni, agen tiket dari Kings Travel Medan MEDAN (Waspada): Majelis Dzikir Az Zikra (MDAZ) Sumatera lahwargakepadaWaspada,Sabtu dipasangPemkoMedantersebut, di depan mata kalangan petugas. Jakarta yaitu mencapai. termahal Rp800 ribu, ujar dia. (KTM) ketika dikonfirmasi Utara bersama Hizbut Tharir Indonesia (HTI) Sumut, Pendam I/ (29/8) malam, pada saat mereka sedangkan petugas BPP seperti Warga yang enggan menye- “Saat ini permintaan seat Saat awal Ramadhan belum menyatakan untuk saat ini BB danWartawan Pertahanan Kodam I/BB memberikan santunan, hendak mengambil sepedamo- tahun-tahun lalu melakukan pe- butkan jatidirinya itu, mengakui, pesawat masih stabil,” kata Yuli ada pergerakan permintaan seat, penerbangan di Bandara Polonia bingkisan dan berbuka puasa bersama dengan anak Panti Asuhan Aspita, Distrik Manajer (DM) sementaraLion Air juga menam- Medanmasihmenjualtiketantara Bani Adam, Kecamatan Medan Labuhan, Jumat (28/8). Santunan yang tornya yang parkir di trotoar per- ngawasan,ternyatasekaliinitidak Sabtu malam itu, arena Rama- simpanganJalanBrigjenKatamso ada,’’ ucap seorang warga kesal. dhan Fair benar-benar padat se- Lion Air ketika dikonfirmasi, bahflight menjadi 15 flight antara Rp500 hingga Rp700 ribu sekali disalurkan berupa 250 kain selimut, bantal serta bingkisan uang. Minggu (30/8) sore. lain Medan-Jakarta 11 flight, jalan Medan-Jakarta. Kegiatan itu dirangkai dengan tausyiah yang disampaikan Ali - Masjid Raya (depan pertokoan) Warga lainnya mengatakan, hingga pengunjung sulit berjalan untuk pulang. kalau pun memang terjadi pe- akibat berdesakan. Anak-anak Yuli menyebutkan, hingga Medan-Banda Aceh dan Medan- Sementarago show atau beli Murthado dihadiri Kapendam I/BB Letkol CAJ, Asren Nasution; Minggu belum ada peningkatan Batam masing-masing 1 flight di loket bagi penumpang berang- Ketua Majelis Taklim Az-Zikra Sumut, Rizal Mahaputra; Ketua Majlis Mereka sangat terkejut dan ngutipan parkir hendaknya harus kecil menangis meraung. Keja- permintaan tiket dari Medan tu- danMedantujuanPenang2flight. kat mendadak hanya Rp720 ribu, TaklimWanita Az-Zikra Sumut, Maryam Lubis; Humas Hizbut Tahrir kecewa, karena persis di atas legal dan pakai karcis retribusi dian ini terutama karena bagian juanJakarta,MedantujuanBanda Harga tiket, katanya, bakal baik Lion Air, Batavia Air, Sriwi- Indonesia Sumut, Azwir Ibnu Aziz;Wakil KetuaWartawan Pertahanan trotoar depan pertokoan itu ter- sebagaimana ketentuan berlaku. tengahruasjalandiramaikanlapak Aceh, Medan tujuan Penang dan naik empat hari usai Lebaran Idul jaya Air, Mandala Airline dan Kodam I/BB, Suyono, dan pengurus lainnya. pajang spanduk yang menya- ’’Ini, katanya gratis, tapi kenya- pedagang kaki lima.(m34) Ketua Majlis Taklim Wanita Az-Zikra Sumut, Maryam Lubis, bahkan Medan tujuan Batam. Fitri 1430 H. Hal tersebut ber- penerbangan lainnya. (m32) dalam sambutan, mengatakan, pemberian santunan dan makanan berbuka puasa kepada anak panti asuhan itu untuk menjalankan anjuran Allah SWT dan Nabi Muhammad SAW. Sementara itu, Kapendam I/BB, Asren Nasution, mengemukakan, pemberian santunan ini wujud kepedulian bersama. Hal senada Ramadhan Expo 2009 juga disampaikan Suyono, wakil ketua Wartawan Pertahanan. Ali Murthado dalam tausyiah menjelaskan, umat Islam diperintahkanAllahSWTdanRasulMuhammadSAWmemperhatikan Dipadati Pengunjung anak yatim. Katanya, orang yang tidak peduli atau menghardik anak yatim sama dengan mendustakan agama. (m34) MEDAN (Waspada): Menje- bersaing serta kualitas barang untuk memberikan kesempatan lang pertengahan bulan Rama- yang baik. kepadausahawankecilmenengah dhan tahun ini, Ramadhan Ekspo Kebutuhan lebaran yang mempromosikan produksinya. USU Saatnya Reformasi Diri 2009Marelanyangdigelarselama satu bulan di lapangan bola kaki dijajakan di bazar itu lengkap, dimulai dari sepatu, sandal, “Disini, hadir pedagang yang menjual kain songket produksi MEDAN (Waspada): Jajaran pimpinan Universitas Sumatera Pasar V, Kel. Rengas Pulau, Kec. pakaian muslim, dan assesoris khas asal Pelembang dengan Utara (USU) baik pada tingkat rektorat, dekanat maupun departemen Medan Marelan, mulai ramai pendukungnya. Selain itu kebu- hargacukupkompetitip,”katanya, program studi sudah saat mereformasi diri. Dengan cara itu USU dikunjungi pembeli yang berasal tuhan rumah juga tersedia di Sabtu (29/8). bisa maju dan berkompetisi di dunia pendidikan. Loni Gulo, mantan Ketua Umum Ikatan MahasiswaTeknik Kimia dari daerah Medan Utara se- antaranya TV, kulkas, bunga dan Bukan hanya itu, sejumlah (Imatek) USU mengatakan hal itu seusai menghadiri seminar nasional kitarnya. hiasan dinding demikian juga pedagang makanan, minuman bertajuk “Inovasi Teknologi Proses Dalam Permanfaatan Sumber Umumnya pembeli yang da- dengan buku- buku agama. danjajananuntukkebutuhanber- Daya Alam Menuju Bumi Hajau” berlangsung di Convention Hall tang ke bazar tersebut mencari Ketua PAC Pemuda Pancasila buka puasa sengaja dihadirkan Hotel Tiara Medan, pekan lalu. pernak- pernik untuk kebutuhan (PP) Marelan, Mulyadi yang mengisi Ramadhan Ekspo 2009 Sebagai konsultan dan trainer yang bermukim di Jakarta, Gulo Idul Fitri 1430 H. Puluhan peda- bertindak selaku Koordinator Marelan yang akan berakhir pada sangat menyayangkan sikap fakultas, rektorat dan beberapa dosen gang yang berasal dari Pajak Sam- Ramadhan Ekspo 2009 Marelan malam takbiran itu. “Pedagang teknik USU yang tidak hadir dalam acara itu. Seolah-olah mereka bu, Pajak Brayan dan Pajak Bela- mengatakan, selain bertujuan makanan dan minuman ini diha- Waspada/ Rustam Effendi tidak mendukung kegiatan seminar nasional yang diadakan depar- wan serta pajak lain sekitarnya menyajian kebutuhan lebaran dirkan untuk menciptakan rasa RAMAI: Pembeli padati Bazar Ramadhan Ekspo 2009 Marelan yang dilaksanakan selama temenTeknik Kimia. Padahal, lanjutnya, kegiatan seperti itu membe- telah siap menyajikan seluruh yang murah dan berkualitas, kebersamaan dan saling mem- satu bulan di lapangan bola kaki Pasar V, Kel. Rengas Pulau, Kec. Medan Marelan. Foto diambil, rikan kesempatan bagi USU untuk mempromosikan diri. (m23) kebutuhan itu dengan harga Ramadhan ekspo juga diciptakan butuhkan,” tandas Mulyadi. (cre) Sabtu (29/8) malam.
  • 11. WASPADA Selasa 1 September 2009 Medan Metropolitan 11 Pejabat Takut, Banyak Anggaran Tak Digunakan MEDAN (Waspada): Tahun 2008, diperkirakan sama. Contohnya Kaban Ling- kepala SKPD mengundurkan diri lebih kurang Rp400 miliar dana APBD tidak kungan Hidup, Purnama Dewi. kalau takut beresiko dalam me- Dia juga mengaku banyak layani masyarakat. Kepala dinas, direalisasikan. Itu terjadi karena Satuan Kerja anggaran yang dikelolanya tidak katanya, jangan mau enaknya Perangkat Daerah (SKPD) ketakutan terealisasi. Alasannya, karena saja. menggunakan anggaran. minimnya waktu pelaksanaan Satu sisi, menurut Abdul anggaran. Rahim, rasa takut merupakan hal Wartawan banyak mende- dan Pemukiman (Perkim) Iriadi Ketakutan para kepala SKPD yang manusiawi. Tapi, kalau ngarkan pernyataan langsung Irawadi, secara terus terang me- inimembuatkesalanggotaDPRD karena itu malah mengorbankan kepala SKPD tentang ketakutan ngakui takut menggunakan Medan. Pejabat Pemko Medan kepentingan masyarakat, itu mereka tersebut. Sejak Selasa anggaran. Akibatnya sejumlah dinilai tidak memperdulikan sudah tidak benar. Pejabat yang sampai Jumat pekan lalu, komisi- anggaran di dinasnya tidak digu- masyarakat. Karena, akibat tidak ketakutan itu yang seharusnya komisi DPRD Medan melaksa- nakan. Dia tidak perduli, tentang berjalannya beberapa program mundur. nakan rapat dengan para SKPD, pelayanankepadapublik.Apakah kerja, mempengaruhi pelayanan ‘’Kan aneh. Masyarakat dalam rangka pembahasan jalan di lingkungan masyarakat kepada masyarakat. membutuhkan pelayanan, ter- Laporan Pertanggungjawaban sudah diaspal atau belum. Anggota Fraksi Partai Ke- utama infrastruktur, tidak diberi- (LPj) walikota tahun 2008. Begitu juga kepala dinas dan adilan Sejahtera (PKS) Abdul kan hanya karena pejabatnya Kepala Dinas Perumahan badanlainnya,mengakuihalyang Rahim Siregar, malah minta takut,’’ ujar Abdul Rahim. (m17) Dinkes Medan Abaikan UU Dan SE Menkes Tender JPKMS Jalan Terus Waspada/Dediriono MENGUNDI: Redaktur Siaran Minggu Waspada (SMW) H Halim Hasan mengundi kupon kuis THR Waspada-Honda, di Lantai MEDAN (Waspada): Dinas Mengenai UU No. 40 Tahun 1disebutkan,jaminansosialadalah tannya menjadi tanggung jawab 3 Gedung Bumi Warta Harian Waspada, Senin (31/8). Dalam pengundian itu, hadiah utama Rp1,5 juta diraih Tapisari Siregar. Kesehatan Kota Medan terkesan 2004 Bab III tentang Badan Pe- salah satu bentuk perlindungan pemerintahdaerahsetempatdan mengabaikan UU No. 40 Tahun nyelenggaraanJaminanSosialdan sosial untuk menjamin seluruh mekanisme pengelolaannya 2004 Bab III tentang Badan Surat Edaran (SE) Menkes RI, rakyat agar dapat memenuhi mengikuti model Jamkesmas. Kuis THR Waspada-Honda Penyelenggaraan Jaminan Sosial Polita mengatakan, coba baca kebutuhan dasar hidupnya yang Saat ini, program Jamkesmas dan Surat Edaran (SE) Menkes RI No. 28 tahun 2009. Buktinya, proses tender program Jaminan betul-betul undang-undang itu. “Mana klausul yang mengatakan JPKMS tidak boleh dikelola pihak layak. Ayat 5 tercantum, bantuan iuran adalah iuran yang dibayar oleh pemerintah bagi fakir miskin milik pemerintah pusat tersebut, dikelola langsung oleh Depar- temenKesehatanRItanpameng- Tapisari Siregar Pemenang Hadiah Utama Pemeliharaan Kesehatan Medan ketiga dalam SE Menkes. Coba dan orang mampu sebagai peser- gunakan jasa pihak ketiga (asu- MEDAN (Waspada): Tapisari Siregar warga Jl. Ambai No.45 AB -Susanti, Jl. Utama Gg. Ampera I Medan Sehat (JPKMS) tetap jalan terus. tunjukkan,” ujar Polita. ta program jaminan sosial. ransi). Kondisi ini membuktikan Kadis Kesehatan Kota Me- Ketikaditanyamengapatidak Setelah itu, dalam Bab III bahwa pengelolaan JPKMS tidak Medan memenangkan hadiah utama Kuis THR Waspada-Honda periode pertama, pada pengundian di Lantai 3 Gedung BumiWarta 4 Pemenang @600.000 dan, dr. Edwin Effendi, MSc meniru Dinas Kesehatan Sumut tentang Badan Penyelenggaraan mengikuti model Jamkesmas. Harian Waspada Medan, Senin (31/8). -M. Fusen, Jl. KL. Yos Sudarso No.42 Glugur Kota Medan hendak dikonfirmasi di ruang yang mengelola dana penyang- Jaminan Sosial pasal 5 ayat 1 Buktinya, Dinas Kesehatan Kota Tapisari memenangkan hadiah uang tunai senilai Rp1,5 juta -Fahurrozi, Jl. Denai No.108 Medan kerjanya, Senin (31/8), menolak gah masyarakat miskin senilai disebutkan bahwa badan penye- Medan menyerahkan pengelo- setelah kupon miliknya diundi Redaktur Siaran Minggu Waspada -Khairuddin, Jl. Perniagaan No.94C Stabat Langkat bertemu dengan wartawan. “Pak Rp4,5 miliar tanpa pihak ketiga, lenggara jaminan sosial harus laan JPKMS kepada pihak ketiga. (SMW) H Halim Hasan dengan disaksikan panitia dan karyawan. -Adliza SP Jl. Jati I No.37 Medan , Kadis sedang sibuk. Temui saja Polita mengatakan, Dinas Ke- dibentuk dengan undang- Menteri Kesehatan RI dan ibu Polita,” ujar stafnya. sehatan Sumut sudah mempu- undang. Dinas Kesehatan Sumut pernah Ketua Panitia Kuis melalui Sekretaris Zultamser, SE mengatakan, antusiasme peserta pada periode pertama cukup tinggi, dimana 6 Pemenang @Rp400.000 Sementara, Sekretaris Dinas nyai Perda. Pada ayat 3 dijelaskan bahwa mengingatkan bahwa pemerin- kupon yang masuk mencapai 30-an ribu lembar. -Syahrial Hasbi, Jl. Sekata Gg. Teratai No. 5A Sei Agul Medan Kesehatan Kota Medan, drg. Namun, Polita tidak banyak badan penyelenggara jaminan tahakanmengalamikerugianjika “Kuis ini terselenggara berkat kerjasama Harian Waspada dan -Afrizal, Jl. Pemuda No.11 DEF Medan Usma Polita mengatakan, pihak- berkomentar ketika disebutkan sosial sebagaimana dimaksud pengelolaan Jaminan Kesehatan Honda serta didukung beberapa sponsor yakni Harian Berita Sore, -Devyuzar, Jl. Brigjend Katamso Gg. Lampu I No.20 Medan nya tetap melaksanakan proses bahwa pengelolaan dana pe- pada ayat 1 adalah PT Jaminan Daerah(Jamkesda)sepertiJPKMS BNI, Bank Sumut, Telkomsel dan AXIS. Kuis ini merupakan agenda -Ruslan Effendi Hrp, Jl. SM Raja No.120 Medan tender JPKMS dengan berpedo- nyanggah masyarakat miskin Sosial Tenaga Kerja (PT Jamsos- diserahkan kepada pihak ketiga. rutin Harian Waspada di bulan suci Ramadhan yang dipersembahkan -Aliward, Jl. Coklat 11 No.28 Perumnas Simalingkar Medan man pada Keputusan Presiden tersebut tidak menggunakan tek), PT Dana Tabungan dan Sebab, pemerintah harus bagi pembaca setia Waspada,” jelas Zultamser. -Siti Nurahmi, Jl. Brigjend Katamso Gg. Rame Medan (Keppres) No. 80/2004 tentang Perda tetapi berpedoman kepada Asuransi Pegawai Negeri (PT membayar jasa kepada pihak Pedoman Pengadaan Barang/ SE Menkes dengan tujuan untuk Taspen),AsuransiSosialAngkatan ketiga selaku pengelola Jamkesda Selain pemenang hadiah Rp1,5 juta, juga terdapat 2 pemenang uang tunai Rp800 ribu, 4 pemenang Rp600 ribu, 6 pemenang Rp400 10 Pemenang @Rp200.000 Jasa. Alasannya, belum ada membantu kabupaten/kota di Bersenjata Republik Indonesia tersebut. ribu dan 10 pemenang Rp200 ribu. “Para pemenang dapat mengambil -Rina Ihut Megasari, Jl. T Bongkar II No.81 A Medan Perda yang mengatur tentang Sumatera Utara. (ASABRI) dan PT Asuransi “Departemen Kesehatan RI hadiah mulai Rabu (2/9), di Harian Waspada, Jl. Letjen Suprapto/ -Sofiyan, Jl. Danau Singkarak Gg. Amal 129 Sei Agul Medan JPKMS sehingga pengelola- Seperti diberitakan sebelum- Kesehatan Indonesia (PT Askes). berhasil menghemat Rp2,1 triliun Brigjen Katamso No.1 Medan (jam kerja),” jelasnya. -Muslim, Jl. Mesjid Gg. Budi 9 G Medan annya tetap diserahkan kepada nya, program JPKMS tahun 2009 Sementara,pesertatenderJPKMS setelah dana Jamkesmas tidak -Saini Efendi, Jl. Mesjid No.822Dsn XIII Percut Sei Tuan pihak ketiga. milik Pemko Medan dengan di Dinas Kesehatan Kota Medan diserahkan lagi kepada pihak Daftar Pemenang Kuis THR Waspada-Honda Periode I -DajudinYulsabati, Jl. Jala Permai X/78 BlokVIII Medan Labuhan Sampai saat ini, proses tender anggaran senilai Rp18,5 miliar, tidak ada yang sesuai dengan ketiga. Jadi, kalau ada pemerintah Pemenang Utama Rp1,5 juta -Abdullah Hasan, Jl. Binjai KM. 10,5 Gg. Masjid Paya Geli Medan sudah memasuki tahap verifikasi tidak sesuai dengan Undang- undang-undang tersebut. daerah yang menyerahkan -Tapisari Siregar, Jl. Ambai No.45 AB Medan -Ananda Pratiwi, Jl. STM Gg. Suka Pura No.18 Medan berkas milik tujuh peserta yakni undang No. 40 Tahun 2004 Bab Kemudian, dalam Surat pengelolaan dana Jamkesda -Nazwar Efendi, Jl. Bhayangkara No.351 Medan Asuransi Syariah Mubarokah, PT. III tentang Badan Penyeleng- EdaranMenkesNo.28Tahun2009 kepadapihakketiga,tidaktertutup 2 Pemenang @800.000 -Riza Fitrianny, Jl. Gunung Jayawijaya No.56 Binjai Tugu Pratama Indonesia, PT. Asu- garaan Jaminan Sosial dan Surat poin dua disebutkan, jika masih kemungkinanadanyapembagian -Zulfan , Jl. Gedung Arca No.1A Medan -Sofyan, Jl. Sei Begawan No.21 Medan. (m42) ransi Takaful, PT. Asuransi Bumi Edaran (SE) Menkes No 28 tahun adamasyarakatmiskinyangtidak komisi dari pihak ketiga tersebut,” Putera Muda 1967, PT. MAA Life 2009. terdapat dalam kuota Jaminan ujar Menkes di Bandara Polonia Ansurance, PT. AsuransiWanar- Dalam Undang Undang No. Kesehatan Masyarakat (Jamkes- Medan, beberapa waktu tha dan PT. Asuransi Puri Asih. 40 Tahun 2004 Bab I pasal 1 ayat mas), maka pembiayaan keseha- lalu.(m26) Empat Pengedar Ganja Dituntut 80 Tahun Ratu Ekstasi Diadili MEDAN (Waspada): Empat masing-masing selama 20 tahun Sri Yuniwati alias Ayu, 32, warga di Plaza Millenium Medan. terdakwapengedarganjadituntut penjara,” pinta JPU. JlnVeteran Pasar X, Labuhan Deli, Berangkat dari info itu, tiga Jaksa Penuntut Umum (JPU) Sebelum sampai pada amar diadili dalam kasus kepemilikan anggota Poltabes Medan me- selama 80 tahun penjara pada tuntutannya, JPU mengemu- 276 butir pil ekstasi. ngintai TKP Tidak berapa lama, . Pengadilan Negeri, Senin (31/8). kakan,para terdakwa ditangkap Terdakwa dijerat Jaksa Pe- terdakwa mengendarai sepeda Selain itu, keempatnya, Ar- aparat Reskrim Poltabes Medan nuntut Umum (JPU), Oki Perma- motor BK6334 UC masuk ke diansyah, 28, dan M Andi, 29, di salah satu lokasi di kawasan na, SH dengan pasal 59 ayat 1 pelataran parkir Plaza Millenium. warga Jln Seksama, Khairul, 27 Medan ketika sedang mencari hurufcUURINo5tahun1997ten- Di lokasi itu, terdakwa me- warga Garu II Medan, dan Rudi pembeli ganja seberat 5,9 Kg yang tang psikotropika golongan I. rencanakan melakukan transaksi Hamid, 30- warga Jln P Denai . mereka bawa. Di hadapan Majelis hakim dengan seorang pria yang sudah didenda JPU Nurainun sebesar . “Pengakuan para terdakwa diketuai, Sutadi, SH, JPU menge- menunggunya. Saat terdakwa Rp50 juta subsider 6 bulan di BAP barang itu dibeli dari se- , mukakan, terdakwa ditangkap menyerahkan bungkusan plastik kurungan. seorang di NAD dengan harga polisi, Minggu 17 Mei 2009 siang berisi ratusan butir pil ekstasi ke Dihadapan majelis hakim Rp400 per kilogram dan dijual di pelantaran parkir Plaza calon pembelinya, polisi diketuai I Ketut A, SH, JPU Rp1 juta per kilogram,” jelas JPU. Millenium karena mengedarkan melakukan penyergapan. mengatakan keempat terdakwa Untuk mendengarkan pembe- pil ekstasi. Setelahpembacaandakwaan dijerat pasal 82 ayat 1 UU No 22 laan dari para terdakwa sidang Kata JPU, aktivitas terdakwa JPU, majelis hakim Sutadi tahun 2002 tentang narkotika ditunda hingga Senin depan. sebagai pengedar ekstasi diketa- menunda sidang hingga Senin golongan I. “Untuk itu, kami Ekstasi hui setelah polisi menerima infor- depan guna mendengarkan memohon agar majelis hakim Pada persidangan terpisah, masi dari masyarakat yang me- sejumlah keterangan saksi dari menghukum para terdakwa seorang ibu rumah tangga (IRT), nyebutkan ada transaksi narkoba polisi. (h05) Sekdakab Nisel Diadukan Ke Poldasu MEDAN (Waspada): Seorang pencemaran nama baik terjadi, beberapakali demo terkait duga- kewenangannya sebagai ketua calon pegawai negeri sipil (CPNS) Senin(10/8),saatdengarpendapat anKKNCPNSitu,sepertidiPolda, panitia penerimaan dikuasai oleh Kab. Nias Selatan (Nisel) menga- antara anggota DPRDSU, Pem- Kejati dan DPRDSU. Dalam aksi- pejabattertentu,tanpamenyebut dukan sekretaris daerah (Sekda) kab Nisel, CPNS dan mahasiswa nya, lembaga swadaya masya- nama penjabat dimaksud. Lalu Kab. Nisel ke Polda Sumut atas terkait dugaan korupsi, kolusi, rakat (LSM) mengatasnamakan mengatakan, soal ujian sempat pencemaran nama baik. nepotisme (KKN) penerimaan masyarakat Nisel menuduh dikerjakan pihak tertentu di Dalam pengaduannya, CPNS Nisel formasi 2008. terjadi KKN dalam penerimaan Sibolga. Padahal soal ujian diang- Ilham Niadian Zebua, 27, warga Saat itu sekda menuding CPNS, dan menuntut intansi kut pesawat dengan pengawalan Jend. Ahmad Yani, Teluk Dalam, Ilham tidak ikut ujian CPNS tetapi berwenang mengusutnya. ketat, dan tidak pernah lewat Nisel, mengaku difitnah dan dinyatakan lulus. Pernyataan itu, Dengan adanya demo itu, Sibolga. Dia juga mengatakan, dicemarkan nama baiknya oleh kataYos Lase, bertolak belakang, Polda menyelidiki kebenaran sebagian peserta tidak ikut ujian Sekda, Hengkie Yusuf Wau saat sebab Ilham mendaftar sebagai indikasi KKN. Hasilnya tidak dite- tetapi dinyatakan lulus, termasuk rapat dengar pendapat di DPRD peserta ujian 24 November 2008 mukan dugaan KKN sebagaima- Ilham Niadian Zebua. Sumut. dengan nomor pendaftaran 800/ na dituduhkan para pendemo. Pernyataan dan keterangan Kepada wartawan di Medan, 31/PAN-CPNSD/2008. Kemu- Hal itu disampaikan Dir Reskrim sekda yang tidak berdasarkan Minggu (30/8), Zebua melalui dian, 16 Desember 2008 bersama Poldasu dalam surat No. B/285/ bukti kata Yos Lase, bisa mem- kuasa hukumnya Yos Lase, SH peserta lainnya mengikuti ujian VII/Dit Reskrim tertanggal 31 Juli bangun kekacauan dan kere- dan Kosman Samosir, SH, dengan formasi lamaran penyu- 2009. sahan masyarakat Nisel, juga M.Hum dari Lembaga Bantuan luh Perindag. Sementara DPRDSU juga dapat memicu konflik antar Hukum Merdeka mengatakan, Namun, Juli 2009 terjadi menyahuti tuntunan LSM de- pejabat. nganmengundangPemkabNisel “Pernyataan tanpa didasari PKR Bagi Anak Jalanan untukmelakukanklarifikasimela- lui rapat dengar pendapat. Dalam bukti merupakan perbuatan pidana yakni keterangan palsu rapatitu,SekdamewakiliPemkab dan dapat diancam 7 tahun MEDAN (Waspada) : Ratusan anak jalanan akan mengikuti ke- giatan Pesantren Kilat Ramadhan (PKR) yang dilaksanakan oleh mengatakan, telah terjadi pe- penjara sebagaimana pasal 242 Madya Insani tanggal 4 s/d 7 September2009 di Gedung Al-Wasliyah nyimpangan seleksi penerimaan KUHPidana. Juga mencemarkan Jalan SM Raja Medan. Demikian Direktur Madya Insani Suhartini CPNStanpamenjelaskandimana nama baik Ilham, sehingga dapat S.Sos bersama panitia, Aulia Fatwa SP dan Dewi Sapitri, Senin (31/8). dan bagaimana bentuk penyim- dikenakan pasal 311 KUHPidana Suhartini menyebutkan ke-giatan ini bagian dari kepedulian pangannya. yang ancamannya 4 tahun pen- mereka terhadap anak jalanan yang juga memerlukan siraman rohani Sekda juga mengatakan jara.” katanya.(m11) selama Ramadhan, di sam-ping memberikan kesempatan kepada mereka untuk menikmati sajian berbagai ilmu dari para nara sumber yang memaparkan ilmu agama dan ilmu sosial. Disamping itu, nara sumber dari Gerakan Anti Narkoba (GAN) yang diharapkan mampu memberikan bekal agar anak jalanan tidak terlibat dalam penyalahgunaan narkoba dan jenis obat lainnya yang membuat mental dan fisik mereka jadi sakit. Materi yang mereka dapatkan antara lain, bagaimana tentramnya perasaan seseorang berpuasa dan mengapa wajib melaksanakan ibadah puasa, menunaikan ibadah shalat dan lainnya. (m36)
  • 12. 12 Opini WASPADA Selasa 1 September 2009 Pertumbuhan Berdasar Konsep Lokal Dan Kewilayahan bagi pertumbuhan ekonomi daerah ke- ka perencanaan itu pun akan berjalan Oleh Bachtiar Hassan Miraza bupaten dan kota. Berdasarkan penga- seperti kurakura. Pemerintah daerah matan, selama ini pemerintah daerah perlu mencari aparat daerah yang ber- diminta untuk mengundang investor bakat pada kehidupan suatu perekono- F inancial crisis memang sudah rong perekonomiannya dengan me- tapi tidak diberi izin di dalam memu- mian. Bukan sekadar tenaga adminis- berakhir tapi perekonomian manfaatkan sumberdaya ekonomi di tus karena masih diperlukan berbagai trasi publik saja. Manajemen pemba- masih berjalan lamban. Diper- daerah (sumberdaya lokal) berdasarkan ijin yang dikeluarkan pemerintah pu- ngunan daerah harus diisi oleh birokrat lukan waktu untuk proses pe- konsep lokal dan kewilayahan. Tiap da- sat. yang berjiwa entrepreneurship. mulihan. Cepat lambatnya proses pe- erah atau wilayah mempunyai potensi Dalam upaya menggerakan pereko- Jika pembangunan yang didasarkan mulihan ditentukan oleh besarnya in- ekonomi lokal yang berbeda. Dari po- nomian, di tengah pelambanan yang pada konsep lokal dan kewilayahan da- TAJUK RENCANA vestasi yang ditanamkan pada aktivitas tensi lokal inilah daerah/wilayah meng- terjadi, peran daerah kabupaten dan pat berjalan, diperkirakan begitu banyak ekonomi pada setiap negara. Aktivitas gerakkan perekonomiannya, khusus kota adalah menentukan. Hal ini harus tenaga kerja dan tenaga ahli yang bisa ekonomi menentukan masa pemulihan. dari sudut keunggulan yang dimiliki. disadari oleh para kepala pemerintahan terpakai sehingga dapat menekan ting- Artinya walau financial crisis dikatakan Jika masing masing daerah kabupaten kabupaten dan kota agar dapat diambil kat pengangguran yang ada. Pendapatan Stop Arogansi Malaysia! telah berakhir namun jika semua pihak masih saja menunggu dan tidak berbuat apa apa maka tidak ada manfaat yang dan kota bergerak tumbuh tentu wilayah dimana kabupaten dan kota itu berada akan tumbuh pula. Hal ini akan berpe- langkah langkah pertumbuhan dan pe- ngembangan ekonomi daerah. Banyak hal yang dapat dilakukan di daerah se- yang tercipta dari para pekerja akan da- pat pula menumbuhkan permintaan atas barang lainnya sehingga perekono- kita dapat dari berhentinya krisis terse- ngaruh pada pertumbuhan wilayah perti pengembangan kegiatan peternak- mian daerah akan terdorong lebih cepat R akyat Indonesia marah dengan sikap negara jiran yang seenaknya but. Bahkan mungkin akan muncul tetangganya dan terus mendorong per- an dan bahan baku untuk olahan indus- dan seterusnya. Terdapat suatu siklus melecehkanTKI dan mengklaim seni budaya Indonesia, namun di negeri krisis lainnya menggantikan financial tumbuhan ekonomi nasional. Inilah tri, yang bersumber dari daerah daratan yang membesar sebagai gambaran ke- kerajaan itu berita kemarahan rakyat Indonesia itu tidak banyak diketahui crisis seperti krisis yang timbul dari sek- yang dimaksudkan sebagai pertum- maupun laut, disesuaikan dengan po- majuan perkembangan ekonomi da- rakyat Malaysia, karena media massa di sana, seperti surat kabar dan tor riil di mana ekonomi menjadi stag- buhan berdasarkan konsep lokal dan tensi yang terdapat pada setiap daerah. erah. Penggunaan investor dan teknologi televisi tidak mau mengangkat masalahnya. Kalaupun ada diberitakan; nan dan harga harga menjadi naik kare- kewilayahan. Pemerintah daerah meng- Jika dilihat dari sektor maka sektor perta- domestik ataupun lokal biasanya akan na kebutuhan masyarakat terus bertam- optimalkan pemanfaatan sumberdaya nian, peternakan, perikanan, pariwisata menciptakan lapangan kerja yang lebih kolom dan durasinya kecil sekali. bah. lokal yang selama ini masih banyak yang serta pertambangan dapat diintensifkan banyak jika dibandingkan dengan in- Kesannya,rakyatMalaysiatidakmerasaberbuatsalahdanmenganggapmasalahnya Perekonomian saat ini berjalan lam- terpendam dengan mengajak sektor pertumbuhannya karena potensi sektor vestor asing yang mempergunakan tek- kecil. Hal ini sejalan dengan merosotnya citra kita di mata mereka. Padahal, ban dan penuh ketidakpastian. Ini me- swasta masuk mengolah potensi terse- ini banyak terdapat di daerah. nologi tinggi. Tentu dengan segala risiko permasalahannya cukup serius bagi Indonesia. Hal itu terkait dengan sikap arogan rupakan hal yang wajar karena pereko- but. Peran swasta mengolah potensi Pemerintah daerah harus bisa mem- yang dapat dimunculkannya seperti rakyat dan aparat di Malaysia yang memperlakukan TKI secara tidak manusiawi. nomian baru saja mengalami krisis. daerah adalah menentukan, sepanjang fasilitasi investor masuk ke daerahnya tingkat efisiensi dan produktivitas yang Belakangan ini lewat rekaman sejumlah aparat keamanan Malaysia menyiksaWNI Tidak tertutup kemungkinan terjadi pemerintah daerah memberikan kepas- seperti memberikan informasi potensi relatif lebih rendah. Demikian juga de- komplikasi terhadap kondisi perekono- tian dan pelayanan atas masuknya se- yang dimiliki, rencana perkembangan ngan saluran distribusi dan harga yang denganpukulan,tendangan,injakan.Orang-orangIndonesiadianggapsebagaimanusia mian, yang menjadikan keadaan sema- buah investasi. daerah dalam jangka panjang, rencana biasanya telah ditentukan oleh peru- kelas dua yang harkat dan martabatnya rendah tak ubahnya binatang, sehingga kin kalut. Inilah yang harus dihindari. Untuk negara Indonesia yang wila- tata ruang wilayah, rencana pemba- sahaan besar. seenaknya diperlakukan kejam. Sebagai negara yang tingkat ketergan- yahnya sangat luas dan beragam, konsep ngunan infrastruktur sampai memper- Namun pemikiran ini dapat diper- Melihatsudahberulang-ulangnyapelecehandilakukanMalaysiaterhadapIndonesia tungannya dengan luar negeri adalah ini dinyatakan tepat untuk diterapkan. mudah urusan administrasi perizinan gunakan oleh pemerintah kabupaten maka sudah sepatutnya pemerintah melakukan evaluasi seputar hubungan diplomatik tinggi (ekspor dan impor) Indonesia juga Kewenangan politik pemerintah daerah dan sebagainya. Investor yang diperlu- / kota dalam ikut mendorong perekono- kedua negara. Sebab, kalau dibiarkan terus bisa-bisa Malaysia semakin melonjak. harus memperhatikan ketidakpastian yang menonjol selama ini bisa ditambah kan adalah investor berskala menengah mian nasional dalam situasi pelamban- Ibarat pepatah ‘’dikasih hati minta jantung’’ sehingga perlakuan dan sikap rakyat, ekonomi dunia. Kondisi ekonomi dunia dengan kewenangan ekonomi yang le- dengan tingkat teknologi menengah. an aktivitas ekonomi saat ini. Kita hen- juga sama dengan Indonesia, penuh de- bih luas dengan memberikan kewe- Dengan demikian kesempatan untuk daknya tidak melihat dari besar kecilnya aparat, pejabat Malaysia akan semakin menjadi-jadi nantinya. Sudah semakin kelihatan ngan ketidakpastian. Dalam masa pe- nangan penentuan investasi (domestik digarap oleh investor domestik cukup keuntungan yang diperoleh sepanjang kalau pemerintah kita takut menghadapi Malaysia. lambanan ini, banyak hal yang bisa terja- dan asing) dan aktivitas ekonomi daerah. besar. Investor besar tetap diperlukan tidak merugi. Yang dituju adalah bagai- Dulu, bangsa kita pernah berjaya melawan Malaysia di masa Orde Baru. Masa di dan banyak hal yang perlu dilakukan Pemerintah pusat pun harus menyadari hanya mendapatkannya tidak semudah mana produk/barang dapat bertambah, itu Presiden Soekarno mampu memperlihatkan jadi diri Indonesia sebagai bangsa bagi mempercepat pertumbuhan eko- akan hal ini agar pemerintah daerah di- investor menengah. Masalahnya terletak seiring dengan penciptaan lapangan ker- besar, punya harga diri. Bung Karno cukup kharismatik sehingga Malaysia merasa nomi. Kita tidak bisa berdiam diri karena beri kewenangan memutus, atas hadir- pada bagaimana pemerintah daerah ja dan penciptaan pendapatan. Untuk takut dengan Indonesia pasca konfrontasi. jumlah calon tenaga kerja yang terus nya sebuah investasi di daerah. Ada ke- menjalankan manajemen pembangun- seterusnya hal ini dapat menambah da- bertambah dan konsumsi masyarakat wenangan ekonomi yang dimiliki oleh annya beserta penetapan aparat yang ya beli masyarakat, yang dapat mendo- Sekarang, pemerintah kita kelihatan takut menghadapi Malaysia. Kebesaran yang semakin naik mengirirngi pertum- pemerintah daerah dalam menjalankan paham akan pentingnya peran peme- rong perekonomian yang lamban ini Indonesia semakin memudar. Statement pejabat kita dianggap angin lalu, tak ubahnya buhan penduduk. prinsip pertumbuhan berdasarkan kon- rintah daerah dalam pembangunan na- agar berjalan lebih cepat. ‘’macan ompong’’. Apalagi melihat begitu berkobar-kobarnya semangat perlawanan Dalam hal ini, daerah kabupaten sep lokal dan kewilayahan. Kewenangan sional. Artinya jika sebuah perencanaan yang dilakukan rakyat Indonesia di berbagai daerah, namun reaksi pemerintah lewat dan kota bisa mengambil peran mendo- ini memotivasi dan sekaligus stimulus tidak terdukung oleh aparat daerah ma- Penulis adalah pemerhati ekonomi jalur diplomatiknya; dingin sekali. Kemampuan diplomat Indonesia dalam Hikayat Si Raja Kacip dua dasawarsa belakangan ini memang Intisari memprihatinkan. Dalam berbagai perma- salahan di dalam dan luar negeri hasilnya selalu gagal dan gagal. Lihat saja dalam kasus Kita cinta damai, tapi TimorTimor akhirnya lepas, kasus Sipadan satu petinggi kerajaan yaitu Ketua Dewan korban harta untuk memperoleh kekua- kalau sudah menying- dan Ligitan juga lepas, kini menyusul kasus Oleh Wan Zulkarnain, S.Sos, M.Si Kerajaan si Raja Kacip. Berarti sang Raja saan tadi. Ambalatdankasustapalbatasdengannegara Kacip telah bermain api. Dan apinya telah Dan keretakan itu telah menjadi raha- gung harkat dan marta- jirantermasukMalaysia,jugaterkaitpelecehan memakan korban. Sungguh naif perbuat- siaumum.Anehnya,istilahkaciptelahme- bat bangsa, kemarahan terhadap lagu‘’Indonesia Raya’’ tidak banyak K isah ini bermula di tanah Melayu Si Raja Kacip an sang raja. Padahal baru dinobatkan nyebar ke mana-mana, sehingga penulis yang dapat diperbuat para diplomat Indo- Delibertuah.Hidupdanberkuasa Ketika berkuasa pada level yang lebih menjadi raja di singgasananya melalui sendiri dapat mengungkapkan dalam rakyat wajib direspon pe- nesia. Bahkan, memperjuangkan hak-hak seorangraja.Dengansosokbadan tinggi – awalnya sang raja berkuasa pada pemilihan yang sangat demokratis. tulisan pendek ini untuk memberikan in- subur karena makmur, kulit hitam, perut tingkat lebih rendah dari jabatan sekarang Tapi itulah si Raja Kacip. Tak mau formasiseakuratmungkinsebagaiseorang merintah. warga negaranya di luar negeri saja tidak buncit, hidung besar dan nada bicara celat – tabiat sang raja semakin menjadi-jadi. tahu dengan rakyatnya. Banyak kebijak- peneliti dan dosen yang sedang menekuni mampu sehingga banyak kasus hukum yang ”r” yang mewarnai setiap ucapannya, Dalam setiap pergantian pejabat pada an yang diambilnya membawa kepada ilmu antropologi. Dan tulisan ini memang melibatkan WNI di luar negeri berakhir menjadikan sang raja dikenal sampai ke struktur pemerintahannya, sang raja me- penderitaan. Bahkan proyek pemba- sangat sesuai mengupas sisi budaya sang dengan tragis.WNI/TKI meskipun tidak bersalah harus dihukum berat korban rekayasa seanteronusantara.Cirikhassukaberkela- matok”upeti”agardapatdiangkatmengisi ngunan bandar udara di wilayah kekua- raja yang sering mendengungkan satu aparat di sana karena kinerja diplomat kita sangat tidak memadai alias di bawah standar. kar dan banyak ”membual” membuat lowongan pada jabatan tertentu yang saannya, sepertinya mengalami kendala buah ungkapan budaya yang sangat fa- Lainhalnyadengandiplomatasing,sepertiAmerika,AustraliaEropadll.Merekalangsung sang raja disenangi oleh rakyatnya uta- dianggap ”basah” dan potensi menghasil- karena manajemen istana tidak bekerja miliar yaitu ”Sahabat Semua Suku”. datang mendampingi setiap warga negaranya bermasalah di Indonesia sehingga manya pada lapisan bawah. Tipe kepe- kan uang. Untuk itu, sang raja mengguna- secara profesional. Wajar memang. Ka- hak-haknya terlindungi. mimpinan yang lebih banyak bersifat in- kan istilah ”Kacip”. Sebenarnya secara bu- rena yang diperlukan si raja bukan ke- Penutup formal, ternyata sangat ampuh untuk me- daya, ”kacip” adalah alat untuk membelah mampuan atau skill dari pembantunya, Kisah ini diuraikan sebagai suatu Saatnya bangsa Indonesia –rakyat bersama pemerintah—menyatukan visi dan narik hati semua kalangan. Sosok ramah buah pinang agar mudah mengambil akan tetapi seberapa banyak upeti yang gambaran kepada kita sebagai makhluk misi menghadapi sikap arogan Malaysia, makin cepat makin baik. Sebagai bangsa danberbicaraseperti”malaikat”membuat isinya. telah diberikan kepadanya. Jadi persoal- ciptaan Allah bahwa janganlah bermain- besar dan bermartabat sangat memalukan jika perbuatan Malaysia dibiarkan terus. orang di sekeliling sang raja senantiasa Istilah kacip di lingkungan istana sang an memang sederhana, yaitu ada tidak main dengan amanah yang telah diberi- Memang, pemerintah kita membutuhkan Malaysia karena kira-kira satu juta terpesona. raja telah menjadi bahasa sehari-hari. Isu kacip atau upeti. kan. Sebab, apapun yang telah diberikan TKI (legal dan illegal) mencari kerja di sana. Kalau saja, pemerintah berani melawan Dalam hal urusan kenegaraan, pe- kacip menjadi alat sang raja untuk mengu- oleh Allah pasti akan dimintai pertang- bukan tidak mungkin pemerintah Malaysia mengambil jalan pintas memulangkan rilaku sang raja terbawa-bawa. Dalam tip upeti terhadap pegawai kerajaan agar Retaknya Pemerintahan Sang Raja gungjawaban di dunia maupun di akhirat seluruhTKI. Alhasil, pemerintah kita kelabakan dibuat Malaysia. Hal seperti ini memang hal urusan serius selalu ditingkahi de- dapat diangkat mengisi jabatan strategis Karena tabiat suka meminta upeti kelak. Berkacalah kepada peristiwa sejarah ngan canda tawa. Pada setiap kesem- telah menjadi ”budaya” populer. Tidak denganistilahkacipnya,makasiRajaKacip pemimpin kita yang serakah, tamak dan pantas menjadi kajian pemerintah kita, namun Presiden SBY dan para menteri terkait patan formal urusan pemerintahan tanggung-tanggung, sang raja mematok kinimenghadapiberbagaipersoalanserius rakus, yang akhirnya hidup hina dina. jangan hanya memikirkan bagaimana membukakan lapangan kerja baru buat mereka selalu dibawa ke dalam suasana informal harga kacip sampai miliaran rupiah. Ba- dan berat. Para pembantunya mulai men- Bukankah sejarah merupakan guru jika dipulangkan ke Indonesia, tetapi pemerintah harus lebih berpikir ke depan, yang kadang-kadang terasa seperti yangkan,fantastisbukan.Kalauditotaldari jaga jarak. Bahkan lebih frontal, seperti terbaik untuk melihat diri apakah kita telah mengingat hal ini terkait dengan citra dan kedaulatan bangsa. main-main. Untuk kalangan tertentu jumlahjabatanyangadadibirokrasiistana, wakil sang raja telah bersikap tidak koope- berbuat baik atau buruk. Janganlah masuk Pertanyaannya: Akankah kita rela terus diinjak-injak Malaysia atau bangsa-bangsa ini dapat menjadi hiburan alias info- maka berapa jumlah yang diperoleh sang ratif untuk bekerja secara tim dengan si ke dalam lubang yang kedua. Sebab hanya lain yang melihat ketidakberdayaan pemerintah kita dalam memberikan lapangan tainment, namun bagi kalangan terpe- raja hanya dari upeti bawahannya. Apatah Raja Kacip. Padahal sang wakil raja telah keledai bintang yang paling bodoh. Dan lajar seakan-akan suatu perbuatan nye- lagisumberkacipyanglain.Wajarmemang berjasa membantu si Raja Kacip untuk du- bisa jadi akhirnya hidup akan sia-sia hanya kerja bagi rakyatnya? Jawabnya: Tidak! Sebab, belum tentu posisi tawar kita lemah bila badan sang raja besar karena penuh leneh yang tidak bisa ditolerir. Bahkan dukberkuasaselama5tahundenganpera- karena ujub dunia. Bukankah Karun men- di mata negara lain. Bisa-bisa kalau kita tegas menarik pulang seluruh pekerja kita seolah-olah suka Main-Main (MM) da- dengan upeti dan tidak salah kalau sang hu partai politik yang dimilikinya. Tapi jadi legenda manusia serakah dan mati dari Malaysia membuat negeri itu ‘’bangkrut’’ karena selama ini bisa disebut TKI lam urusan kenegaraan dan pemerin- raja diberi gelar si Raja Kacip. itulahkekuasaan.Penuhintrikdanegoistik. tertimbun oleh harta yang dikumpulkan- lah yang punya andil membangun Malaysia, termasuk menara kembar kebanggaan tahan, yang semestinya memerlukan MemangtanahMelayubertuah.Itulah Bahkanteoritiktidaksamadenganpraktik. nya sendiri. Sadarlah, wahai sang Raja mereka:‘’Petronas’’. BanyakTKI yang akhirnya tewas dalam membangun negeri cukup keseriusan dan kemauan kuat untuk ungkapanyangseringdiungkapkanteruta- Padahal dalam mengelola suatu pe- Kacip!!! makmur itu. Padahal, dalam segi sumber daya alam, seharusnya bangsa kitalah yang menyelesaikan persoalan yang muncul. ma oleh warga Melayu itu sendiri. Dan merintahan sangat diperlukan kerjasama lebih kaya dari negara-negara lain khususnya di ASEAN. Ibaratnya watak sang raja hampir serupa itulah kini melekat kepada si Raja Kacip. tim, apalagi si Raja Kacip saat ini belum Penulis adalah Kandidat Ph.D Jabatan dengan kisah Pak Belalang, yang hidup Dengan bekal pandai bergaul dan suka bekerja maksimal. Itu ditandai dengan Antropologi University of Malaya Kuala Lumpur Menghadapi arogansi Malaysia semua elemen masyarakat harus berpikir rasional dalam legenda di tanah Melayu. Atau berbual serta ramah terhadap orang di lemahnya kepemimpinannya ketika ber- Malaysia, Dosen Luar Biasa FISIP USU, Dosen dan mengambil tindakan nyata, bukan lagi sekadar wacana. Saatnya kita tegas untuk mungkin saja kisah Pak Belalang – yang sekelilingnya memberikan peluang untuk kuasa sebelumnya, apatah lagi pada ja- Tetap Universitas Dharma-wangsa dan mensetop sikap, provokatif, dan perbuatan Malaysia yang sangat arogan terhadap menjadi penasihat raja – ada persamaan memimpin di singgasana istana. Maklum, batan sekarang yang lebih banyak dan luas Direktur Eksekutif Nusantara Research Centre anakbangsakita.Caranyadenganmembuatgebrakandenganmenindaklanjutiharapan dengan raja satu ini. lebihbanyakmain-maindibandingbelajar permasalahannya.Tentu membutuhkan (NRC). dari protes-protes rakyat agar bangsa kita tidak semakin kehilangan marwah.+ Akan tetapi apa mau dikata. Memang serius. Namun itulah nasib sang raja, me- tim yang solid, kompak dan tangguh. Email : begitulah tabiat sang raja.Tiada hari tanpa mang dianggap bertuah. Sehingga dapat Namun apa lacur, ternyata kecongkakan one_zul_baros@perdana.um.edu.my ”membual” dan mengumbar kelakar. Se- berkuasa walaupun secara formal tingkat si Raja Kacip mulai membuahkan hasil, Hubungi kami pertinya itu merupakan menu utama da- pendidikannya relatif kurang memadai. yaknimulairetaknyakekompakansesama lam setiap kegiatannya. Atau mungkin di Padahal di sekeliling istana masih banyak anggota tim. Padahal di awal-awal ketika kepalasangrajahanyaberisiselmain,main calon raja-raja yang mempunyai basic berkampanye mau merebut istana raja, KANTOR PUSAT Penerbit: PT Penerbitan Harian Waspada dan main. Entahlah, belum ada dokter pendidikan bagus dan mempunyai kapa- sungguh harmonis hubungan antara sang Jalan Letjen Suprapto/Brigjen Katamso No. 1 Medan 20151 Komisaris Utama: Tribuana Said Direktur Utama: dr. Hj. Rayati Syafrin, MBA, MM yang membedah kepala sang raja. Mung- kin perlu juga dilakukan riset mendalam sitas memimpin yang baik dan benar. TapiitulahtanahMelayu.Samaseperti Raja Kacip dengan wakilnya. Bagai lepat SUDUT BATUAH dengan daunnya. Tel: (061) 4150858, Faks Redaksi: (061) 4510025, SIUPP: 065/SK/MENPEN/SIUPP/A.7/198 terhadap otak sang raja untuk mengetahui kisah Pak Belalang yang malas. Namun Tapi itulah dunia. Kalau sudah bicara Faks Tata Usaha: (061) 4531010. tanggal 25 Februari 1988 sel apa saja yang ada di kepalanya. Di balik tuah badan membuatnya hidup senang. tahta, harta dan wanita, maka kita akan E-mail Redaksi: redaksiwaspada@gmail.com itu semua, ternyata ada satu tabiat sang Persoalannya adalah bahwa si Raja Kacip lupa dan dilupakan oleh bisikan setan. Itu- * Malaysia tak senang kita kuat Anggota SPS No. 13/1947/02/A/2002 - Kalau kita kuat, susah klaim KANTOR PERWAKILAN raja yang sering dilupakan orang ramai, initelahmenggoreslukabanyakrakyatnya. lah nikmat dunia. Juga ini dapat menjadi Percetakan: PT Prakarsa Abadi Press karena telah terpesona dengan perilaku Karena belakangan ini disorot telah mem- neraka dunia. Anehnya, pada pelantikan budaya! Bumi Warta Jaya Jalan Kebon Sirih Timur Dalam No. 3 Jalan Letjen Suprapto/Brigjen Katamso No. 1 dan ucapan sang raja yang mirip-mirip buatnistadannoda.Sorotaninijugaujung- pejabatistanadibawahlevelkekuasaannya Medan 20151 malaikat. Dan tabiat ini sebenarnya dapat ujungnya berhubungan dengan kacip. si Raja Kacip dengan pongahnya berujar * Gubsu: Daya serap APBD 2009 Jakarta 10340 harus dipacu Tel: (061) 6612681 menjadipetakabagisangrajakarenadapat Bahwa sang raja diisukan ada merestui kepada wakil raja yang baru diangkat Tel: (021) 31922216, Faks: (021) 3140817. - Berpacu dalam melodi, Isi di luar tanggung jawab percetakan menggusurkedudukannyasebagaikepala dibentuknya kerajaan lain selain kerajaan- sumpahnya tersebut bahwa agar tahu diri Jalan Ratu Syafiatuddin No. 21 C pemerintahan.Bahkan,perilakujeleksang nya. Kerajaan yang akan dibentuk ternyata karena raja hanya satu. Jadi jangan mem- he...he...he Banda Aceh 23122 Harga iklan per mm kolom: raja telah menyebar sampai ke level para adamemberiupetisampaimiliaranrupiah buatulahatauistilahnya”durhaka”kepada Tel & Faks: (0651) 22385 BW Rp. 11.000,- pegawai kerajaan. Sehingga kadang-ka- untuk memuluskan usaha memisahkan raja. Ini berarti memberikan sinyal kuat * Fatwa haram mengemis tak FC Rp. 30.000,- selesaikan masalah Jalan Iskandar Muda No. 65 Lhokseumawe Halaman depan BW Rp. 33.000,- dang ada celoteh beberapa pegawai kera- diri dari wilayah kekuasaaan si Raja Kacip. bahwa secara tidak langsung, si Raja Kacip Tel: (0645) 42109 jaan bahwa ternyata sang raja tadi sama Tentunya permainan ini awalnya hanya menyindirwakilnyasendiriyangdianggap- - Takutnya menambah masalah Halaman depan FC Rp. 90.000,- D oel Wak Jalan Sutami No. 30 Kisaran. Tel: (0623) 41412 Ukuran kolom: 40,5 mm seperti Karun – si penimbun harta yang dianggap main-main. Namun ternyata nya tidak loyal kepadanya sebagai seorang tersohor itu. membawa dampak pada kematian salah rajayangberkuasapenuhkarenatelahber- WASPADA Dewan Redaksi: H. Prabudi Said, H. Teruna Jasa Said, H. Azwir Thahir, H. Sofyan Harahap, H. Akmal Ali Zaini, H. Muhammad Joni, Edward Thahir, M. Zeini Zen, Hendra DS. Redaktur Berita: H. Akmal Ali Zaini. Redaktur Kota: Edward Thahir. Redaktur Sumatera Utara: M. Zeini Zen. Redaktur Aceh: Rizaldi Anwar. Redaktur Luar Negeri: H. Muhammad Joni. Redaktur Nusantara & Features: Gito Agus Pramono. Redaktur Opini: H. Sofyan Harahap. Redaktur Ekonomi: Armin Rahmansyah Nasution. Redaktur Olahraga: Johnny Ramadhan Silalahi. Redaktur Minggu/Humas: Hendra DS, Redaktur Agama: H. Syarifuddin Elhayat. Asisten Redaktur: Rudi Faliskan (Berita) Zulkifli Harahap, Muhammad Thariq (Kota Medan), Feirizal Purba (Sumatera Utara), T. Donny Paridi (Aceh), Syafriwani Harahap (Luar Negeri), Setia Budi Siregar (Olahraga), Hj. Hoyriah Siregar (Ekonomi), T. Junaidi (Hiburan), Hj. Erma Sujianti Tarigan (Agama), Hj. Neneng Khairiah Zein (Remaja), Austin Antariksa (Kreasi), Armansyah Thahir (Otomotif), Anum Purba (Wanita), Hj. Ayu Kesumaningtyas (Kesehatan), Denny Adil (Pelangi). Sekretaris Redaksi: Hj. Hartati Zein. Iklan: Hj. Hilda Mulina, Rumondang Siagian (Medan), Lulu (Jakarta). Pemasaran: Andi L. Said (Medan), H. Subagio PN (Sumut), S. Manik (NAD). Wartawan Kota Medan (Umum): H. Erwan Effendi, Muhammad Thariq, Zulkifli Harahap, David Swayana, Amir Syarifuddin, Ismanto Ismail, Rudi Arman, Feirizal Purba, Zulkifli Darwis, H. Abdullah Dadeh, H. Suyono, Ayu Kesumaningtyas, M. Ferdinan Sembiring, M. Edison Ginting, Surya Effendi, Anum Purba, Sahrizal, Sulaiman Hamzah, Sugiarto, Hasanul Hidayat, Aidi Yursal, Rustam Effendi. Wartawan Kota Medan (bidang khusus): H. Syahputra MS, Setia Budi Siregar, Austin Antariksa, Dedi Riono (Olahraga), Muhammad Faisal, Hang Tuah Jasa Said (Foto), Armansyah Thahir (Otomotif), Dedi Sahputra (Penugasan Khusus). Dedek Juliadi, Zulfan Efendi, Tetty Rosiana, Handaya Wirayuga (Koran Masuk Sekolah/KMS). Wartawan Jakarta: Hermanto, H. Ramadhan Usman, Hasriwal AS, Nurhilal, Edi Supardi Emon, Agus Sumariyadi, Dian W, Aji K. Wartawan Sumatera Utara: H. Riswan Rika, Nazelian Tanjung (Binjai), H.M. Husni Siregar, Hotma Darwis Pasaribu (Deli Serdang), Eddi Gultom (Serdang Bedagai), H. Ibnu Kasir, Abdul Hakim (Stabat), Chairil Rusli, Asri Rais (Pangkalan Brandan), Dickson Pelawi (Berastagi), Muhammad Idris, Abdul Khalik (Tebing Tinggi), Mulia Siregar, Edoard Sinaga (Pematang Siantar), Ali Bey, Hasuna Damanik, Balas Sirait (Simalungun), Helmy Hasibuan, Agus Diansyah Hasibuan, Sahril, Iwan Hasibuan (Batubara), H. Abu Bakar Nasution, Nurkarim Nehe, Bustami Chie Pit (Asahan), Rahmad Fansur Siregar (Tanjung Balai), Indra Muheri Simatupang (Aek Kanopan), H. Nazran Nazier, Armansyah Abdi, Neirul Nizam, Budi Surya Hasibuan (Rantau Prapat), Hasanuddin (Kota Pinang) Edison Samosir (Pangururan), Jimmy Sitinjak (Balige), Natar Manalu (Sidikalang), Arlius Tumanggor (Pakpak Bharat)Parlindungan Hutasoit, Marolop Panggabean (Tarutung), Zulfan Nasution, Alam Satriwal Tanjung (Sibolga/Tapanuli Tengah), H. Syarifuddin Nasution, Mohot Lubis, Sukri Falah Harahap, Balyan Kadir Nasution (Padang Sidimpuan), Idaham Butarbutar (Gunung Tua), Iskandar Hasibuan, Munir Lubis (Panyabungan), Bothaniman Jaya Telaumbanua (Gunung Sitoli). Wartawan Aceh: H. Adnan NS, Aldin Nainggolan, Muhammad Zairin, Munawardi Ismail, Zafrullah, T. Mansursyah, T. Ardiansyah (Banda Aceh), Iskandarsyah (Aceh Besar), Maimun (Lhoksukon) Bustami Saleh, M. Jakfar Ahmad, Jamali Sulaiman, Arafat Nur, M. Nasir Age, Fakhrurazi Araly, Zainal Abidin (Lhokseumawe), Muhammad Hanafiah (Kuala Simpang), H. Syahrul Karim, H. Ibnu Sa’dan, Agusni AH, H. Samsuar (Langsa), Amiruddin (Idi), HAR Djuli, Zainuddin Abdullah (Bireuen), Bahtiar Gayo (Takengon), Muhammad Riza, H. Rusli Ismail (Sigli), T. Zakaria Al-Bahri (Sabang), Khairul Boang Manalu (Subulussalam), Rusli Idham (Meulaboh), Jaka Rasyid (Blang Pidie), Zamzamy Surya (Tapak Tuan), Ali Amran, Mahadi Pinem (Kutacane), Bustanuddin , Wintoni (Blangkejeren), Khairul Akhyar (Bener Meriah), Tarmizi Ripan, Mansurdin (Singkil), Rahmad (Sinabang). Semua wartawan Waspada dilengkapi dengan kartu pers. Jangan layani dan segera laporkan ke pihak berwajib atau ke Sekretaris Redaksi bila ada oknum yang mengaku wartawan Waspada tetapi tidak bisa menunjukkan kartu pers yang sah, ditandatangani Pemimpin Redaksi
  • 13. WASPADA Selasa 1 September 2009 Opini 13 Menyelamatkan Budaya Bangsa Selanjutnya pada tahun 2008 kembali hingga kini, Malaysia bersikap “berani” Menteri Pertahanan Malaysia untuk semen- lahan ataupun tidak. Selain itu mereka tanpa dan integritas bangsa Budaya nasional me- kita dikejutkan dengan klaim batik sebagai terhadap Indonesia. Tidak ada rasa takut tara ketegangan sudah mereda. ampun menjatuhkan hukuman gantung rupakanidentitassuatubangsadantermasuk bagian dari budaya warisan Malaysia. Ken- sedikit pun, menyegani ataupun menghor- Fenomena klaim budaya termasuk tanpa mengindahkan permohonan keri- bagian dari kedaulatan negara kesatuan datipun klaim lagu Rasa Sayange dan batik mati negara besar yang berpenduduk 250 wilayah kedaulatan yang dilakukan Ma- nganan dari keluarga terpidana maupun dari Republik Indonesia. Pemerintah Indonesia mendapat reaksi keras dari rakyat Indonesia juta ini. Fenomena tidak menyegani dapat laysia patut menjadi perhatian dan pena- pemerintah Indonesia seperti dialami pen- harus tegas menyelesaikan masalah klaim berupa unjuk rasa di kedutaan dan konsul dilihat beberapa kebijakan dan tindakan nganan serius pemerintah dan seluruh datang asal Tanjung Balai, Sumatera Utara terhadapbudayanasionalkita,sehinggatidak mereka yang ada di negeri ini bahkan terjadi mereka melecehkan bahkan merendahkan komponen bangsa, karena sudah satu da- yang kedapatan memperjualbelikan dadah berulang kali dilakukan Malaysia. Selama ini pembakaran terhadap bendera kebangsaan harkat dan martabat kedaulatan Negara sawarsa Malaysia menganggap remeh (narkoba). Yang lebih menyakitkan lagi terkesanIndonesia“lembek”menyikapiklaim Oleh H IrhamTaufik Umri,SH,MAP Malaysia,tidakmenyurutkanlangkahmereka Kesatuan Republik Indonesia. Lihat saja ke- terhadap negara serumpunnya Indonesia. mereka menyebut bangsa Indonesia sebagai batik dan lagu rasa sayange. Waktu itu pe- untuk mengklaim budaya Indonesia itu. Ma- nyataan pahit yang ditelan Indonesia, ketika Pada masa Orde Baru klaim mengklaim “Indon”, predikat yang merendahkan harkat merintah kita/Menteri Pariwisata Seni dan lah mereka semakin bersemangat berjuang mereka merebut pulau Sipadan dan Ligitan. ini tidak pernah terjadi, karena Indone- danmartabatmanusia.Banyaklagikebijakan Budaya Jero Wacik yang langsung datang N egara jiran Malaysia mengklaim agar budaya milik bangsa Indonesia itu men- Sama halnya dengansengketabatik,penyele- sia di bawah pemerintahan Soeharto yang dan tindakan yang dilakukan mereka terha- menemui pejabat berkompeten ke Kuala taripendet(tarisakralkeagamaan jadibudayamilikmereka.Perjuanganmereka saian pulau Sipadan dan Ligitan juga dilaku- berkuasa 32 tahun lamanya cukup kuat. dap bangsa ini, termasuk peristiwa klaim Lumpur memprotes keras klaim Malaysia. Bali) sebagai budaya mereka. tidak sia-sia. Dengan kemampuan diplomasi kanmelaluiproseshukuminternasional.Lagi- Persatuan dan kesatuan bangsa solid. De- terhadap tari Pendet yang nyata-nyata tarian Kendatipun mereka tidak lagi menyiarkan Klaim itu diketahui dari situs luar negeri yang piawai, ditopang sumber lagi Indonesia kehilangan tongkat untuk ke- mikian pula Angkatan Bersenjata Republik itu berasal dari Bali Indonesia. Dari pakaian, lagu Rasa Sayange pada promosi pariwisata- website dan momentum formal kenegaraan daya manusia andal di bidang hukum inter- dua kalinya. Sengketa pulau Sipadan dan Indonesia cukup disegani terutama di musik gamelan dan gerakannya, seluruh nya, mereka tidak minta maaf atas kejadian melalui promosi pariwisata “Visit Malaysia nasional, ahli-ahli hukum mereka dapat me- Ligitan yang sudah sejak lama dipersoalkan kawasan ASEAN. Keseganan Malaysia dunia pun sudah tahu bahwa tari sakral itu, seakan tidak bersalah. Bahkan kembali Year 2009”. Dalam promosi pariwisata itu se- yakinkan Mahkamah Internasional. Akibat- kedua negara yang bertetangga itu kembali bertambah karena Indonesia mendomi- keagamaan itu merupakan warisan leluhur mengulang klaim terhadap lagu Indang cara jelas ditayangkan tarian Pendet dengan nya cukup tragis, klaim mereka berhasil men- dimenangkan oleh Malaysia. Mahkamah nasi percaturan di perhimpunan bangsa budaya Bali. Setiap wisatawan yang berkun- Bariang, musik angklung, makanan rendang durasi satu menit menjadi ikon latar untuk dapat pengakuan dunia internasional. Batik Internasional yang berpusat di Den Haag Be- Asia Tenggara. Tidak pernah terjadi klaim jung ke Bali pasti mendapat tontonan tari padang dan tari Pendet. memperkenalkan tempat-tempat wisata yang dikenal turun temurun menjadi budaya landa memutuskan kedua pulau strategis ataupun masalah krusial termasuk pere- Pendet, karena dipergelarkan pada saat-saat Oleh karena itu budaya sebagai aset yang ada di negara jiran tersebut. dan mata pencaharian sebagian besar ma- itu secara sah menjadi bagian dari negara butan wilayah antar kedua negara. Akan upacara keagamaan yang sangat sering bangsa yang diklaim Malaysia harus disela- Promosi pariwisata ini di samping ter- syarakat pulau Jawa akhirnya berubah men- Malaysia. tetapi keseganan Malaysia sudah berlalu dilakukan di pulau dewata itu. matkan dan dipertahankan, karena me- dapat pada website yang dapat diakses di jadi hak paten budaya Malaysia. Mendapat angin dari keberhasilan dan sejalan dengan perubahan politik di negeri Begitu juga dalam memperkenalkan nyangkut identitas dan kedaulatan NKRI. internet,jugadisiarkandengangencarmelalui Pada tahun yang sama Malaysia juga kemenangan merebut pulau Sipadan dan ini. budaya Indonesia ke mancanegara sekaligus Apapun motif di balik peristiwa itu harus stasiun televisi yang dimiliki negara itu. Klaim mengklaim lagu Indang Bariang (asal Su- Ligitan tanpa peperangan fisik maupun Kini Malaysia menunjukkan taringnya menarik kunjungan wisata, tari Pendet sudah diusut tuntas, sehingga diperoleh titik pe- terhadapbudayamilikIndonesiainibukanlah materaBarat),BungaRaflesia,BintangKejora, keberhasilan klaim terhadap batik, beberapa terhadap Indonesia. Mereka menganggap sangat sering dipergelarkan dalam lawatan nyelesaian. Jika ada unsur kesengajaan, untuk pertama kali mereka lakukan, akan musik angklung (Sunda Jawa Barat) dan reog bulan yang lalu mereka melakukan manuver remeh dan rendah bangsa yang pluralis ini, ke luar negeri terutama di Malaysia. Berda- pemerintah Malaysia harus minta maaf tetapi sudah berulang kali dengan sengaja Ponorogo (JawaTimur) sebagai aset budaya- ingin merebut pulau Ambalat di sekitar pulau karena mereka menganggap negaranya sarkan upaya mempromosikan tari Pendet secara formal kepada pemerintah/bangsa diperbuat Malaysia. Menurut catatan klaim nya. Khusus reog Ponorogo mereka ganti Sulawesi yang sangat kaya dengan sumber cukup maju terutama di bidang perekono- dan tari nasional lainnya, mustahil mereka Indonesia. Jika menyangkut area bisnis terhadap budaya Indonesia dimulai pada namanya menjadi tari Barongan. Makanan mineral seperti minyak dan gas bumi. Kapal- mian. Banyak peristiwa yang menyakitkan tidak tahu tari tersebut berasal dari Indonesia. harus diselesaikan dengan cara ganti rugi tahun 2007. Dalam rangka mempromosikan khasPadangSumateraBaratrendangpadang kapal perang mereka secara sengaja menuju hatiyangdilakukanmereka,sepertiperlakuan Harus diakui pula negara Indonesia memang dengan merujuk kepada hak intelektual. pariwisata yang gencar dilakukan untuk diakuipulamerupakanmakananberasaldari dan berpatroli di perairan Ambalat, bahkan terhadap tenaga kerja Indonesia yang me- kaya baik potensi alam dan juga keaneka- Namun yang sangat penting dilakukan meningkatkan arus wisatawan ke negaranya sana. Bahkan dari sumber yang layak diper- sudah jauh memasuki wilayah perairan yang ngadu nasib disana, terlebih-lebih bagi TKI ragaman budaya dari Sabang sampai Me- adalah duduk bersama di bawah semangat melalui sloganVisit MalaysiaYear 2007, lagu caya ditenggarai pula bahasa Indonesia yang menjadi kedaulatan bangsa Indonesia. illegal (pendatang haram) yang masuk ke rauke,dariMiangassampaipulauRote.Saking saudara serumpun dan panji ASEAN. Un- Rasa Sayange dijadikan sebagai nyanyian sudah diikrarkan menjadi bahasa persatuan Ironisnya walaupun berkali-kali kapal pe- wilayahkedaulatannya.Merekadiperlakukan kayanya, sudah tentu ada orang yang ingin tuk mencapai kesepakatan antara kedua memperkenalkan negaranya baik untuk bangsa Indonesia pada tanggal 28 Oktober rangnya melanggar perairan Indonesia, dan semena-mena tanpa menghormati yang mengambil kekayaan itu dari pemiliknya. negara termasuk mengikut-sertakan buda- konsumsi masyarakat domestik maupun 1928, akan dikukuhkan pula sebagai bahasa diusir kapal patroli Indonesia dengan cara namanya saudara serumpun. Ada majikan Bisa dikatakan ilustrasi itulah yang menimpa yawan. Andaikata ingin membuat iklan manca negara. Kendatipun judul lagu diubah Melayu. Timbul pertanyaan mengapa Ma- menggiring kapal perang mereka keluar dari yang tidak membayar gaji kepada TKI ber- negara Indonesia. promosi pariwisata yang masih “grey area” menjadi “Rasa Sayang” yang dinyanyikan laysia begitu nekad melakukan klaim ter- zona eksklusif Indonesia, tidak menyurutkan bulan-bulan bahkan tahunan. Ada pula di- (abu-abu) terlebih dahulu dibahas bersa- bergantian mulai etnik Melayu, China dan hadap budaya milik Indonesia? langkah mereka mengincar pulau Ambalat. siksa dengan menyulut puntung rokok, Penyelesaian ma, sehingga tidak secara sepihak meng- India, namun lirik dan iramanya tetap meru- Meskipun sengketa Ambalat sempat mene- memukul sampai babak belur bahkan Klaim terhadap tari Pendet dan juga adopsi budaya negara lain.- juk kepada lagu Rasa Sayange yang kita keta- Remeh gangkan hubungan kedua negara, namun melakukan siksaan dengan menyiramkan budaya nasional yang dilakukan Malaysia huisejakdulukalalaguituberasaldariMaluku Tidak dapat dipungkiri sejak terjadinya melaluipembicaraanyangdilakukanMenteri air panas mendidih ke sekujur tubuh tenaga harus segera diselesaikan. Penyelesaiannya Penulis adalah Dosen Sekolah Tinggi Agama Indonesia. reformasiyangmelanda negeriinitahun1998 Pertahanan RIYuwono Sudharsono dengan kerja Indonesia baik yang melakukan kesa- sangat penting karena menyangkut identitas Islam Al Hikmah Kota Tebing Tinggi. Bersatu Membangun Negeri agarsetelah20Oktober2009saatpemerintah- ga diyakini mampu menghasilkan kinerja bilitas tinggi, tetapi tidak didukung oleh pemi- nangan, tugas dan tanggung jawab mesti Oleh Aldwin Surya an era SBY-Boediono dilantik dan mulai ber- optimal. Persoalan mendasar adalah apakah likan staf dengan kinerja tinggi pula. Oleh dihindari. Disharmonisasi cenderung mem- tugas, para menteri pun boleh ”tancap gas” pemerintahan era 2009-2014 mau memberi karena itu, diharapkan para menteri mampu beri celah bagi pihak luar untuk meman- di bidang masing-masing. Sejumlah agenda ruangkepadafigur-figuryangmemilikiderajat mencermati kinerja stafnya. Jika diperlukan, faatkan kesempatan guna meraih keuntung- K emenangan duet SBY-Boediono keinginan Presiden/Wakil Presiden terpilih kerja yang merupakan warisan dari kerja se- keprofesionalan tinggi di bidangnya? langkah mengganti para staf di setiap eselon ansecarasepihak.Hatikitapunsemakinmiris padapilpres2009memicutimbulnya merangkul dan menempatkan beberapa ka- belumnya serta agenda kerja baru untuk Penetapan spesifikasi/kriteria figur dan dapat ditempuh. Keadaan inilah yang dimak- saat mendengar, menyaksikan disharmoni- banyak harapan untuk membenahi der partai politik pada jajaran kabinet 2009- mewujudkankinerjaIndonesiadimatadunia proses seleksi yang digunakan menjadi pen- sud sebagai ”tancap gas”, agar para menteri sasi birokrasi, regulasi dan personel dimanfa- beragam persoalan yang masih melanda 2014 dinilai tepat. Makna dinilai tepat adalah sudah menanti. ting sebelum akhirnya ditetapkan Presiden dapat bergandengan tangan dengan para atkannegaralainmeraihkeuntungandengan Indonesia. Beragam persoalan itu bermuara keikhlasandaripartaipolitikuntukmenyerah- Harapan terhadap terwujudnya kinerja untuk mendudukikursimenteridansetingkat staf dan kemudian secara bersama-sama memanfaatkan potensi ekonomi, sosial, pada aspek ekonomi, sosial, politik, budaya, kansepenuhnyapenyusunankabinetsebagai Indonesia secara holistik patut diberi an- menteri. Penetapan figur yang tepat diyakini ”berlari” mengejar ketinggalan dan meraih budaya, dan politik yang ada di Indonesia. dan pertahanan keamanan nasional. Skala hak prerogatif kepada Presiden terpilih. Ini cunganjempol.Pasalnya,PresidenSBYsudah akan meringankan tugas Presiden danWakil prestasi lebih baik. Pemanfaatan ini semakin menyedihkan bila persoalannya tidak hanya di dalam negeri, berarti koalisi 24 partai politik yang mendu- memberi sinyal bahwa kabinet 2009-2014 Presiden dalam menghadapi beragam isu Prestasi yang diharapkan itu tercermin melihat ”longgarnya” penerapan aspek ke- tapi juga luar negeri. Keberhasilan menye- kung SBY-Boediono tidak semuanya akan adalah kabinet kinerja. Sebuah kabinet yang domestikdanluarnegeriyangmelanda Indo- dari peningkatan mutu layanan publik.Wu- amanandisetiapwilayahIndonesia.Keadaan lesaikan beragam persoalan itu, akan men- memiliki peluang menempatkan kader par- berisi para menteri atau setingkat menteri nesia.Presidententusajasudahmendapatkan dnya boleh jadi berbentuk kepuasan atas ini cenderung menimbulkan beragam efek cerminkan keberhasilan pemerintah. Dalam tainya pada kabinet 2009-2014. Sikap elegan yangdiharapkanberlomba-lombamenguta- banyak informasi tentang calon-calon yang layanan publik, minimalisasi keluhan dari seperti lahan subur bagi aksi teror dan ren- usia matang kemerdekaan ke 64, rakyat ber- seperti ini juga merupakan implementasi makan kinerja optimal. Dalam pandangan dianggap layak menjadi pembantu Presiden. publik,pencapaiantarget,kecepatanpenyele- dahnya pengawasan pulau-pulau terluar harap Indonesia harus mengejar “ketinggalan” dari kematanganberdemokrasidalampilpres publik, kabinet 2009-2014 berisi figur-figur Oleh karena itu, kemungkinan salah pilih ter- saian kasus atau sikap tidak memihak dari yang berbatasan dengan negara lain. untuk mampu bersaing dengan negara lain. di Indonesia. Partai politik tidak lagi hanya yang ingin menghasilkan karya ”monumen- hadap calon yang diunggulkan dapat dihin- semua lini personel di lingkungan departe- Kedepankitaberharapupayapihakasing Syukurlah, sinyal terhadap harapan ini memikirkankepentingandirisendiri.Namun, tal” di bidang masing-masing. Publik pun dari. Namun, penentapan calon menteri men tingkat pusat dan daerah. Di era glo- memanfaatkan potensi ekonomi, sosial, bu- dengan cepat ditangkap oleh pasangan Pre- sudah memahami betapa pentingnya me- berharap kinerja optimal para menteri lang- belumlah lengkap bila tidak disertai dengan bal saat ini mutu layanan publik menjadi in- daya dan politik serta belum optimalnya pe- siden/Wakil Presiden terpilih. Dalam bebe- mikirkan nasib bangsa yang akan bermuara sung dirasakan manfaatnya oleh semua ka- pembenahan sistem dan prosedur kerja di dikator keberhasilan pemerintah, di dalam ngawasan keamanan pulau-pulau terluar rapa kali pertemuan, sinyal ini secara gam- kepada nasib negara. Selain kader partai, langan, etnik dan agama dalam waktu segera. masing-masing departemen. Pembenahan dan luar negeri. Dalam konteks inilah, biro- di Indonesia, tidak lagi terjadi. Kita tidak lagi blang dikemukakan oleh Presiden SBY. Hal Presidenterpilihjugamenempatkansejumlah SebagaipembantuPresiden,paramenteri dilingkungandepartemenantaralaindimulai krasi, regulasi dan kesiapan personel menjadi ingin mendengaradawilayahIndonesiayang yang melegakan adalah komitmen untuk profesional sehingga susunan kabinet sema- dansetingkatmenteriperlu memahamibah- dari para personel di bawah menteri (eselon hal mustahak untuk membentuk harmoni- ”dikuasai” pihak asing, ada budaya Indonesia “merangkul” dua pasangan capres dan ca- kin padu. wa dipilih menjadi menteri adalah amanah I dan seterusnya), mekanisme, ketepatan sasi kerja antara pusat, provinsi dan daerah/ yang diklaim milik negara lain. Jadi, para wapres lain agar secara bersama-sama me- yang patut dijalankan secara sungguh-sung- dan kecepatan kerja. kota di seluruh Indonesia. menteri kabinet 2009-2014 tidak perlu sung- mikirkan dan mewujudkan kinerja masing- Kabinet kinerja guh.Apalagisebelumnya,merekamelakukan Pasca otonomi daerah, beragam bentur- kan menggalang semua kekuatan elemen masing dalam membangun bumi pertiwi Sementara Presiden terpilih masih terus sumpah jabatan. Jadi, bila ukuran keberhasil- Mutu layanan publik an yang bermuara kepada aspek birokrasi, masyarakat untuk menjadikan bangsa In- menjadi sebuah negara yang maju, kuat dan menggodokfiguryangtepatyangakanmeng- an yang diinginkan Presiden adalah kinerja, Di era global saat ini, kinerja sebuah de- regulasi dan kesiapan personel kerap timbul donesia sebagai bangsa yang maju, mandiri bermartabat. isi formasi kabinet 2009-2014,Wakil Presiden maka indikator usia (senioritas) bukan lagi partemen tidak hanya ditentukan oleh figur dan menjadi dishorminisasi yang merugikan dan bermartabat. Persaingan selama masa sebelum pilpres terpilih juga sudah diberi tugas menyusun tolok ukur yang tepat. Banyak figur dalam yang memimpin departemennya, tetapi juga bagi bangsa dan negara. Pasalnya, Indonesia berlangsung sudah usai. Inilah saat untuk rencana kerja pemerintahan pada lima tahun kisaran usia muda yang potensial dan teruji kepada kinerja para staf. Boleh jadi sebuah adalah negara kesatuan, sehingga kecen- Penulis adalah pemerhati perkotaan dan bersatu membangun negeri. Oleh karena itu, ke depan. Mekanisme ini juga dinilai tepat dalam banyak kegiatan di bidangnya, sehing- departemen memiliki menteri dengan kapa- derungan disharmonisasi dalam hal kewe- Rektor Universitas Dian Nusantara Kebersihan Dan Keindahan Kota Medan (Pembersihan Drainase Untuk Kebersihankah Atau Penyebaran Penyakit?) kita lihat juga kekurangannya adalah me- di jalan. Itu mungkin karena sampah tersebut domestik terutama limbah padat dan penuh lewat atau masyarakat yang tinggal di sekitar Oleh Fauzil Husni, S.Si ngenaikebersihanjalan.Sekarangkitamelihat sudahlamatidakdiangkutsehinggamenum- dengan endapan lumpur. Sehingga aliran jalantersebut,karenakuman-kumantersebut jalan-jalan protokol, bukan saja banyak yang puk sampai tidak muat lagi. Jalan-jalan dan air tidak bisa berjalan dengan lancar. Hal ini belumlah mati pada kondisi suhu yang ada. berlobangtetapijugakotordanberdebutebal, taman kota pun banyak yang kotor dan tidak mempunyai pengaruh yang cukup besar Tentunya hal tersebut bisa menjadi sumber B elakanganini,khususnyakotaMedan apalagi,tidakadabiaya?Kemanabiayauntuk sehingga kalau panas berdebu, dan kalau terawat. Taman-taman kota banyak yang dalampengendalianbanjir.Bahkanpenyebab penyakit, terutama pada anak-anak, ditam- yang kita cintai ini, terlebih setelah pembangunan jalan, sementara jalan-jalan hujan becek dan berlumpur. Katanya Medan kotor karena dipasangi spanduk dan sampah kotornya aliran Sungai Deli juga dikarenakan bah lagi kondisi iklim yang tidak menentu. dinyatakan dan dinonaktifkannya yangrusakhanyadiperbaikidenganditambal, pernahmendapatpenghargaanAdipura,tapi pedagang yang berjualan. Membangun ta- kotornya buangan dari drainase. Selain itu, jika lumpur tersebut lama diangkat, Walikota danWakilWalikota Medan Abdillah tidak berapa lama kemudian hancur lagi. mungkin itu beberapa tahun yang lalu, seka- mankotaitukanuangrakyat,Manatanggung Penyebab terjadinya banjir di daerah bisa jadi saat turun hujan deras, lumpur ter- dan Ramli, kota Medan seperti tak terurus, Drainase di sekitar jalan itu juga sudah usai ranghanyatinggalkenangandansebuahtugu jawab petugas pamong praja? Apa mereka perkotaan yang paling utama adalah karena sebut akan masuk kembali ke drainase atau terutama mengenai kebersihan, keindahan dibangun. Mau berapa tahun lagi diperbaiki. di Jalan Adam Malik. menutup mata untuk itu. Masyarakat kota semakin berkurangnya ruang atau permuka- juga menjadikan jalan sangat kotor dan bau, serta ketertiban kota. Ditambah lagi dengan Mungkin para pejabat tinggi dinas yang ber- Memang masalah kebersihan tidaklah medan wataknya memang mesti ditegasi, antanahyangbisamenyerapairkarenasudah sehingga pekerjaan pun akan menjadi sia- keadaancuacaalamyangtakmenentukarena sangkutan tidak merasakan bagaimana rasa- terlepas dari peranan kedua pihak antara ma- jadikalauaparatpemerintahkesannyapanas- semakin banyak bangunan. Untuk menang- sia. Belum lagi jalanan bertambah macet ka- dilandaglobalwarming.Kitabukanmemper- nya ketika melewati jalan-jalan yang rusak syarakat dan pemerintah terutama dinas ke- panas tahi ayam, pastilah mereka akan main gulangi hal tersebut, itulah sebabnya perlu rena adanya lumpur tersebut yang belum soalkan siapa yang memimpin tetapi kita tersebut,karenabisajadimerekatidakpernah bersihan kota, tetapi tentunya dinas kebersih- kucing-kucingan dengan aparat. ada drainase. Selain sebagai saluran pem- diangkat. bertanya ada apa sebenarnya dengan aparat dibawa pergi melewati jalan-jalan yang rusak anpunyaotoritasdankewenanganyanglebih buangan limbah cair domestik, drainase juga Haltersebutkebanyakankitajumpaipada pemerintahan kota Medan, kenapa seperti- itu, atau pun tidak terasa ketika melewati jalan serta tanggung jawab yang besar terhadap Pengorekan drainase besar fungsinya untuk mengantisipasi banjir. drainase yang tidak berada di pusat kota dan nya mandek. Berkenaan dengan hal keber- tersebutkarenaempuknyamobilyangdiken- kebersihan kota Medan. Kita bukan memuji KetikaWalikota Abdillah dinonaktifkan, Langkah pembersihan drainase yang di- dandidalamgang.Berbedadenganbeberapa sihan, keindahan dan ketertiban kota, kita ma- darainya,tapicobapikirkanbagaimanaorang Walikota nonaktif Abdillah, tetapi memang kitamenunggukira-kiraapayagebrakanyang ambil oleh dinas kebersihan saat ini, merupa- drainaseyangberadapadapusatkota,seperti- syarakat sangat risih dan cemas melihat kota yang bersepeda motor dan menggunakan ang- kenyataannyapadamasabeliauaktifmenjadi akan dilakukan PJWalikota Medan Afifuddin kan suatu langkah yang cukup baik. Jika drai- nya ada pilih kasih. Kalau di pusat kota seperti Medan yang semakin kotor dan amburadul. kutan kota, mungkin ibu hamil pun bisa Walikota, debu-debu terutama di jalan-jalan pro- Lubis. Dalam masalah kebersihan kota serta nase yang ada ini tidak dirawat dengan baik, Jalan Imam Bonjol, lumpur yang diangkat Kita bisa melihat jalan-jalan besar di kota keguguran. tokol selalu dibersihkan oleh mobil pembersih perawatan dan perbaikan jalan ternyata ba- maka drainase tersebut tidak akan memberi- dari drainase langsung dimasukkan ke dalam Medan ini banyak yang rusak, kemudian Kalau kita berpikir, betapa besarnya pe- debu.Tapi coba kita lihat sekarang, mana mo- nyak kemunduran dan banyak yang terbeng- kan manfaat yang besar terutama dalam kantong-kantong goni untuk diangkat, se- hanya main tempel saja seperti menambal ranan jalan yang bagus terhadap penurunan bil pembersih itu? Debu-debu di jalan sudah kalai. Kita tidak tahu alasan yang pasti, me- penanggulanganbanjir.Jadiwalaupunmung- hingga tidak sampai mengotori jalan. Tapi pakaian. Di sisi lain, ada pula jalan yang sudah lakalintasdankemacetan.Karenasebahagian pada tebal, itulah yang setiap hari panas dihirup ngapa terjadi perubahan kinerja aparat yang kin belum bisa untuk membangun atau coba kita lihat drainase yang berada di Jalan bagus, kemudian dibongkar lagi, mungkin besar kecelakaan lalu lintas disebabkan oleh olehpengendarayanglewat,terutamasepeda signifikan terutama dalam masalah keber- memperlebardrainase,palingtidakkitaharus BajakII,Thamrin,Utama,Sutrisno,Ismailiyah, karena ada galian PDAM lah, atau galian Serat rusaknya jalan, banyaknya jalan yang berlo- motor, dan itu pulalah yang dihirup oleh sihan dan keindahan kota. Apakah memang bisa merawat dan membersihkan drainase Pelajar, Jalan Cahaya Kp. Durian dan lain- Optik lah, PLN, dan sebagainya. Saya rasa bang. Kalau banyak jalan yang rusak atau masyarakat yang tinggal di sekitar jalan itu. tidak ada perintah, atau ada perintah tapi yang sudah ada. lain yang tidak di pusat kota, lumpurnya di- belum ada satu ruas jalan yang sepanjang berlobang, masing-masing pengendara akan Begitu pula dengan pengangkutan sam- diabaikan, atau kehabisan anggaran. Hal itu Pembersihan drainase yang ada di kota biarkan begitu saja di pinggir jalan. Kasihan jalan itu bagus dan mulus. Padahal, kalau kita berebut memilih jalan yang bagus, akibatnya pah yang ada di jalanan, saya rasa kita semua terusberlanjuthinggaakhirnyabeliaupensiun Medan, sudah berjalan hampir satu bulan. sekali warga yang tinggal di sekitarnya, harus berpikir salah satu indikasi meningkatnya ketika dua pengendara mengambil bagian pastimerasakandanmasihingatketika2atau dan digantikan oleh Rahudman Harahap. Hampir semua drainase baik yang berada rela menghirup bau tak sedap dan kuman- pembangunan dan kesejahteraan masyara- jalanyangsamasecarabersamaan,akibatnya 3 tahun yang lalu. Ketika itu banyak unit-unit Rahudman kelihatan punya semangat di pusat kota maupun yang berada di dalam kuman yang mungkin berterbangan. Sekali kat kota bisa dilihat dari kualitas pemba- bisa terjadi kecelakaan. Begitu pula dengan mobil khusus pengangkut sampah berwarna yang lebih, walaupun beliau hanya sekadar gangdilakukanpengorekan.Kitasangatapre- lagi masyarakat juga yang kena dampaknya. ngunan infrastruktur terutama jalan dan kemacetan, semakin banyak jalan yang rusak hijau, yang siap mengangkut sampah bukan pejabat walikota yang mungkin sekitar + 1 siasi dengan langkah ini, cuma kita lihat pem- Sebenarnya kalau pekerjaan ini benar-benar drainase.Karenajalanlahfasilitasinfrastruktur sudah pasti jalan tersebut semakin macet hanya di jalan-jalan protokol saja, tapi juga tahun lagi akan habis. Sepertinya masih ada bersihan drainase yang dilakukan sepertinya difikirkan matang-matang, sungguh besar yang dapat dirasakan semua lapisan masya- ketika dilalui banyak pengendara, akibatnya termasuk taman-taman kota dan jalan-jalan kemauan untuk berbuat walaupun mungkin masih kurang pertimbangan dan seperti ada dampakpositifyangdihasilkan,tetapisebalik- rakat, baik kaya atau miskin, maupun pejabat aktivitas serba terlambat. Bisa kita ambil con- kecil bahkan sampah di dalam gang pun dirasakan tak banyak yang bisa diperbuat. kesanpilihkasih.Mengapatidak?Kitamelihat nya jika dikerjakan setengah-setengah, akan atau pengemis. tohjalanGatotSubroto,cobakitabandingkan diangkut,danseringjugaataumungkinsudah Gebrakan tersebut muncul tak berapa lama lumpur-lumpur yang bercampur sampah menyisakan dampak yang negatif terhadap Banyak sekali jalan yang rusak, seperti ketika jalan tersebut masih rusak parah de- terjadwal, pada malam hari pun mereka hanyadalamhitunganharisetelahpelantikan. yang diangkat dari drainase kebanyakan ma- masyarakat. Sehingga timbul pertanyaan, jalan Mandala By Pass, Jalan Setia Budi, Jalan ngan keadaan sekarang yang sudah bagus bekerjamengangkutsampahtersebut.Waktu Gebrakan yang sangat jelas terlihat oleh kita sih dibiarkan sampai lama dipinggir jalan. pembersihandrainase,untukkebersihankah, Denai, dan masih banyak lagi. Belum lagi ja- dan lumayan mulus, pasti jauh berbeda. itu kita begitu terkesan dan acung jempol adalah pembersihan /pengorekan drainase. Kita juga bingung mengapa lumpur hitam atau penyebaran penyakit? Tapi walaupun lan-jalan di pedalaman, hampir semua tidak dengan pemerintah kota Medan terutama Menurutsayainimungkinsuatulangkahawal tersebut dibiarkan lama tak diangkat. Kita begitukitapatutucapkanterimakasihkepada ada yang tidak rusak. Apa memang kualitas Kebersihan Jalan dinas kebersihan. Tetapi sekarang, ke mana yang sangat baik, karena salah satu masalah kantahukalaulumpurtersebutpastimengan- pemerintah kota Medan yang sudah berupa- jalan yang baru bisa dibangun hanya seperti Masalah kerusakan jalan, mungkin kita semua unit mobil pengangkut sampah itu? kota Medan yang sangat menonjol saat ini dung banyak kuman yang bisa menjadi sum- ya untuk menjadikan Medan menjadi kota itu, atau kurang tenaga ahli atau hal-hal lain. bisaberprasangkabaikyaitumungkindikare- Apakah sudah jadi sampah atau dimakan adalah mengenai penanggulangan banjir ber penyakit. Jadi kalau lumpur tersebut di- yang bersih dan indah. Semoga kekurangan JalanMandalaByPassmisalnya,sudahberapa nakan sudah habisnya anggaran untuk itu, rayap?. Sekarang tinggal truk pengangkut dan kebersihan kota, selain masalah kerusak- biarkan lama, kemudian terkena panas dan yang ada bisa menjadi bahan evaluasi untuk tahun penduduk sekitar itu merasakan becek atau terlalu besar dana untuk memperbaiki sampah yang berwarna kuning yang keba- an jalan. Bagaimana tidak, karena kalau kita angin, besar kemungkinannya kuman- dapat diperbaiki. dan banjir kalau hujan, dan menghirup debu jalan jika lebih dari sekedar menambal. Tapi nyakan sudah reok, yang terkadang jika lihat, hampir semua drainase yang ada di kota kuman penyakit tersebut bisa berterbangan yang sangat tebal kalau lagi panas. Alasan selain masalah kerusakan, sisi lain yang bisa kepenuhan,sampahpunkembaliberjatuhan Medan sudah begitu kotor dengan limbah dan menjangkit kepada setiap orang yang Penulis adalah Mahasiswa MagisterTeknik Kimia USU
  • 14. 14 WASPADA Selasa, 1 September 2009 FAX.4561347 1 CM Rp. 12.000 3 CM Rp. 36.000 5 CM Rp. 65.000 7 CM Rp. 91.000 9 CM Rp. 126.000 11 CM Rp. 165.000 IKLAN KHUSUS HARGA BELUM TERMASUK Khusus Medan Deli, Marelan, Labuhan, Belawan 2 CM Rp. 24.000 4 CM Rp. 48.000 6 CM Rp. 78.000 8 CM Rp. 104.000 10 CM Rp. 140.000 12 CM Rp. 180.000 6x1,5 kolom Rp. 120.000 PPN 10% Hub. 0812 6390 660 Iklan Anda Dijemput Bursa SUZUKI BALENO NEXT-G ‘03/04 Maron Met. BK Mdn 1 Tgn, VR 18”, BR, Jok Klt, DVD, Komplit, DP 36Jt, Angs: 3,3 (30bln) TOYOTA Innova G ‘05. Akhir (Des). Bursa Service Bursa AUTOMOTIVE Honda City New-IDSI ‘04/05, Htm Met, AC, RT, DVD, Jok Klt. M/T. Silver Metalik, Bensin, mulus KOMPUTER ELEKTRONIK LOWONGAN KERJA Full Body KIT, VR 17”, BR, BK, Asur: All Risk 3 Th. DP 40 Jt. sekali. Terawat. Lengkap. Plat BL. Informasi Pembaca Angs: 4,9Jt (25 Bln) Hub. 0813 7588 7306 Bursa Automotive Harga Rp. 154Jt (nego). Hub. 0812 BUTUH BANYAK www.anekamodem.com REPARASI AC, KULKAS, MESIN CUCI AC SUZUKI BARU - (061) 77612356 AC : Air Condition PS : Power Stearing Carry Pick Up..........DP 7 Jt-an 645 2881 / (061) 414 2671 Kompor Gas, Dispenser H & C BR : Ban Radial PW : Power Window Carry Minibus..........DP 16 Jt-an Modem 3.75G Sierra 885U, 875U, Hvawei TV, M. Pompa Air Sanyo Hub. SURYA TEKNIK SERVICE Wanita Usia 18 s/d 30 thn ikuti sgr plth CL : Central Lock RT : Radio Tape Karimun Estilo .......DP 20 Jt-an TOYOTA Kijang LX Th. ‘04. Warna biru, Telp. 66482216 - 0813 7589 8757 sbg gru, Tmpt terbatas hub: ND DB : Nippon Denso : Double Blower VR EW : Velg Racing : Electric Window APV........................DP 16 Jt-an Grand Vitara..........DP 38Jt-an E160, E169. Novatel 950, T-Flash, Siap Ketempat Jl. KH. Wahid Hasim 92 Medan mobil sehat. Siap pakai. Bisa Kredit. Mulai Rp. 4xxrb Call. 061-91150607 SUZUKI Escudo 2.0 Thn. 2004. SERVICE LEONI SERVICE AC BMW 318 Th. 91. Hitam met. Mdn asli. Ph. 453.3875/ 456.9269 Jl. Karya Wisata Coklat met, Original. Plat BH. Rp. 110 Jt. Jl. Tritura No. 8 K. CUCI/SERVICE AC, PERBAIKAN No. 23A Johor Ph. 7861.690 Medan Dua nama dari baru. VR, BR, AC, PW, Kembar Mobil. 0812 6058 6666 OBRAL LAPTOP MURAH AC, BONGKAR PASANG AC, MESIN CUCI, KULKAS. FREEZER CL, CD. Mulus. Siap pakai. 061-6621339 Rp. 120 Jt. Hub. 0816 3113 953 Hubungi: 0812 6300 746 TERDAHSYAT 2009 LOWONGAN BISA PILIH TIMOR Th. 2000 W. Htm. DOHC BK BMW 530i A/T. Individual, Thn. ‘95. SUZUKI Baleno ‘98 Komplit. Hijau, over kredit. Mutasi, Seri DK. 43Jt. Hub. 77084568 Miliki Segera....!!! Laptop, ok Kwalitas import, merk terkenal. MAJU TEKNIK 7030118 “DIBUTUHKAN SEGERA” SHIFT KERJA sep. Toshiba, Acer, HP, Dell Didesain dgn tampilan menarik Perusahaan swasta bertaraf INT’L buka cabang di Hitam, mulus, BK Pilihan, Sisa 19x. DP 29Jt. Sisa 24 x 2.386 ribu. Serius TP. - 0813 9674 1238 Jl. S. Parman Blkg. AC sehingga lebih berkelas & bergengsi. Internet Wifi Connection, Medan, butuh 35 org P/W (17035 thn) utk diposisikan Hub. 0813 7000 7127 - (061) 77567855 Toko Van Mtr. 23 Dkt. Bundaran. bluetooth, multimedia, komplit & sdh. siap pakai. 76750084 di kantor (100% BUKAN SALES), syarat: Hub. 0812 650 0200 Kunjungi Segera.....Mencoba sampai puas oke2 saja. KULKAS, M. CUCI - Pend. min. SMU, SMK sederajat - S1 (semua jurusan) - FC KTP: 2 lbr, FF 3x4: 2 Lbr # SUZUKI PAKET LEBARAN # - Medan Mall Lt. Dsr - 0812 6455 7274 Bursa - Guntingan iklan utk interview/ syarat lain bisa 2 CHEV. Trooper Thn. ‘88. BK Dapatkan Diskon s/d Rp. 7 Jt. DP Mulai 10%. Bunga - Millenium Lt. Dsr - 0813 70711319 Hrg. DISPENSER (BERGARANSI) menyusul setelah interview diterima mulai 1,56%. New G. Vitara, SX 4, Swift, APV Arena, - Medan Plaza Lt. Dsr - 0812 6085 2666 Mulai Penghasilan: Rp. 1.500.000 - Rp. 3.50.000/ bln Mdn, 5 pintu, 4x4. AC, Velg New Karimun. Carry Minibus, PU. Pick Up DP Mulai. BUTUH UANG - Paladium Lt. Dsr - 0813 7666 9353 CUCI Rp. 20.000,- (sesuai posisi dikantor) AC Rp. 4 Jt-an. Luar Kota OK. Hub. 0812 6570 683 Hub. BPK. ANDI SYAHPUTRA, SE Racing, Jual cepat. Hub. 0813 SUZUKI Carry Realvan 2000 Dijual. ANDA BUTUH DANA Jaminan Sertifikat Rumah, BPKB dan Leas- - Aksara Lt. Dsr - 0813 9742 2213 - Binjai Super Mall - 0813 6125 4113 Jt-an AC Baru 1 Pk + Pasang Rp. 2.090.000,- Garansi HP 0813.9678.1212 => TDK SMS . Atau datang lsg ke kantor: Jl. KH. Wahid Hasyim 70775644 / 7794 6484 1500cc. BK Mdn asli, merah metalic, AC, ing Mobil. Proses Cepat. Hub.061- NB: Ready Bongkar Pasang No. 118 A (±100m dari Simpang Barat Gatot Subroto) NB. 10 org pelamar pertama lsg kerja/ terbuka bagi mahasiswa DAIHATSU Espass 1.6 S. Van ‘96. Maron Met, BK Tape, Body mulus (kalengxx), Mesin ok. Harga 51Juta/Nego. Hub. 0852 6276 0024 77627838, 0852 758 79788 - 0811 65 7838 Bursa Hub. Sumatera 77555550 Jaya Mdn, Sliding Door. AC, TP, VS, BR DP 14 Jt. Angs: 1,013. Jeep Cherokee 4x4 M/T ‘95. 4.0 L Biru met. Good condition, VR, BR 31, PW, DP 23 Jt. SUZUKI Carry 1,5cc Dijual 2007, Pick ANDA BUTUH DANA KOMUNIKASI 0813 9730 5020 Jl. Gatot Subroto 401 SEBUAH PABRIK DI T. TINGGI Jaminan Apa Saja, Sertifikat Tanah. Membutuhkan: Angs. 2,3Jt. Hub. 0813 7588 7306 Up. Biru metalic, BK Medan asli/Pjk Proses Cepat, Syarat Mudah. Hub. HP BB. 8320 WIFI, DIJUAL. Memory 4 GB, Baru. Body/Pak mulus, mesin ok. 061-8222774, HP 0816 314 1807 . KHUSUS REPARASI / SERVICE Mekanik Bubut AC PROMO LEBARAN DAIHATSU BARU (Diskon + Hadiah) Harga Nego !!! Hub. 0812 6564 7771 Mulus 99% seperti baru. Garansi 7 bulan Xenia DP 12 Jt-an dan angs 2 Jt-an ANDA BUTUH DANA TUNAI Kulkas, M. Cuci, Sanyo air, Mekanik Las Terios DP 20 Jt-an dan Angs 3 Jt-an Rp. 3 Jt. Hub. 0812 6564 906 / 76877553 Dispencer, Bongkar pasang AC Luxio DP 8 Jt-an dan Angs 4 Jt-an Gran Max PU DP 8 Jt-an dan Angs. 2 Jt-an SUZUKI Katana Thn. 92, Hijau met. BK Jaminan BPKB Sepeda Motor/Mobil, bunga Hub. PRATAMA ELECTRIC Mekanik Listrik 3 Phase Ringan. Proses Cepat. Data Bisa Dijemput. Hub. 0813 7694 1988 / (061) 77722561 Bulan 6 - 2010, VR, BR, AC, RT, H. 38Jt. Mekanik Otomotif - DAIHATSU Rocky 4x4. Th. 95. Hitam, BK Mdn, 80Jt. Damai. Telp. 7863182 - 0856 6320 115 Hubungi: 061-66477734 /0813 9779 1077 Bursa GARANSI Telp. 7343789 LOWONGAN KERJA *BUTUH SEGERA 20 ORANG* BARU BUKA TANAH KAPLING SHM Dgn ukuran 6x20 (120m2). Harga PHOTO COPY Pelamar langsung ke: Rp. 325 Rb/m2. Hadap Barat Jl. Roso - Daihatsu Taft GT 4x4 Th. 94. Hitam, BK Mdn, 68Jt. - SUZUKI Carry Pick Up Th. 05, Hitam...Hrg. 55 Jt Bursa KHUSUS REPARASI KULKAS M. Cuci, Dispenser & Water Heater Jl. Jati Ujung Gg. Prima No. 5 Menjelang Mau “LEBARAN” Perusahaan Internasional menerima P/W usia 17 - 35 thn untuk diposisikan dalam Mariendal I (dlm Perumahan) Hub. (061) 7780.3927 (TP) Mls, Siap pakai. Bantu Kredit. Hub. 6614976 - Daihatsu Espass Pick Up Th. 03, Hitam...Hrg. 37Jt MESIN Siap Ditempat / Bergaransi Krakatau Ujung Medan kantor. (100% tidak Sales). Penghasilan Rp. 1.500.000/ Mls, Nego. Kredit DP 13Jt. Hub. Jl. Karya dkt Amir bln, syaratnya: KTP dan guntingan iklan dibawa untuk DAIHATSU Espass Minibus 1995 LESTARI JAYA (061) 8457990 - HP. 0812 632 1970 mempermudah diterima kerja. Pengalaman dan Hamzah Tel. 77872325 Jual: M. Penghitung Uang, M. Genset, 9000W, BK Medan Pintu 5 Short Rp. 25Jt. Mulus. Jl. Karet Raya No. 68-B 7000W, 4000W, 1500W (Nego). Hub. 4577146, AHLI TOSHIBA, SONY, LG, SAMSUNG, POLYTRON, LOWONGAN KERJA pendidikan tidak diutamakan Hubungi: IBU NILA NINGSIH Bursa SUZUKI Futura FN 2005. Mulus. SANYO, JVC, AKARI, SHARP, TV CHINA, DLL Dicari: TEKNISI ELEKTRONIK HP. 0813.7046.7180 => NO SMS P. Simalingkar 7656 3366 DAIHATSU Feroza 1994. Biru muda. Terawat, jarang pakai. Harga 45Jt Nego. Hub. 0813 9725 3351 77073637. Senang Hati. Jl. Sekip 67 A Bursa Alamat: Jl. Gatot Subroto Dalam No. 6J & 8 L Medan TV Siap di Tempat, Murah, Bergaransi HARIS, 77091118 - 0812 6311011 Tamatan : Sekolah Menengah Kejuruan (SMK) Atau datang langsung ke alamat kantor ada di: Jl. Wahid Hasyim No. 110 A Simpang Barat Medan NB. - Iklan berlaku 1 minggu sejak terbit PENGINAPAN Mesin dan body mulus. AC, BK. Tape, AHLI TOSHIBA, SONY, POLYTRON, SAMSUNG, SHARP, - Datang langsung diterima kerja SUZUKI SIDE KICK ‘95 DIJUAL RENTAL MOBIL SANYO, LG, JVC, TV CINA, DLL. Jurusan : Elektronik (Audio Vidio) VR, BR. Hub. 0812 650 16503 (Marlina) # DAIHATSU PAKET LEBARAN # Mulus sekali. BK 1 thn. Tdk. pakai Seri. CD, Jok dll. Siap pakai. Harga 70 Jt IKHLAS RENT CAR Dalam Kota: Innova G 300rb, Avanza G: 270rb Luar Kota: Innova G 350rb, Avanza G : 330rb Termasuk TV Siap di Tempat, Murah, Bergaransi Minggu Buka SIGIT, 76547004, 0812 6067 7344 Usia : Max. 21 thn Belum menikah DIBUTUHKAN SEGERA 1. Assisten Manager 1 orang Xenia DP 13 Jt-an Angs. 3 Jt-an Segera daftarkan diri anda: Terios DP 19 Jt-an Angs. 3 Jt-an Nego. HP. 0812 656 8818 / 7730 5875 supir Non BBM. Hub. 0852 61182 406 - 91312308 AULIA JAYA 2. Administrasi 1 orang Luxio DP hanya 7 Jt-an Servis, Bongkar Pasang, Reperasi, Freon. Di kantor Panasonic Sentra Service 3. Analis Kesehatan 2 orang Hub. Taufik 0811 651 993 / 77491993 DIJUAL Bursa Alamat Jl. William Iskandar 4. Penata Rontgen 2 orang SUZUKI Vitara ‘93, Hitam, Komplit ELEKTRONIK Mesin Cuci, Dispenser, Kulkas (Pancing) No. 265 Telp. 664.5650 H. Civic ‘87, Hitam, VR, BR, AC, Tape 5. Perawat 2 orang FORD Escape 4x2, Matic. Thn. 2003. S. Katana ‘87, Merah, komplit. JUAL & BELI Hubungi: 0813 7571 7657 - (061) 6849 Persyaratan sebagai berikut: VR 18. Crom, Silver. BK Mdn Rp. 139Jt. Kijang LSX ‘97 Biru met, Komplit TV, PS 1, 2, 3. Laptop, LCD Projector. Handycam Camera, Keyboard, Kulkas, M. Cuci, Sound, dll. 0363. Alamat Jl. Brigjend. Katamso. 1. Pendidikan S1 Ekonomi Management (1) Hub. 0812 6594 2789 Zebra ‘94, VR, BR, Mulus. Kijang Pick Up ‘90 Merah Mulus. Hub. MARKET ELECTRONIC. Telp. 821.0097. 66900693. 2. Pendidikan Minimal D3 - S1 Ekonomi, Komputer (2) Jl. Setia Budi No. 424B Dkt. Ring Road. HONDA Civic Wonder Th. 89. W. Hijau tua Hub. 0813 7044 0662 TERCECER / HILANG 3. Pendidikan D3 Analis Kesehatan (3) met. AC, TP, VR, PW, Medan asli. Mobil cantik. JUAL / BELI/T.T. BARU/BEKAS 4. Pendidikan D3 ATRO (4) Mulus, siap pakai. Harga 26 Jt. Nego. SUZUKI Futura Thn ‘92 Alexander, Tape/ Ban - TV, PS, Ampli, Spk. AC, Kulkas, M. Cuci, Laptop, TELAH TERCECER Hub. Jl. Karya Gg. Cimacan No. 9. Bagus Bodi, Mulus, BK Medan panjang, Abu-abu Proyejtor, Fax, Handicam,Camera, Keyboard, dll Sebuah BPKB No. A - 9600121-B. Sebuah Sp. 5 Pendidikan D3 Keperawatan (5) HP. 0813 75511277 - (061) 7637 5528 Hub. 4577146 - 7707 3637 Motor Merk Yamaha RX K. 135 - Thn. 2000. 6. Perempuan/ belum berkeluarga (1, 2, 3, 4, 5) Met, Harga 35 Jt/nego, TP Hub. Pak Guru Jl. Bajak Senang Hati, Jl. Sekip No. 67 A Hati, No. No. Pol. BK 3275 - AR. A/n. Herman. Alamat ISUZU Panther Chalenger. Th. 93 IV Timur Ujung 116 HP. 0813.6217.3116 Jl. Garu I Gg. Bakti Asri No. 89 D Medan. 7. Usia max. 24 tahun (1, 2, 3, 4, 5) W. Biru metalic. AC DB, Tape, PW, PS, VR, BR. Body lempang. Mulus. -SUZUKI Spin Thn. ‘08 mulus, Over KAMERA PENGINTAI BENTUK PULPEN HILANG/TERCECER 8. Mampu mengoperasikan komputer min. Excel/ Word Bursa H. Nego. Hub. 0813 9754 5210 Kredit. 6 Bulan lagi Angs. Rp. 582.000. (Tanpa Kabel Tanpa Listrik) Surat Hibah Tanah a/n. Abdul Rahman No. 209/3/A/ (1, 2, 3, 4, 5) BUSANA / AKSESORIS Kembali DP 5,5 Jt/Nego. Pulpen kamera ini bisa digunakan untuk H/MTP/1981. Tanggal 15 April 1981. Yang terletak di 9. Dapat berkomunikasi dengan baik (1, 2, 3, 4, 5) Tanjung Sari Gg. Kancil No. 27 Psr. 1. Luas tanah +/ PECI MURNI ISUZU Panther LDX Th. 92. W. Biru -Yamaha New Vega R Thn. ‘07. Mulus, merekam suatu tempat atau merekam - 529 M2. Bagi yang menemukan Hub. ke alamat tsb. 10. Jujur, disiplin, dan bertanggung jawab (1, 2, 3, 4, 5) metalik. AC Dingin. Tape, Power, CL, 7 Jt/Nego. Serius HP. 061-66477734/ seseorang tanpa diketahui. Hasil rekaman dapat dilihat melalui komputer / laptop. Dapat TERCECER 11. Bersedia ditempatkan di cabang perusahaan kami Remot. VR, BR, BK Medan. H. Nego. 0813 9779 1077 (TP) Hub. 061-7672 4125 merekam gambar dan suara (jelas dan BPKB dan STNK Mobil Zebra Thn. 94. No. Rangka di Mataram (3) berwarna). Dapat merekam dengan kapasitas 111020 BK 1483 FZ. No. Mesin 9111020. Bagi yang SUZUKI Carry Futura Pick Up. Lamaran dialamatkan ke Komplek Merbau Indah ISUZU Panther Mirip Total Assy Th. 99 W. Biru, Body kaleng. Seksi. max. -/+ 6 jam (4 GB). Pulpen kamera ini bisa menemukan harap hub. 0813 7660 1889 Tidak akan dituntut dan akan diberikan hadiah sepantasnya. TEMPAHAN ISTIMEWA Pasang Iklan Tahun. 93/92. W. Biru met. AC, VR, Lempang, Cat mulus. BK Medan. dibawa-bawa / dikantongi saat bepergian. No. 3-H Medan Petisah (belakang Carefour) H. ADAM AKIL HSB BR, PS, Tape. Cantik. H. 44 Jt/Nego. H. Nego. Hub. 061-77609041 Harga: Rp. 600.000. paling lambat 2 (dua) minggu setelah iklan ini Hub. 0813 7513 6475 Hub. 0813 7550 6908 NB: Harga tersebut diatas sudah fix. Bursa Jl. Setia Budi No. 49 A 8223975 TOYOTA Kijang Krista Diesel Th. 2001 PERCETAKAN ISUZU Panther Hi Grade Thn. 95. Mulus sekali. Mesin sehat, Complit, Dijual. W. Silver, AC, Tape, VR, BR, BK Medan. Body Kaleng, mulus. Bursa KESEMPATAN KERJA Bursa PECI MAHKOTA MENJUAL PECI TEMPAHAN Full Sound Sistem. Hrg. 68Jt Nego. Hub. 0813 7644 7297 Hrg. Nego. Hub. 0813 7582 3555 ELEKTRONIK DI MALAYSIA PROPERTY Berbagai Model Dan Warna UNTUK 200 ORANG TENAGA KERJA WANITA Jl. Prof. H.M. Yamin SH. No. 340 / Jl. Serdang “WASPADA” TOYOTA Kijang LGX ‘01 Diesel Hitam AC ISUZU Panther MB LDX Thn. 91 Mulus sekali, mesin sehat, siap pakai. VR, met. Jok kulit, AC DB, VR, BR, DP 35Jt, Angs: 3,7. Toyota Kijang LSX-EFI ‘01 Biru tua met BARU “HARGA” SPECIAL ALPS ELECTRIC (M) SDN. BHD Informasi Pembaca Depan Gg. Sadu Medan BR, PS, RTP, AC Dingin. Hrg. 43Jt AC, TP, VR, BR, BK DP 23 Jt, Angs: 3,2. Hub. 0813 7588 7306 - PANASONIC INTERTER - LG Jengka, Negeri Sembilan Bursa Property Bursa Nego. Hub. 0812 6477 7088 - MITSUBISHI ELECTRONIC - AUX GR : Garasi LB : Luas Bangunan SEWA - SAMSUNG - DAST ISUZU Panther Hi Grade Dijual. Ungu metalic. TOYOTA 100% BARU 5 PK & 3 PK - GENERAL - FUJI Syarat & Fasilitas: KM : Kamar Mandi LT : Luas Tanah PELUANG BISNIS FLOOR - CHANGHONG - DAIKIN KP : Kamar Pembantu RM : Ruang Makan Thn. 1994. BK Medan. AC DB, Tape, PW, PS, CL, AVANZA, RUSH, INNOVA, FORTUNER, YARIS, VIOS, ALTIS, STANDING - SHARP PLASMA CLUSTER - Umur 18 - 28 thn (berpendidikan) KT : Kamar Tidur RT : Ruang Tamu PELUANG BISNIS CAMRY, HILUX. AVANZA Dptkan Paket Lebaran Body mulus. Mesin ok. Siap pakai !!! Harga 57 Hub. 0813 7512 7297 - (061) 7795 1428 TOKO SUPER ELECTRONIC - Gaji Pokok RM 415.00 sebulan SHM: Sertifikat Hak Milik Anda butuh penghasilan tambahan Telp: 061 - 4576602 Juta/Nego!!. Hub. 0813 7085 1883 HUB: Jln. Sutomo No. 139 C (Simp Gandhi) - Elaun Makan RM 50.00 sebulan 1 DC Loyalty. Menyediakan Penghasilan TOYOTA Avanza VVTI Tipe G 2006. Tel. 7347810 - 7360741 - Elaun Kedatangan RM 50.00 sebulan RUMAH BARU DIJUAL Yang Spectakuler untuk anda. Peluang ISUZU Panther MB Thn. 95. Mobil mulus. Tel. 77982281 MEDAN Jl. Eka Warni Gedung Johor Mdn, Uk. 7,5x25m Komplit. Harga 51Jt Nego. Komplek W. Hitam, BK Medan, tangan I. Velg INSTALASI & PEMASANGAN - Elaun Syif RM 87.50 sebulan KT 3, KM 2, Gerasi, Keramik, Gipsum ini bisa untuk semua kalangan dari usia Medan Estate. No. 32. Desa Lau 16. Hub. 0816 3177 984 - 7796 7599 SERVICE, REPARASI AC - KULKAS - Lembur RM 407.50 sebulan Harga 350 Jt/nego Hub. 0813.7694.9191 20 th - 70 th. Hub. Dewi 0818 0807 6441 Dendang. Hub. 0813 9725 3351 - 0812 1843 7754 DIJUAL SALAH SATU TOYOTA Starlet GT Turbo. Gaya Drag Rac. Mesin mulus, komplit. Full GT Thn. 95. Telp. WASPADA xpress Service - Berangkat dengan Pesawat udara - LEVY (Pajak) Gratis RUMAH BARU DIJUAL CEPAT LT. 220, LB. 100, KT 3, Keramik, Carport, 1.ISUZU Panther Miyabi Long Thn. 95 AC, C. Lock, Remote, Alarm, Resing. (061) 4513640 - HP. 0857 6156 8699 - Asuransi, Transportasi & Asrama Gratis Medan Johor Hub. 0812.6542.2876 Bursa H. 43Jt Nego. KONSTRUKSI PERABOT 2.Isuzu Panther Chalenger Long TOYOTA Kijang Kapsul LSX-Diesel Dijual Informasi dan Pendaftaran, hubungi: Thn. 93/94. AC DB, V. Resing. C. Lock, Thn. 00/01 - Abu-abu Hitam met. AC, Tape, PS, WC TUMPAT, Sal. AIR, K. Mandi TUMPA RUMAH DIJUAL CEPAT SPECIALIST SOFA (REPARASI & TEMPAHAN) Remot Alarm. H. 43Jt/Nego. Mobil mulus, cantik. Hub. Dr. Dewi Hasanah. Spog. CL, VR, BR, Mobil sangat mulus. Hrg. 112Jt Damai. Hub. Rumah Makan Surya Baru Jl. Karya No. Tel. 7878078, 77008458 PT. RASTANURA RAYANI SAPUTRA Jl. Sei Sikundur No. 7 Medan K. Sofa, Makan, Kantor, Jepara, Spring bed, Ganti Kain/ Kulit + Busa, NB. Terima tukar tambah sofa 061-77572509 - 0812 63599200 90 Sei Agul. 20 Mtr Dari Simpang (4) Lampu Merah NARO SERVICE Jl. Sisingamangaraja Jl. Jend. G. Subroto Km. 4,5 No. 6 P-Q Baru, 2 Tkt, LT. 14,5x25,5m, 7 KT, Ayong 662.8642 - 0813.6153.6320 TOYOTA CORONA TWINCAM ‘91 Telp. (061) 846.1844/ 45 Medan 6 KM, Dpr 2, Ltk Strategis, Dkt MITSUBISHI L300 Dijual. BK 18 HS Satu tangan dari baru. Kondisi Tumpat Sedot Jl. Brayan Medan Medan Plaza, Harga nego TEMPAHAN MURAH Tahun 88 Solar. (Depan Univ. Panca Budi Medan) WC 0812 642 71725 mulus sekali. Hub. (061) 6878 4368 -Lemari pakaian 3 pintu Sungkai asli Rp. 1.500.000 tempahan Hub. 0812 6418 4656 - 0815 3374 8820 8442246 Telp.: Pendaftaran Setiap Hari Tanpa Seleksi Hub. 0813.6191.9366 -Kursi Sofa Kulit 3 ,2 1 pakai Spring Rp. 1.300.000 Hub Telp. (061) 6618116 - 6616802 TOYOTA Kijang Kencana ‘92 Dijual. Dash- dgn membawa copy ijazah 2 lbr dan MITSUBISHI Eterna DOHC Thn. 90 BK Mdn board sedan, Hijau met, P. Steering, AC ADI Ada Garansi Photo terbaru 4x6cm: 3 lbr DIJUAL CEPAT MURAH SPRING BED DIJUAL MURAH asli. W. Silver, Body kaleng. 90% mulus (DB). Accesories lengkap. Hrg. 52Jt/Nego. MAU PINDAH Spring Bed 6 kaki 2 lapis Rp. 1.100.000 Hub. 0812 6462 136 / 4521487 (TP) WC Rp. 37 Juta Nego. Hub. 0811 648 960 TUMPAT/ SEDOT LOWONGAN KERJA Rumah Hanya Rp. 345 Jt, Ring Road Spring Bed 5 kaki 2 lapis Rp. 1.075.000 RESMI KE MALAYSIA MITSUBISHI Lancer Dijual. Warna biru ke abu- TOYOTA Innova - G Th. ‘06. Solar, Wr n. Hitam, mbl. Cantik. Full 77442112 Dibutuhkan Tenaga Kerja Wanita untuk di pekerjakan pada perusahaan Electronic terkemuka di Malaysia. Kilang Setia Budi, Komp. Villa Malina Spring Bed 4 kaki 2 lapis Spring Bed 3 kaki 2 lapis Rp. 1.000.000 Rp. 900.000 abu-an. Lengkap. Mulus. Thn. 83/84. Hub. (061) Jl. Gatot Subroto Medan Spring Bed 3 kaki Dorong Rp. 1.000.000 7865201. Jl. Brigjend. Katamso. Gg. Sepakat SMP Accesories, Ban Baru, Kaleng2. COMPANY, bukan KONTREK, sebagai berikut: Telp. (061) 8211.488 - 7780.5813 Pembangunan No. 10 Medan. Harga Rp. 22,8 Nego. Rp. 184Jt. Jl. SM. Raja No. 200 Ada Garansi 1. WESTERN DIGITAL M SDN. BHD Garansi Per 10 tahun Hub. 061-661.8116 - 661.6802 2. SANYO AUTOMEDIA, SEBRANG PRAI Kembar Ponsel. 0812 603 85555 GRAND SETIA RESIDENCE WC Syarat-syarat pendaftaran dan seleksi: MITSUBISHI BARU Bawa Pulang L300 Angs. 3Jt-an. T 120 ss, TOYOTA Kijang Minibus Thn. 1989. Mulus, ANDA TUMPAT - SEDOT 1. Wanita Umur 18 s/d 30 tahun 2. Pendidikan minimal SMP sederajat 3. Membawa Fotocopy Ijazah, KTP, Kartu Keluarga Type 45, 54 dan 70 Anda Butuh Perabot Colt 110, 125 PS, Pajero Sport, L200,... Serius Hub. (061) 76728071 / 0812 653 3319 siap pakai RP. 34 Jt Nego. HP. 7640 4820 Hub. 8219951 (asli di bawa sewaktu interview) 4. Membawa phas photo warna 3x4: 3 lbr Lokasi Bandar Setia ± 3 Km Jepara Asli? Jl. HM. Joni / Doorsmeer Maju Jaya. Jl. Setia Budi No. 2 A. RINCIAN GAJI dari Unimed/ IAIN Hub. MITSUBISHI Colt Diesel Box 4 Roda Th. ‘08. Akhir. Mbl sehat, siap pakai. Cash TOYOTA Kijang Commando ‘88. Long, AC, VR, BR, PW. H. 42Jt Bursa 1. WESTERN DIGITAL (M) SDN. BHD - Gaji Pokok - Tunjangan kehadiran - Tunjangan shift : RM 450/ bln : RM 50/ bln : RM 107/ bln 0852.9715.1991 - (061) 7790.4287 MALIOBORO PERABOT Rp. 185Jt. Blk. Dp. 65Jt. Sdh. Byr. 9x Nego. Hub. 0813 9725 3351 PENDIDIKAN - Tunjangan makan : RM 16,50/ bln RUMAH DIJUAL Hubungi: Jl. Bilal No. 90 P. Brayan Medan Rp. 5.343 Rb, Sisa 27 Bln. Kembar Mobil. - Tunjangan lainnya : RM 57 - RM 78/ bln LT. 236m2, LB. 98m2, SHM, Listrik - Bonus: Bonus Prestasi dan tahunan Telephone Toko : 661.6285 Jl. Tritura No. 8 K - 0812 6058 6666 TOYOTA Innova Th. ‘04. Warna biru, 2. SANYO AUTOMEDIA SDN. BHD 900 watt, PDAM, Telepon, Lok. MERCY Boxer 200 Thn. 87/88. EL. V. Bensin. AC DB. TV, Tape, Power POLTEKKES Dr. RUSDI - Gaji Pokok - Tunjangan Kehadiran : RM 400/ bulan : RM 40/ bulan Perm. Villa Belibis Blok C Rumah : 661.1540 Fax : 661.6285 (061) Window, Central Lock. Velg Racing. PRODI D-IV FISIOTERAPI - Tunjangan Berdiri : RM 1/ hari Jl. K.L. Yos Sudarso depan SMA Sun Roof. Silver, BK Medan, ex Rp. 156 Jt. Jl. SM. Raja No. 200 - - Bonus - Tunjangan Makan : RM 40/ bulan : RM 0.50/ hari No. 8 & No. 9, Harga nego, Negeri 1 Tebing Tinggi mutasi Rp. 42Jt. Hub. 77863981 Kembar Ponsel . 0811 613 107 Berdiri Sejak 1987-Terakreditasi - Tunjangan di bagian Mesin : RM 60/bulan Dapat di KPR kan Telp. (0621) 24243 Yang Pertama dan Satu-satunya di SUMATERA - Tunjangan Makan (waktu Lembur/ Overtime): a. 2 Jam atau Lebih: RM 1.50, B. 4 Jam atau lebih: RM 2.50 Hub. 0813.6161.6353 - 0812.6341.5144 - Tunjangan Shift: a. Petang: RM 3, b. Malam (8 Jam): PROGRAM STUDI SARJANA SAINS RM 8, c. Malam (12 Jam): RM 10 0813.7086.2699 TERAPAN FISIOTERAPI (SST. Ft) B. FASILITAS - Levy subsidy 100% (061) 7626.1884 - (061) 7758.9358 FD Bertujuan Menciptakan Tenaga Ahli - Asrama, tiket pulang, kemudahan kesehatan, asuransi, Physioterapi Profesional berangkat naik pesawat terbang - Bagi yang tidak mampu dapat mencicil biaya RUMAH SEGERA DIJUAL YANG PERTAMA DAN SATU-SATUNYA pemberangkatan C. JADWAL PENDAFTARAN/ SELEKSI: LB. 200m (8 Kamar) Halaman Luas CD - Setiap Hari Kerja LT. 17x58m: 968m Menerima Mahasiswa/i Baru T.A. 2009/2010 C. Untuk Perusahaan Sanyo Automedia boleh yang SK Camat ANGKATAN PERTAMA Pendaftaran s/d 25 September 2009 mantan/ eks TKI Sanyo Prai dan Bayan Lepas “SELEKSI DILAKSANAKAN SETIAP HARI KERJA” Segera daftarkan diri anda sekarang juga ke: Jl. Sunggal No. 205 Medan KIRIMKAN... (± 500 meter sebelum Ring Road) Uji Tulis: Tgl. 26 September 2009 PT. MUTIARA KARYA MITRA SIUP NO: 629/MEN/2006 JL. KAPTEN MUSLIM NO. 89 C MEDAN Hubungi: 0811.606.962 - DATA IKLAN ANDA Informasi/ Pendaftaran: Jl. H. Adam Malik No. 140-142 Telp. (061) 661.4941 TELP: (061) 845.2956 (DEKAT RSU SARI MUTIARA) Contact Person: Mega 0813.6220.2213, Ecy: 0813.7515.5055 0819.604.6777 DALAM BENTUK CP: 0812.6520.5614 - 0819.824.289 - 0813.6220.5812 LOWONGAN KERJA LANGSUNG (COMPANY) DI PERUSAHAAN ELEKTRONIK DI RUMAH DIJUAL Jl. Sembada VI No. 17 Kel. Padang Bulan Selayang II, Kec. Medan DIGITAL SEKOLAH TINGGI PENANG - MALAYSIA TPC (MALAYSIA) SDN. BHD Bayan Lepas - Tuntungan, Medan, LT. 300m2, LB. 213m2, Lantai 2, SHM, Fas. Listrik Keterangan lebih lengkap silahkan 1300 Watt, Air PDAM, Telephon hubungi: TEKNOLOGI IMMANUEL Penang, memberikan kesempatan kerja langsung (Company) dengan persyaratan: - Wanita, umur 18 s/d 30 tahun Harga nego Hub. 0813.6161.6353 0812.6341.5144 - 0813.7086.2699 TELPON : 061 - 4576602 MEDAN (S1) - Tamat SMA/ sederajat (belum menikah) - Mendapat izin orang tua/ Wali - Lulus seleksi dan Test kesehatan (061) 7626.1884 - (061) 7758.9358 FAX : 061 - 4561347 Menerima - Bersedia kontrak kerja minimal 2 tahun TANAH * Format: JPG - TIFF (Photoshop) - Terbuka untuk mantan Mahasiswa Baru/ Pindahan FASILITAS: TANAH DIJUAL Uk. 30x20m di Jl. Pintu Air IV/ - Gaji Pokok RM 450/ bulan T.A. 2009/ 2010 - Tunjangan Shift Pagi RM 1/ hari Gg. Inpres arah Simalingkar B Mau Menjual Kwala Bekala Mdn Johor TERAKREDITASI - Tunjangan Shift Petang RM 3/ hari Hub. 0856.9234.0000 Nego Rumah, Tanah, - Tunjangan Shift Malam RM 8/ hari NO: 012/BAN-PT/AK-X/51/VI/2007 - Tunjangan Kedatangan RM 30/ bulan TANAH DIJUAL Kendaraan, Barang - Tunjangan Makan RM 40/ bulan Luas ± 10.000m2 (SHM), Lokasi 300m PROGRAM STUDI: - Tunjangan Target RM 50/ bulan Dibelakang Kantor Walikota Tanjung Balai Asahan, Cocok buat perumahan atau kantor Kerajinan Tangan atau Barang - Tunjangan Training (3 bulan) RM 100/ bulan Yang ber minat dapat menghubungi: 1.TEKNIK MESIN (S1) - Tunjangan Khas (Jika Kerja 12 jam) RM 25/ bulan HP. 0813.7034.7690 - 0812.6524.6331 Dan (061) 7734.9075 Dagangan Lain? 2.TEKNIK ELEKTRO (S1) - Tunjangan Prestasi RM 50 - RM 200/ bulan P. SIDEMPUAN DIJUAL - Levy disubsidi 100% oleh Majikan (Gratis) Tanah & Bangunan, Luas Tanah Ya Tentu...Pasang Iklan di... SARANA PRAKTEK TERLENGKAP - Asrama & Fasiltiasnya, Transportasi dan Asuransi disediakan 21x40m2, (SHM) di Jl. BPDN Informasi dan Pendaftaran - Berangkat dengan pesawat terbang No. 4 P. Sidempuan (Sadabuan) Surat Kabar Tercinta: * Pendaftaran setiap hari kerja, Senin s/d Hub. 0812.6403.555 KAMPUS Sabtu (jam 08.00-17.00) (Pemilik langsung) Harian Jl. Gatot Subroto No. 325 Medan Telp. 456.9548 - 457.3158 Dengan membawa: Copy KTP, Pasphoto 3x4: 2 lembar, Copy Ijazah, Copy KTP orang tua/ yang memberi TANAH DIJUAL LT. 984m2, SK Camat Jl. Pinus Sudut WASPADA izin, Copy Kartu Rumah Tangga Fax. 415.4154 Untuk pendaftaran datang langsung ke: Jl. Perwakilan Kel. Pulo Brayan Untuk informasi PT. AL WIHDAH JAYA SENTOSA Bengkel Baru Kec. Medan Timur, lebih lengkap hub Jl. Setia Budi No. 74 C Tanjung Rejo Medan, Harga nego Jl. Jend. Gatot Subroto No. 198-A Tel. (061) 415 5678 - medan MINI & EFEKTIF (sebelah Showroom Yamaha, dekat Simpang Jl. Sei Serayu) Hub. 0813.6161.6353 - 0812.6341.51144 0813.7086.2699 TEL. (061) 4576602 Jl. IR. H. juanda no. 29 - 31 Tel. (061) 7350 777 - MEDAN Jl. Sei Batang Hari No. 6 Telp (061) 4555 928 Medan IKLANKAN PRODUK ANDA Medan 20122 Telp. (061) 821.5444 (Hunting) (061) 7626.1884 - (061) 7758.9358 FAX. (061) 4561347
  • 15. Ekonomi & Bisnis 15 WASPADA Selasa 1 September 2009 Pertumbuhan Ekonomi 2010 Harga Kebutuhan Lebaran Naik, Defisit Tetap Melonjak 50 Persen JAKARTA (Waspada): Plt Menko Perekonomian/Menteri MEDAN (Waspada): Harga tuk anak-anak ukuran usia Keuangan (Menkeu) Sri Mulyani Indrawati menyatakan defisit barang kebutuhan lebaran se- tersebut juga mengalami ke- RAPBN 2010 tidak akan mengalami perubahan meski pertum- perti pakaian, sepatu dan ber- naikan cukup tajam, bila ta- buhan ekonomi akan mengalami kenaikan. bagai kebutuhan rumah tang- hun lalu baju jenis gaun dijual “Defisit RAPBN 2010 sampai sekarang tidak ada perubahan,” ga lainnya khususnya non pa- Rp50 ribu saat ini harganya kata Menkeu di Gedung Utama Departemen Keuangan Jakarta, ngan melonjak hingga hingga sampai 100 ribu lebih, sedang- Senin (31/8). RAPBN 2010 menetapkan defisit sebesar 1,6 persen 50 persen. kan jenis kaus Rp50 ribu, se- dari produk domestik bruto (PDB) atau nominalnya Rp98 triliun. Lonjakan harga tersebut butnya. Menkeu juga menyebutkan, rencana pembiayaan terhadap didominasi oleh barang kebu- Naiknya harga pakaian defisit itu akan tetap sama dengan usulan awalnya. tuhan jenis pakaian untuk ke- anak-anak disamping me- “Sama, tidak ada perubahan,” katanya. butuhan anak-anak dan orang ningkatnya kebutuhan masya- Menkeu mengakui, dengan adanya kenaikan pertumbuhan dewasa khususnya wanita, se- rakat luas secara serentak ekonomi dalam RAPBN 2010 dari 5,0 menjadi 5,5 persen maka telah itu diikuti naiknya harga menjelang lebaran, juga akibat akan ada peningkatan penerimaan negara. barang aksesoris rumah tang- lemahnya produk lokal dijual “Penerimaan negara dari pajak penghasilan (PPh) pasti ga seperti horden dan lainnya. murah dalam merebut pangsa naik, pajak pertambahan nilai (PPN) juga pasti naik, lalu PPh Menurut Henny, pedagang pasar, ujarnya. Migas karena asumsi harga minyak juga naik,” katanya. pakaian di lantai II Pasar Pe- Akibatnya produk impor Dia menyebutkan dengan kenaikan asumsi harga minyak tisah Medan, kenaikan harga dari China dijual dengan harga dari 60 menjadi 65 dolar AS per barel maka penerimaan PPh sangat didominasi pakaian lebih tinggi lebih dibanding Migas juga akan naik. “Pembahasan sampai sekarang seperti anak-anak khusus wanita se- produk lokal lebih mendomi- itu, kalau itu diterima maka akan berimplikasi kepada PPh,PPh hingga untuk satu pasang nasi barang dagangan peda- non migas, PPh migas, dan PPN. gaun berikut perlengkapannya gang, sehingga para konsu- Sebelumnya RAPBN 2010 menetapkan pertumbuhan eko- menghabiskan biaya hampir men lebih banyak ditawarkan nomi 2010 sebesar 5,0 persen. Pertumbuhan itu akan bersumber Rp150 ribu. barang impor, imbuhnya. dari konsumsi masyarakat 5,1 persen, konsumsi pemerintah Sementara itu harga cela- Budi pedagang horden di 6 persen, investasi 8,5 persen, dan ekspor-impor masing-masing na pendek dan rok mini untuk Pusat Pasar mengatakan harga 4,1 dan 6,9 persen. anak usia satu tahun hingga barang aksesoris rumah tang- Pemerintah akan terus berupaya melakukan berbagai lima tahun lalu masih rata-rata ga saat ini mengalami kenai- langkah untuk meningkatkan target pertumbuhan ekonomi Rp35 ribu per potong, saat ini kan akibat naiknya harga ba- seperti mendorong pertumbuhan konsumsi masyarakat dan naik menjadi Rp50 ribu hingga han tekstil , namun kenaikan pemerintah dan mendorong realisasi penyerapan anggaran. MULAI NAIK: Seorang ibu memilih telur sebagai menu berbuka puasa sore harinya di Pasar Peringgan Medan, Senin Rp60 ribu per potong, tutur- tersebut tidak terlalu tinggi Untuk meningkatkan pertumbuhan investasi akan (31/8). Sejumlah kebutuhan pokok mulai merangkak naik di sejumlah Pasar di medan. Harga telur dijual Rp900 hingga nya. hanya berkisar 20 persen di- diperbaiki iklim investasi, pemulihan ekspansi kredit perbankan, Rp1.000 per butir. Sedangkan harga baju un- banding tahun lalu.(m40) dan percepatan pembangunan infrastruktur. Rupiah Turun Ke 10.085 Per Dolar DPR Tolak Kenaikan Harga Raskin JAKARTA (Waspada): Komisi IV DPR-RI menolak rencana pemerintah menaikkan harga beras miskin (raskin) atau beras Inggeris Desak UE Perbanyak JAKARTA (Antara): Rupiah di pasar uang spot antarbank Jakarta Senin (31/8) sore me- per dolar. Minimnya faktor positif dari dalam negeri dan berlan- bersubsidi (rasdi) dari Rp1.600 per kg menjadi Rp2.150 per kg pada 2010. Kenaikan ini dipastikan akan memberatkan daya beli kalangan keluarga miskin. “Kita hanya setuju Rp1.600 per kg,” tegas Anggota Komisi Reformasi Keuangan lemah ke kisaran 10.085/ 10.100 per dolar AS. Melemahnya bursa regio- nal merupakan faktor utama jutnya sentimen negatif dari luar akan kembali menekan rupiah di pasar, katanya. Dia mengatakan rupiah IV DPR RI Elviana dalam acara RDP di Komisi IV DPR-RI, Senin LO N D O N ( A n t a r a ) : minggu ini di London, sebe- kan, dana tambahan dari Ing- matkan mereka untuk tu- yang menekan rupiah di pasar sebenarnya masih mencari (31/8). Dia mengungkapkan, pada rapat dengar penda-pat Menteri keuangan Inggeris lum pertemuan puncak eko- geris, untuk membantu IMF juan. Tujuan itu adalah untuk lokal, setelah pada sesi pagi titik keseimbangan baru (equi- dengan Bulog sebelumnya, rencana kenaikan raskin telah pada Senin (31/8) mendesak nomi-ekonomi terbesar di du- membantu negara-negara men-dapatkan kredit sempat menguat, kata Direk- librium). Jadi pergerakannya disampaikan pemerintah yaitu hingga Rp 2.000 per kg. Namun negara Uni Eropa untuk me- nia pada September di Pitts- berpenghasilan rendah pulih kembali, bu-kan untuk dana tur Retail Banking PT Bank kadang naik atau turun ter- kenyataanya rencana kenaikan itu justru lebih besar dari ningkatkan sumber daya burgh, yang akan membahas dari krisis, akan diumumkan imbalan bagi risiko yang Mega Tbk, Kostaman Thayib, gantung dari sentimen yang perkiraan awal yang justru mencapai Rp 2150 per kg. IMF guna membantu pere- isu bonus bankir. hari Selasa. berlebihan yang di Jakarta Senin. masuk ke pasar. “Ini tsunami bagi orang miskin di 2010, apalagi BLT (Ban- konomian dunia yang ra- Menulis di Guardian, Dar- Darling mengatakan dia mengakibatkan konsekuensi Kostaman Thayib menga- Meski demikian peluang tuan Langsung Tunai) dicabut, harga beras naik,” tegasnya. puh, dan mengatakan Ing- ling mengatakan para pemim- masih berharap Inggeris - sa- buruk seperti itu.” takan, koreksi harga yang ter- untuk menguat masih ada, ka- Beberapa anggota komisi IV lainnya menyatakan hal serupa. geris berjanji akan menai- pin dunia G-20 dalam perte- lah satu penderita dari resesi “Bankir lupa bahwa me- jadi terhadap rupiah dinilai rena dari faktor internal, ru- Harga raskin tahun ini masih Rp1.600 per kg dianggap sudah kan dana ekstra hingga 11 muan di London pada bulan terburuk dalam dekade - un- reka bahaya.” wajar karena sentimen negatif piah masih mendapat duku- sangat memberatkan kalangan orang miskin, apalagi dinaikan miliar dolar AS. April telah menyepakati untuk tuk kembali ke pertumbuhan Pengambilan risiko ber- dari bursa regional cukup be- ngan dari fundamental makro menjadi Rp2.150 per kg. Alistair Darling juga me- meningkatkan sumber daya “pergantian putaran tahun”. lebihan, akibat bonus besar sar. Sentimen pasar cukup ku- ekonomi nasionl yang cukup Dalam rencana anggaran 2010 jumlah rumah tangga sasaran ngatakan tidak boleh “refor- pinjaman yang tersedia di Da- Tapi risiko ekonomi glo- bagi para bankir, telah disa- at terutama dari bursa China baik. raskin sebanyak 17,5 juta RTS dengan alokasi beras sebanyak masi sektor sektor keuangan na Moneter Internasional bal tetap ada, dan “Inggeris lahkan membantu memicu dan bursa Korea Selatan yang Pengamat pasar uang PT 15 kg/bulan/RTS durasi selama 12 bulan. terhenti” di tengah krisis glo- (IMF) menjadi 750 miliar dolar akan terus memimpin aksi krisis keuangan global yang mengalami penurunan cukup Makinta Securities, Harry Kur- Sedangkan untuk rencana harga jual raskin Rp2.150 per bal, termasuk pada masalah AS (460 miliar poundsterling, interna-sional” untuk mengarah ke talangan pe- tajam, katanya. niawan, mengatakan, rupiah kg, atau hanya 43 persen dari harga pasar untuk jenis beras kontroversial gaji dan struk- 524 miliar euro). membantu me-ngamankan merintah multi-miliar dolar Menurut dia, apabila bursa masih bisa menguat mende- IR III yang saat ini Rp5.000 per kg. Jika dibandingkan dengan tur bonus untuk eksekutif. “Negara-negara Uni Eropa pemulihan, ka-tanya. “Juga bagi bank-bank di dunia. regional masih melemah, ma- kati angka 10.000 per dolar ka- tahun 1998 lalu harga harga jualnya justru telah mencapai 50 Komentar Darling da- telah sepakat untuk menye- tidak ada yang membiarkan Meski memberikan te- ka pergerakan mata uang In- rena persepsi pasar terhadap persen dimana harga tebusnya Rp1.000 per kg dengan harga tang menjelang pertemuan diakan 100 miliar dolar AS (un- reformasi sektor keuangan puk tangan atas kesepaka- donesia akan terus melemah perekonomian Indonesia cu- pasar pada waktu itu sebesar Rp2.000 per kg.(dtc) menteri keuangan G-20 tuk IMF),” Darling mengata- terhenti. Setiap ne-gara harus tan antara Inggeris dan Lie- hingga melewati angka 10.100 kup bagus. kan di surat kabar. terus menempat-kan bank chtenstein, Darling menga- Bursa TERAPI SITAWAR-SIDINGIN MENGOBATI PISIK DAN PISIKIS “Tapi Eropa harus mem- pada pijakan yang sehat,” takan juga lebih perlu dila- MATERIAL BANGUNAN ATAP & DINDING EURODEK Penyakit lumpuh/ strok, kaku melangkah, kaki bengkak, sudah buang air kecil & beri contoh dan berbuat lebih banyak untuk memenuhi tar- katanya. “Memulihkan keperca- kukan untuk menekan pem- bebasan pajak. Produksi Minyak Agustus ALUMINIUM ZINC - AZ - 150 air besar Pria/ wanita, sesak nafas, darah tinggi, sakit pula pening/ migren, asam urat, perut keras, sakit tenggorokan dll. get, melalui komitmen kenai- yaan publik, serta menjamin Liechtenstein mengang- Di Bawah Target kan menjadi 175 miliar dolar stabilitas masa depan sektor, kat gerbang benteng pem- Gangguan kejiwaan, perbuatan orang JAKARTA (Waspada): Rata-rata produksi minyak nasional & orang halus. cara pandang tajam, AS - dengan Inggeris siap me- mengharuskan kita untuk bebasan pajaknya awal bulan bicara-bicara sendiri, selalu merasa hingga akhir bulan Agustus 2009 mencapai 949.451 barel per nyediakan tambahan hingga melangkah lebih jauh pada ini, membuat kesepakatan takut, dll hari (bph) berarti di bawah target APBN 2009 sebesar 960 ribu Hub. PAK JALAL (0852.9724.9457) 11 miliar dolar AS, dengan total gaji dan bonus.” memungkinkan Inggeris PAGAR EURO R bph. Sementara untuk produksi gas bumi sudah mencapai Alamat: Jl. Ikhwanul Muslimin Lr. Ikhlas kontribusi kami lebih dari 26 Dia menambahkan: “Bank untuk menjerat sekitar 5.000 GALVANIS No. 3 Paya Geli masuk galon Gg. Jadi 7,8 miliar kaki kubik per hari. Atau Gg. Damai depan Asrama Abd. miliar dolar AS.” harus menyadari, pembayar pemegang rekening Inggeris “Kami berharap lapangan-lapangan baru dari Mobil Cepu, Hamid Jl. Binjai Km. 10 The Guardian mengata- pajak datang untuk menyela- sampai dengan 3,0 miliar BP tangguh, Duri Chevron Pacific Indonesia dan Medco Malaka pound dalam deposito dira- akan bisa membantu produksi di akhir tahun 2009,” ujar Kepala hasiakan. BP Migas R.Priyono dalam Rapat Dengar Pendapat dengan EUROMESH BAJA U-50 R KOLOM PRAKTIS EURO R BUMN Jangan Kuasai Komisi VII DPR, Jakarta, Senin (31/8). Sementara untuk realisasi lifting minyak sampai data minggu ketiga Agustus 2009 sebesar 939.360 bph, dimana stok minyak BAJA U-50 - SIAP PAKAI - LEBIH PRAKTIS & HEMAT - DARI BESI BETON Harian Proyek Infrastruktur mentah milik pemerintah saat ini mencapai 12 juta barel. Rendahnya realisasi lifting tersebut, lanjut Priyono, dian- taranya disebabkan kilang Cilacap mengalami kerusakan, WASPADA PRODUKSI: JAKARTA (Antara): Penga- Latif menyayangkan, pro- termasuk Indonesia. Hal sehingga lifting tidak bisa dilakukan sesuai jadwal. Selain itu, PT. REZEKI PRIMA JAYA ABADI mat dan praktisi menilai Ba- gram public private partner- inilah mendorong peme- faktor Cuaca di laut juga menyebabkan tidak bisa lakukan lifting Jl. Sutomo No. 436 Medan 20231 dan Usaha Milik Negara (BU- ship dicanangkan pemerintah rintah melalui Kementerian sesuai jadwal. (samping Bank Maspion) Telp. (061) 452.2588 - 415.7504 - 455.7204 - 455.71494 Tempat Iklan Anda MN) kini cenderung melaku- belum dilengkapi petunjuk Negara PPN/Bappenas Untuk produksi gas bumi hingga bulan Agustus sudah men- Fax. (061) 415.7504 SUMUT - INDONESIA kan penguasaan (kooptasi) pe- pelaksanaannya di lapangan, membentuk Pusat Kerjasa- capai 7,8 miliar kaki kubik per hari dari target produksi gas Hub. 4576602 kerjaan proyek-proyek pem- bangunan infrastruktur di sehingga menimbulkan ke- cenderungan BUMN meng- ma Pemerintah dan Swasta (PKPS) atau private public pemerintah tahun ini sebesar 7,256 miliar kaki kubik per hari. “Diharapkan produksinya bisa meningkat lagi dari produksi Bursa daerah sehingga membuat pe- kooptasi pembangunan in- partnership (PPP). lapangan Oyong milik Santos, BP Tangguh dan ConocoPhillips,” PENGOBATAN rusahaan swasta (kontraktor) frastruktur berskala besar di Contoh kasus pemba- jelasnya. Pada kesempatan sama, Priyono memaparkan, pene- nasional kesulitan mendapat- berbagai daerah. ngunan bandar udara Kuala rimaan negara dari sektor hulu migas pada semester I-2009 PENGOBATAN URAT SYARAF DAN KANKER PENGALAMAN DALAM DAN LUAR NEGERI kan pekerjaan. “Ini memunculkan kesan Namu di Medan yang bela- sebesar Rp7,58 miliar atau 120,3 persen dari rencana APBN TERKILIR, LEHER TENGENG, TANGAN TDK BISA “Ini menunjukkan pro- perusahaan kontraktor BUMN kangan ini sempat ramai, semester I-2009 yang sebesar 6,3 miliar dolar AS. DIANGKAT, PINCANG, LUMPUH, LUTUT SAKIT, BISU, TUMOR, KANKER DAN KEBATINAN, TERAPI URAT gram kemitraan swasta de- ‘serakah’ karena tidak melibat- ternyata semua pekerjaan- “Penerimaan itu terdiri dari kegiatan hulu minyak bumi SYARAF RP. 100.000/TERAPI. BISA DIPANGGIL ATAU DATANG LANGSUNG KE: HarianWASPADA ngan pemerintah (public pri- kan perusahaan swasta nasio- nya ditangani kontraktor sebesar 4,74 miliar dolar AS dan kegiatan hulu gas bumi sebesar JL. KELUARGA GG. RUKUN (DEPAN SMPN30) Tempat Iklan Anda vate partnership) tidak berja- nal sebagai mitra bersama BUMN seperti Pembangu- 2,84 miliar dolar AS,” katanya. Menurut Priyono, penyebab ASAMKUMBANG - MEDAN HP. 0813.6101.3680 lan sebagaimana mestinya da- (joint operation) dalam pem- nan Perumahan (PP), Was- meningkatnya penerimaan negara dari sektor hulu migas yaitu lam mempercepat pemba- bangunan infrastruktur dida- kita Karya, Adi Karya, Hu- harga minyak ICP aktual lebih tinggi yaitu sebesar 51,12 dolar Pengobatan Alat Vital H. Suhendar Besar dan panjang di tempat Klinik H. Suhendar di bawah ngunan infrastruktur di da- erah,” kata pengamat ekonomi dari Lembaga Ilmu Pengeta- huan Indonesia (LIPI), Latif nai APBN,”tambahnya. Dia mengatakan percepa- tan pembangunan infrastruk- tur kini menjadi isu penting tama Karya dan Nidya Kar- ya. Begitu pula proyek Banjir Kanal Timur (BKT) di Jakarta melibatkan kontraktor AS per barel dari patokan harga ICP di APBN 2009 sebesar 45 dolar AS per barel. Sementara untuk biaya investasi dan operasi yang dibelanjakan bagi kegiatan hulu migas semester I-2009 mencapai 5,3 miliar dolar AS atau 70 persen dari target rencana Kerja dan Adam, di Jakarta Senin (31/8). bagi hampir semua negara BUMN tersebut. anggaran (RKA) semester I-2009 sebesar 7,6 miliar dolar AS. Tidak ada hasil, Mahar kembali kontrol dan pengawasan langsung Ditangani secara profesional H. SUHENDAR Alami bukan suntik, menggunakan metode terapi dan ramuan tradisional, Diberitahukan kepada masyarakat Paling aman tidak ada efek samping untuk berhati-hati terhadap pengobatan H. Suhendar sudah di kenal sebagai pakar sejenis yang mengaku-ngaku kerabat kejantanan yang sudah berpengalaman, atau saudara, soal cara boleh sama sanggup mengatasi keluhan alat vital khusus tapi keahlian yang membedakan pria, memperbesar, memperpanjang (garansi), meningkatkan Untuk keluhan dan pengaduan silahkan HarianWASPADA kekerasan, tambah Mahar Rp. 500 ribu hubungi langsung: kuat dan tahan lama H. SUHENDAR HP. 0812.131.6364 Tempat Iklan Anda dalam berhubungan Jl. Tempuling No. 43 B - Serdang (masuk Gg. Sado) Medan Telp. (061) 663.4220 Saksikan !!! Interaktif bersama Bpk. H. SUHENDAR di TVRI Nasional Medan. Setiap Sabtu Malam Minggu Pukul 20.00 WIB Seorang pedagang parfum non alkohol sedang menunggu pembeli di kawasan Masjid Raya Al-Mashun, Medan, Senin (31/8). Parfum yang biasanya digunakan sebagian umat muslim yang akan melaksanakan shalat itu dipasarkan dengan harga yang Jangan Lewatkan Interaktif langsung variatif, dari Rp 5.000 dengan PASAK BUMI di DELI TV Tgl. 29 hingga Rp 25.000 itu Agustus ‘09 Pkl. 22.30 Wib (Live) tergantung ukuran Call Center: 0818 090 73481 botol.
  • 16. 16 Ekonomi & Bisnis WASPADA Selasa 1 September 2009 Harga Gula Nasional Capai Rp9.981 JAKARTA (Waspada): Ke- Sebagaimana diketahui “Masalah SNI, maka se- Rp790 per kg sedangkan untuk melut lonjakan harga gula harga gula selama beberap bu- baiknya pemberlakuannya raw suga hanya Rp550 per kg. konsumsi di dalam negeri be- lan terakhir terus merangkak ditunda,” kata Ketua Umum Sehingga dengan demikian lum menunjukan tanda-tanda naik, bebepa analisa bermun- Forum Industri Pengguna Gu- proses impor gula rafinasi bisa ke arah penurunan. Berda- culan mulai dari terpengaruh la (FIPG) Franky Sibarani da- berjalan secara lancar. sarkan data harian laporan dari harga internasional, faktor lam acara konferensi pers di “Sudah ada 2-3 perusaha- pemantauan harga kebutu- spekulan gula di dalam negeri, Departemen Perindustrian Se- an lagi, kalau September ini han pokok Departemen Per- terserap oleh industri dalam nin (31/8). diberikan IT maka Oktober su- dagangan per 31 Agustus negeri dan sebagainya. Dia mengatakan penera- dah bisa masuk gula rafinasi,” 2009, harga gula nasional Sampai saat ini pemerin- pan SNI saat ini secara tidak terangnya. tembus Rp 9.981 per kg. tah belum melakukan tinda- langsung telah menghambat Dia mengatakan dari ke- Angka itu mengalami ke- kan nyata dalam meredam proses penyerapan gula rafi- butuhan gula rafinasi dalam naikan dibandingkan de- harga gula di dalam negeri, nasi impor yang menurutnya negeri intuk industri saat ini ngan harga tanggal 28 Agus- bahkan rapat koordinasi khu- secara kualitas lebih baik dari yang mencapai 2,1 juta ton tus 2009 yang hanya Rp 9.831 sus mengenai gula sampai saat produk rafinasi dalam negeri. hanya dipenuhi oleh produksi per kg atau naik Rp 150 per ini belum dilakukan oleh Men- Rekomendasi impor gula rafi- dalam negeri hanya 1,5 juta kg. Sedangkan untuk harga ko Perekonomian. nasi sampai September hanya ton dari industri dalam negeri rata-rata bulan Agustus 2009 90.000 ton saja. dan kuota impor sebanyak tembus mencapai Rp 9.028 Gula rafinasi “Impornya masih 50.000 380.000 ton, masih jauh dari per kg atau mengalami ke- Para industri makanan dan ton sampai Agustus, karena kebutuhan. naikan Rp 560 per kg dari minuman mengeluhkan ter- masih banyaknya hambatan Kondisi kekurangan ini harga rata-rata bulan Juli sendatnya daya serap kuota impor,” terangnya. berpeluang terjadi penyimpa- Waspada/Surya Efendi 2009 yang hanya Rp 8468 per impor gula rafinasi yang saat Dia mengatakan sudah se- ngan-penyimpangan terma- GULA MEROKET: Seorang pedagang memasukkan gula ke dalam plastik pesanan konsumen di Pasar Peringgan Medan, kg. ini hanya terserap 90.000 ton harusnya pemerintah untuk suk dugaan-dugaan penggu- Senin (31/8). Menjelang lebaran, harga gula dipasaran terus meroket mencapai Rp10 ribu per kg dari Rp8.000 per kg. “Harga tertinggi terjadi dari kuota sebanyak 380.000 membuka kran impor gula naan gula konsumsi umum di Manokwari Rp 12.000 per ton tahun 2009. Pelaku industri rafinasi selebar-lebarnya ter- oleh industri kecil menengah kg, terendah terjadi di Mana- mendesak agar pemerintah masuk menunda penerapan yang menjadi kambing hitam BI Proses Izin 10 BPR Sumut-Aceh do Rp 9250 per kg,” jelas lapo- ran harga Depdag yang dipe- roleh Senin (31/8). mencabut sementara SNI wa- jib gula rafinasi dan meminta tambahan impor gula rafinasi. SNI wajib, menghapus atau mengurangi biasa masuk gula rafinasi yang saat ini mencapai naiknya harga gula konsumsi umum beberapa bulan ter- akhir. (dtc) MEDAN (Antara): Seba- Minat cukup tinggi untuk jumlah Rp500 juta serta sebe- dari posisi 2008 yang masih nyak 10 Bank Perkreditan Rak- mendirikan BPR/BPRS di Su- lumnya sudah berbentuk per- Rp380 miliar, sedangkan DPR Tuding BI Penyebab yat (BPR) dan BPR Syariah (BP- mut dan Aceh itu, kata dia, seroan terbatas (PT), koperasi DPK sudah Rp390 miliar dari RS) di Sumut dan Nanggroe sudah seyogianya melihat ma- atau perusahaan daerah. 2008 yang Rp350 miliar. Ada- Aceh Darussalam dewasa ini sih besarnya peluang untuk “Standar pendirian BPR/ pun aset sudah Rp530 miliar. sedang dalam proses perizi- usaha itu menyusul bertam- BPRS sudah baku dimana se- Mengenai besaran kredit nan operasional menyusul 59 BPR yang sudah beroperasi selama ini. bahnya terus daerah peme- karan. “Harusnya jumlah investor mua persyaratan harus dipe- nuhi karena diperlukan untuk keamanan nasabah,” katanya. bermasalah, dia mengakui, lebih tinggi dari bank umum atau mencapai 7,75 persen Kejatuhan Bank Century “Ada 10 BPR/BPRS yang BPR/BPRS itu lebih banyak Secara umum, kondisi BPR pada posisi Juli. Menurut Dradjad jika BI berharap investigasi bisa lebih lumnya. JK tetap bersikukuh izinnya sedang dalam proses lagi karena peluangnya masih di Sumut cukup bagus dengan “Meski naik dibanding- bisa bertindak cepat menye- cepat lagi dengan adanya KPK dirinya tidak diberi tahu soal dimana tujuh merupakan BP- sangat besar,” katanya. adanya pertumbuhan penya- kan posisi Desember 2008 lesaikan permasalahan ini, yang masuk,” tandasnya. bailout Bank Century yang kini RS dan tiga lainnya BPR,” kata Persyaratan untuk mendi- luran kredit maupun peng- yang sebesar 7,26 persen, ta- maka kasus Bank Century “Ini adalah uang negara, sudah membengkak hingga Kabid Moneter dan Ekonomi rikan BPR antara lain adanya himpunan dana pihak ketiga pi dibandingkan posisi Maret tidak akan sebesar ini dan jadi janggal kalau tidak dila- Rp6,7 triliun. Bank Indonesia (BI) Medan, modal setor untuk di wilayah (DPK). yang sebesar 7,95 persen, dana yang dikeluarkan tidak porkan kepada DPR,” tegasnya Yang pasti, dalam perte- Maurids Damanik, di Medan, Kota Medan sebesar Rp1 miliar Kredit disalurkan 59 BPR NPL per Juli itu ada penuru- mencapai Rp6,7 triliun. lagi. muan sebelumnya antara Senin (31/8). dan untuk di luar Medan se- misalnya sudah Rp400 miliar nan sedikit,” katanya. Pihak LPS, dikatakan Wakil Presiden Jusuf Kalla Menkeu Sri Mulyani dan Gu- Dradjad tidak memberikan menilai masalah membelit bernur BI yang ketika itu dija- Bunga BRI Lebih Rendah Dari Pasar JAKARTA ( Waspada): Bank Indonesia (BI) dituding data akurat kepada DPR me- ngenai besaran biaya penye- lamatan Bank Century yang Bank Century bukan lah ma- salah krisis melainkan masa- lah kriminal, perampokan. Ka- bat Boediono, JK telah mene- gaskan bahwa masalah ini adalah karena kelemahan BI. JAKARTA (Waspada): Suku gerakan perlu didukung sektor Sementara itu, Sofyan me- ngan perseroan yang dipub- menjadi pihak paling ber- dinilai sangat besar. Karena itu sus Bank Century ini juga seka- “Saya katakan dalam per- bunga Bank Rakyat Indonesia perbankan,” papar Sofyan. ngatakan Dana Pihak Ketiga likasikan, salah satu penye- tanggung jawab dalam jatuh- Komisi XI meminta Badan ligus menjadi bukti lemahnya temuan itu, ini kriminal, ini Tbk (BRI) sudah lebih rendah Sementara portofolio kre- (DPK) yang berhasil dihimpun bab lonjakan laba bersih itu nya Bank Century sehingga Pemeriksa Keuangan (BPK) pengawasan Bank Indonesia. perampokan, kenapa kita tole- dari bunga pasar, bahkan bu- dit BRI pada kuartal II-2009 BRI pada kuartal II-2009 men- adalah naiknya pendapatan harus disuntik dana oleh untuk melakukan audit inves- “Saya terima Menkeu dan rir. Itulah kelemahan penga- lan depan akan diturunkan meningkat 35,78 persen atau Rp capai Rp216,35 triliun atau bunga. Pada semester I-2009, Lembaga Penjamin Simpa- tigasi terhadap penyelamatan Gubernur BI (ketika itu) Pak wasan BI di situ. Jadi benar kembali untuk bunga kredit- 48,65 triliun, dari Rp 135,96 tri- meningkat jika dibandingkan BRI berhasil meraup penda- nan (LPS). Bank Century. Boediono melaporkan tentang menkeu bahwa ini kelemahan nya sebesar 50-100 bps sebagai liun pada kuartal II-2008 men- DPK kuartal II-2008 yang patan bunga hingga Rp16, Anggota Komisi XI DPR “Apakah Century ini ter- situasi bank Century (tanggal BI sebenarnya, yang terpaksa tindak lanjut dari kesepakatan jadi sebesar Rp184,60 triliun. sebesar Rp176,53 triliun. 840 triliun, atau naik diban- Dradjad Wibowo mengata- masuk sistemik, lalu apa me- 25). Dan saya langsung me- jadi tanggung jawab semua- 14 bank besar. Dengan pertumbuhan Dengan adanya penca- dingkan periode yang sama kan BI sangat pandai dalam mang penyelamatannya bu- ngatakan masalah Century nya,” ketusnya. “Bulan depan kita ada ren- kredit tersebut, LDR (Loan to paian kinerja tersebut, lanjut sebelumnya sebesar Rp13, menemukan masalah terjadi tuh Rp6,7 triliun karena ber- bukan masalah karena krisis, Bahkan ketika itu JK sudah cana menurunkan kembali Deposit Ratio ) BRI pada kuar- Sofyan, total aset BRI mening- 208 triliun. pada perbankan, namun dasarkan pengalaman 1998, tapi itu perampokan, kriminal. menyatakan agar pemilik sekitar 50 bps sampai 100 bps. tal II-2009 tercatat sebesar kat 23,20 persen dari Rp 216,89 Sementara untuk penda- masih lemah dalam penin- deposan mana saja yang su- Karena pengendali bank ini Bank Century sebelumnya Hal ini tindak lanjut dari ke- 85,33 persen. Sementara itu pada kuartal II-2008 menjadi patan bunga bersih BRI per dakan. dah memperoleh pengembali- merampok dana bank Century yakni Robert Tantular harus sepakatan 14 bank kemarin,” rasio kredit bermasalah (NPL) Rp267,21 pada kuartal II-2009 semester I-2009 mencapai “Dari dulu harus dirom- an lebih cepat,” katanya. dengan segala cara termasuk ditangkap karena masalah ini kata Direktur Utama BRI Sof- gross pada kuartal II-2009 serta ekuitas BRI juga menga- Rp10,931 triliun, naik diban- bak total. Kelemahan BI ada Dradjad juga menyambut obligasi bodong yang dibawa adalah masalah kriminal. yan Basir dalam jumpa pers adalah sebesar 3,70 persen. lami peningkatan. dingkan semester I-2008 di pengawasan bank, BI sa- baik investigasi atau penye- ke luar negeri,” urai JK. “Karena itu maka saya di kantornya di Jakarta, Senin “Pertumbuhan kredit BRI Sedangkan untuk laba ber- yang sebesar Rp9,574 triliun. ngat pintar menemukan ma- lidikan dilakukan Komisi Hal itu disampaikan Wap- bilang, pak, penyelesaiannya (31/8). disokong oleh pengembangan sih, BRI berhasil mencatat Namun beban operasio- salah tapi penindakan le- Pemberantas Korupsi (KPK) res JK dalam keterangan pers- yang harus ini orang (robert Menurutnya, penurunan usaha mikro, kecil, menengah hingga Rp3,492 triliun pada se- nal meningkat dari Rp4,984 mah. Jadi harus dirombak BI. terhadap masalah Bank Cen- nya di Istana Wapres, Jalan Me- tantular) ditangkap dulu kare- suku bunga BRI merupakan (UMKM) dimana total porto- mester I-2009. Perolehan laba Saya dari dulu tidak setuju tury ini. dan Merdeka Selatan, Jakarta, na kriminal dan perampokan. triliun pada semester I-2008 upaya antisipasi pemulihan folio kredit UMKM BRI men- bersih itu berarti naik 23 per- dengan OJK (Otoritas Jasa “Alat yang dimiliki KPK Senin (31/8). Karena itu saya minta Guber- menjadi Rp5,238 triliun. Se- ekonomi yang mulai bergerak Keuangan) karena beri be- lebih lengkap dibanding Ko- Kronologi bailout nur BI Pak Boediono agar ini capai 81,71 persen atau sebe- sen dibandingkan laba bersih hingga BRI selama semester tumbuh pada tahun depan.“Pe- ban tambahan. Solusi bukan misi XI. Kalau kita cuma ada JK juga membantah se- dilaporkan ke Polisi. Tapi jawa- sar Rp150,84 triliun dari total pada semester I-2008 yang se- I-2009 berhasil mencatat la- rekonomian dunia, termasuk OJK, tapi rombak total BI,” lewat rapat. KPK berhak me- mua kronologi bailout yang ban BI, “Ini tidak ada dasar hu- pinjaman sebesar Rp184,60 besar Rp2,818 triliun. ba operasional sebesar kita, tahun depan akan ada ber- tandasnya. nyadap dan menyita, kami disampaikan Menkeu sebe- kumnya”,” ungkap JK.(dtc) triliun,” papar Sofyan. Menurut laporan keua- Rp4,843 triliun.(j03) Pegadaian Medan Siapkan Distribusi Elpiji 3 Kg Ditata Ulang Pinjaman Rp350 M MEDAN (Waspada): Ber- bagai pihak dari elemen ma- riman, ujarnya. Belum adanya pengaturan kan setelah berkoordi-nasi dengan pemerintah da-erah. di daerah rampung, katanya. Terhadap hal tersebut ma- MEDAN (Waspada): Kan- vensional. katanya. syarakat mengkhawatirkan kuota, dimungkinkan akibat Koordinasi tersebut sangat syarakat diimbau tidak perlu wil Perum Pengadaian Medan Dia mengaku belum me- akan terjadi kelangkaan ba- konversi minyak tanah ke gas penting guna memantau ke- khawatir karena penarikan mi- yang membawahi Sumut dan ngetahui secara pasti apakah han bakar rumah tangga se- di sejumlah daerah seperti Me- siapan berbagai daerah dalam nyak tanah dilakukan secara Aceh telah menyiapkan dana cadangan dana yang disalur- telah konversi minyak tanah dan masih berjalan dan belum rangka pelaksanaan konversi bertahap setelah program cadangan Rp350 miliar bagi kan ke berbagai kantor cabang ke gas elpiji di Sumatera Uta- selesai, sementara itu subsidi yang rencananya akan segera konversi berjalan baik diber- masyarakat yang membutuh- di seluruh wilayah Sumut dan ra selesai dilakukan. minyak tanah juga belum di- dilakukan setelah pelaksanaan bagai daerah, ujarnya.(m40) kan dan akan ditingkatkan lagi Aceh sudah habis atau meni- Pasalnya setelah empat cabut, katanya. apabila permintaan melebihi pis karena hal itu baru bisa di- bulan dimulainya program Namun pihak agen me- dari stok. ketahui dalam bentuk laporan konversi minyak tanah ke gas nolak akan terjadi kelangkaan Hal itu dijelaskan Kepala bulanan. elpiji 3 kg di Sumut, hingga bahan bakar elpiji dalam wak- Humas Kanwil Perum Pega- “Andaikata stok Rp350 kini pihak Pertamina BBM tu dekat setelah distribusi mi- daian Medan Lintong Parulian miliar itu menimpis atau ter- Retail Region I Medan ter- nyak tanah bersubsidi dicabut Panjaitan kepada Waspada Se- pakai seluruhnya, kami dari nyata belum mengatur tata oleh pemerintah karena dalam nin (31/8) di ruang kerjanya Jl. Kanwil bisa menambahnya niaga distribusinya ke ma- menjalankan konversi Sumut Pegadaian Medan ketika di- segera dalam bentuk permin- syarakat. dinilai lebih siap dibanding minta keterangannya menge- taan dana talangan ke pusat Menurut pihak distribu- daerah Jawa, katanya. nai kesiapan perusahaan BU- sehingga masyarakat tidak ke- tor elpiji 3 kg David H Mar- Sementara itu Humas Per- MN itu melayani masyarakat cewa dan pelayanan kami te- paung, Jalan Perintis Kemer- tamina BBM Retail Region I butuh dana selama Ramadhan tap berjalan sebagaimana serta menghadapi Idul Fitri. mestinya,” kata Panjaitan yang XLent Heroes Community dekaan Medan, Senin (31/8), belum ada tata niaga yang Medan Rustam Aji mengata- kan pihak Pertamina saat ini Menurut Panjaitan, sejak beberapa hari menjelang pua- belum bersedia mengungkap- kan seberapa besar cadangan Medan Sahur On The Road mengatur tentang pasokan sedang menggodok pembaha- XLent Heroes Community Medan menggelar sahur on the road dan pendistribusian bahan san masalah tata niaga distri- sa sampai saat ini permintaan dana Idul Fitri. bakar pengganti minyak ta- busi elpiji 3 kg yang diperkira- dan buka puasa bareng (bubar) pada Minggu (30/8). Tepatnya mulai ,masyarakat atas layanan jasa Pada kesempatan itu Pan- pk.00.000 sedangkan buka puasa pk.16.00-pk.20.00. nah tersebut ke masyarakat. kan akan rampung akhir Sep- Perum Pegadaian di mana- jaitan juga menyebutkan rea- Xlent Heroes telah berkumpul di basecamp Visi FM sambil Informasi yang diterima tember. mana jauh meningkat diban- lisasi penyaluran dana kepada menunggu kegiatan sahur on the road yang di mulai pk.03.00. Mereka pihak agen, untuk pangkalan Untuk menjamin tersalur- dingkan hari-hari biasa. masyarakat setiap tahun terus kemudian disajikan nonton bareng dan secangkir teh hangat cappucino. Dengan guyuran hujan dari tadi pk.23.00 tidak membuat harus mampu memasarkan nya distribusi elpiji 3 kg ke ma- Itu disebabkan berbagai meningkat kendati angkanya para heroes Medan patah semangat dengan membentuk barisan minimal sebanyak 200 ta- syarakat luas Pertamina telah keperluan masyarakat, teruta- masih dibawah target. Dia konvoi sekitar 15 motor dan 5 mobil serta disertai XL Center Mobile. bung elpiji 3 kg sedangkan menjalin kesepakatan dengan ma dari kalangan pedagang mencontohkan periode Juli Para heroes bertolak dari basecamp menuju area inti kota Medan untuk tingkat distributor atau 42 agen minyak tanah yang yang hendak menambah per- 2008 yang ditargetkan Rp239,9 membagikan 100 paket sahur kepada kaum dhuafa. Di sekitaran area Jl. Jamin Ginting – Asrama Haji – Brigjen Katamso – Simpang agen harus mampu mena- akan beralih memasarkan el- modalan atau ada kalangan miliar sekitar Rp143.6 miliar Limun – SM Raja – Juanda – Brigjen Katamso – Kesawan Square ngani 5.000 tabung, ujarnya. piji 3 kg dalam rangka men- yang sengaja membuka usaha yang tersalurkan, namun ang- – Lap. Merdeka – Guru Patimpus dan akhirnya finish di Simpang Namun pasokan gas uku- sukseskan konversi ke gas, se- musiman selama Ramadhan. ka realisasi itu mengalami ke- Golden SIB para heroes sahur bersama.. ran 3 kg tersebut ternyata be- butnya. Berdasarkan laporan dan naikan dibanding penyaluran Setelah pagi sahur on the road bersama para Xlent Heroes community saatnya buka bareng bersama anak-anak panti asuhan. lum diatur kuotanya, tidak Adanya kekhawatiran ber- pantauan Kanwil Medan ter- tahun sebelumnya sebesar Berlokasi di basecamp Visi FM acara di mulai pk.16.00 wib. Diiringi seperti minyak tanah selama bagai pihak akan terjadi kelang- hadap pelayanan kantor ca- 155.81 persen. accoustic Islami menambah nikmatnya berpuasa. Bukan hanya ini pihak agen harus mampu kaan bahan bakar untuk rumah bang di berbagai kota dan ka- Juli 2009 terjadi lonjakan itu saja, para heroes Medan memberikan bantuan berupa baju menampung jumlah kuota tangga tersebut Rustam Aji me- Waspada/Sahrizal bupaten, Panjaitan mengakui pinjaman masyarakat yang me- yang layak dipakai untuk di sumbangkan kepada panti asuhan. yang sudah ditetapkan Perta- ngatakan penarikan minyak TABUNG ELPIJI: Ratusan tabung gas ukuran isi 3 kg masih keperluan dana yang dipero- nyamai target penyaluran de- mina sesuai jadwal pengi- tanah bersubsidi akan dilaku- menumpuk di distributor. leh melalui jasa pelayanan ba- ngan realisasi pinjaman, yaitu dan usaha milik negara itu le- sebesar Rp223,8 miliar lebih. Ini, bih didominasi bentuk pin- katanya, menunjukkan kebutu- Valuta Asing Di Medan Harga Emas Di Medan Mata Uang Jual Beli jaman konvensional. han masyarakat terhadap pin- Artinya gadai perhiasan se- jaman dana pegadaian cukup Jenis Kadar Harga Dolar AS 10.100 10.085 perti emas, berlian dan sejenis, besar tanpa ter-ungkap pasti London Murni 99% Rp304.000 Dolar Australia 8.225 7.925 Franc Swiss 9.664 9.287 sementara untuk jenis kenda- faktor penyebab pasti. Diban- London 97% Rp290.000 Poundsterling Inggris 16.748 16.305 raan bermotor seperti mobil dingkan tahun dua tahun ter- 24 Karat 90 s/d 93% Rp260.000 Dolar Hongkong 1.389 1.283 dan sepeda motor sangat mi- akhir, kata Panjaitan, 2008 pe- Emas Putih 75 % Rp230.000 Yen Jepang 110,43 105,88 nim yang hanya sekitar lima nyaluran dana Pengadaian ke- Dolar Singapura 7.230 7.000 22 Karat 70% Rp165.000 Euro 14.523 14.123 persen saja. Sedangkan gadai pada masyarakat mengalami Suasa 20 s/d 35% Rp100.500 Ringgit Malaysia 3.300 3.000 syariah masih di bawah kon- kenaikan 155,81 persen.(m23)
  • 17. WASPADA Selasa 1 September 2009 Sumatera Utara 17 Kota Zhuhur ‘Ashar Magrib ‘Isya Imsak Shubuh Syuruq Kota Zhuhur ‘Ashar Magrib ‘Isya Imsak Shubuh Syuruq Kota Zhuhur ‘Ashar Magrib ‘Isya Imsak Shubuh Syuruq Kota Zhuhur ‘Ashar Magrib ‘Isya Imsak Shubuh Syuruq Medan 12:29 15:37 18:34 19:43 04:54 05:04 06:19 Langsa 12:30 15:39 18:37 19:46 04:56 05:06 06:21 Sabang 12:42 15:53 18:48 20:01 05:05 05:15 06:32 Tarutung 12:28 15:43 18:31 19:43 04:55 05:05 06:20 B. Aceh 12:41 15:48 18:48 20:57 05:06 05:16 06:31 L.Seumawe 12:33 15:41 18:41 19:50 04:59 05:09 06:24 Pandan 12:29 15:43 18:32 19:43 04:56 05:06 06:21 T.Tinggi 12:27 15:40 18:31 19:43 04:53 05:03 06:18 Binjai 12:28 15:38 18:34 19:43 04:54 05:04 06:20 L. Pakam 12:27 15:36 18:33 19:42 04:53 05:03 06:18 Sibolga 12:29 15:43 18:32 19:43 04:55 05:05 06:21 Panyabungan 12:25 15:41 18:28 19:39 04:53 05:03 06:18 Bireuen 12:35 15:43 18:42 19:52 05:00 05:10 06:26 Sei Rampah12:26 15:35 18:32 19:41 04:52 05:02 06:17 Sidikalang 12:30 15:44 18:34 19:46 04:56 05:06 06:22 Teluk Dalam12:32 15:48 18:35 19:46 05:00 05:10 06:26 B. Pidie 12:35 15:43 18:42 19:51 05:00 05:10 06:26 Meulaboh 12:37 15:46 18:44 19:53 05:03 05:13 06:29 Sigli 12:40 15:51 18:45 19:58 05:04 05:14 06:30 Salak 12:30 15:44 18:34 19:46 04:57 05:07 06:22 G. Sitoli 12:31 15:44 18:36 19:45 04:59 05:09 06:26 P.Sidimpuan12:25 15:37 18:30 19:39 04:53 05:03 06:18 Singkil 12:33 15:47 18:36 19:48 04:59 05:09 06:25 Limapuluh 12:26 15:34 18:30 19:42 04:52 05:02 06:17 K. Jahe 12:30 15:43 18:36 19:46 04:56 05:06 06:21 P. Siantar 12:27 15:41 18:34 19:43 04:53 05:03 06:18 Stabat 12:30 15:43 18:34 19:46 04:55 05:05 06:21 Parapat 12:28 15:37 18:32 19:41 04:54 05:04 06:20 Kisaran 12:25 15:39 18:32 19:41 04:51 05:01 06:17 Balige 12:27 15:42 18:31 19:43 04:54 05:04 06:18 Takengon 12:36 15:48 18:41 19:54 05:01 05:11 06:27 GunungTua 12:23 15:36 18:28 19:37 04:51 05:01 06:16 Kutacane 12:30 15:40 18:37 19:46 04:57 05:07 06:22 R. Prapat 12:24 15:39 18:28 19:39 04:51 05:01 06:16 T.Balai 12:25 15:38 18:29 19:40 04:51 05:01 06:16 Sibuhuan 12:23 15:36 18:28 19:37 04:51 05:01 06:16 Dihisab oleh: Tim Ahli Badan Hisab dan Rukyat (BHR) Sumut Tapaktuan 12:35 15:48 18:39 19:51 05:01 05:11 06:25 Lhoksukon 12:33 15:41 18:41 19:49 04:58 05:08 06:23 Kinerja SKPD Binjai Bentrok Di Binjai, Seorang Kritis Dinilai Tidak Optimal BINJAI (Waspada): LS, 35, warga tuak di salah satu lapo tuak di kawasan Jalan Bone, Kelurahan Limau Mu- Cinta dapat, Kecamatan Selesai. BINJAI (Waspada) : Lembaga Pemantau Kinerja Penyele- ngkur, Kecamatan Binjai Barat yang Mengetahui temannya LS dan A nggara Negara (LPKPN) Kota Binjai menilai, kinerja Satuan Kerja sehari-harinya bekerja sebagai minum tuak, datang SPS alias Maen, Perangkat Daerah (SKPD) di Pemko Binjai tidak optimal. Satpam bersama temannya A dan bersama dengan 3 orang temannya Sekretaris LPKPN BinjaiT.Dahlan, Senin (31/8) mengemuka- SPS alias Maen, menganiaya Perda- dengan menumpang Betor . Mereka kan, ketidakoptimalan kinerja SKPD melaksanakan program mean Manik alias Gilbert, 39, warga kemudian ikut minum tuak. untuk rakyat terkendala biaya operasional yang tidak dikeluar- jalan Takaraw, Kelurahan Timbang Setelah mabuk SPS alias Maen kan Dinas Penglolaan Aset dan Keuangan Pemko Binjai. Langkat, Kecamatan Binjai Timur, mengatakan kepada LS kalau ia per- T. Dahlan mengaku sudah melakukan observasi di beberapa di pangkalan Betmen (sopir Sudaco) nah selisih paham dengan Perda- SKPD di Pemko Binjai. Ada SKPD yang belum menerima biaya di Jalan Sukarno –Hatta, Kelurahan mean Manik alias Gilbert. Bahkan rutin tahap II, seharusnya dana operasional dikucurkan sudah Dataran Tinggi, Kecamatan Binjai ketika ia baru pulang dari Batam, triwulan III. Timur. Minggu (30/8) di Terminal Binjai ia Tersendatnya pencairan biaya rutin dan operasional SKPD Akibatnya Perdamean Manik juga sempat dipukuli Perdamean di Pemko Binjai dengan alasan tidak ada dana. Sekretaris LPKPN alias Gilbert terpaksa dilarikan ke Manik. Binjai minta minimnya dana di kas Pemko Binjai dan tersendat Rumah Sakit Adam Malik Medan Mendengar itu, LS mengajak te- peluncuran dana SKPD harus diteliti dan diaudit Badan Pemeriksa dengan luka sekujur tubuh. Semen- man minumnya mereka menda- Keuangan ( BPK). tara SPS dilarikan ke Rumah Sakit tangaiPerdameanManikkepang-kalan Sementara Anggota DPRD Binjai Daniel Sitepu pada Pirngadi Medan. Beberapa jam Betmen (sopir Sudaco) di Kecamatan kesempatan terpisah meminta tim BPK meneliti adanya dana pasca kejadian polisi mengamankan Binjai Timur, sekira pukul 22:00. gratifikasi yang oleh Komisi Pemberantasan Korupsi (KPK) dinilai tersangka LS dari rumahnya. Kedatangan kelompok LS men- sebagai tindakpidana korupsi. Dana gratifikasi itu, menurut Kapolresta Binjai, AKBP Robets cari Gilbert, diketahui teman-te- Daniel bersumber di Kabag Program dan Pembangunan Setdako Kennedy melalui Kasat Reskrim mannya sehingga perang antara ke- Binjai diperoleh dari kontraktor untuk mendapatkan proyek. AKP Muhamad Taufiq ketika dikon- dua kelompok dengan mengguna- Setiap proyek diwajibkan setor 20 persen. (a03) firmasi membenarkan. kan senjata tajam terelakkan. Polisi Waspada/Arlius Tumangger MAUT MENANTI : Tumpukan batu cadas pada setiap bahu badan jalan di Desa Tinada, Kec. Tinada dan Desa Keterangan yang diperoleh, ben- yang mendapat informasi langsung Sepeda Motor Kontra Bus, Pasutri Tewas Sukaramai, Kec. Kerajaan, Kab. Pakpak Bharat sangat menganggu pengguna jalan serta mengundang terjadinya kecelakaan lalulintas. Namun hingga kini, instansi terkait terkesan tidak pernah peduli. Foto direkam, Senin trok terjadi ketika LS dan A, Minggu malam sekira pukul 18:00 minum mengamankan TKP serta senjata tajam. (a04) BINJAI (Waspada): Sepeda motor Suzuki Smash BK 4888 (31/8). OR yang dikendarai Safruddin Lubis,49, yang berboncengan denganistrinyaIda,45,keduanyawarga JalanUmarSaid,Keluruhan Karyawati Perusahaan Swasta Korban Banjir Belum Dapat Bantuan, Ditemukan Tewas Di Kamar Kampung Tangsi, Kecamatan Binjai Kota, Minggu (30/8) bertubrukan dengan bus BK 7053 PL di Jalan Sudirman Binjai. Akibatnya pasangan suami istri itu tewas di tempat. Keterangan yang dikumpulkan Waspada , Senin (31/8) TANJUNGBALAI (Waspada) : sum, dan hasilnya seminggu baru menyebutkan, sebelumnya pasangan suami istri yang memiliki Seorang karyawati perusahaan diketahui,” kata Tarigan. tiga orang anak itu hendak pulang ke rumahnya dari rumah salah seorang keluarganya. Ketika tiba di Jalan Sudirman persis di depan Perguruan Taman Siswa, korban hendak membelok namun sepeda motor Pemkab Klaim Sudah Memberi swasta, ditemukan tewas di ranjang kamar rumah pamannya di Jalan MT Haryono, Kelurahan Selat Lan- cang, Kecamatan Datuk Bandar, Sementara, paman korban, Dar- sono, mengaku sebagai orang yang pertama kali mengetahui korban tewas. Awalnya, Darsono curiga, Lili korban bersenggolan dengan sepeda motor lainnya. Akibatnya Kota Tanjungbalai Senin (31/8). belum juga terbangun, padahal STABAT (Waspada): Sejumlah mengklaim telah menyalurkan ban- Sosial Pemkab Langkat belum berhasil Dari lokasi kejadian, jenazah Lili, waktu telah menunjukkan pukul korban terjatuh dan sepeda motor yang menyenggol korban korban banjir di Desa Pantaigemi, tuan berupa beras, mi instan, minyak dimintai tanggapannya terkait pe- 20, warga Panipahan, Provinsi Riau, 08:00. “ Biasanya dia berangkat kerja kabur. Naas bagi kedua korban begitu keduanya terjatuh lalu goreng, telur, gula, kopi dan teh. ’’Su- nyaluran bantuan ke korban banjir sempat disemayamkan di Kelenteng jam 07:00, tapi tadi berbeda, jam keduanya ditubruk bus yang dikendarai SBM,45, hingga tewas Kec. Stabat mengaku belum dah kita salurkan bantuan,’’ kata Kabag warga Pantaigemi. Ketika mengun- Jalan MT Haryono, baru selanjutnya sudah pukul 08:00, Lili belum juga mengenaskan. menerima bantuan apapun dari Humas Pemkab Langkat Syahrizal, jungi kantornya Senin sore, telah ko- dilaporkan ke Polsekta Tanjungbalai terbangun,” kata Darsono. Kapolresta Binjai AKBP Roberts Kennedy ketika dikonfirmasi Pemkab Langkat. Senin. song. Sementara handphone miliknya Selatan. Dan, tindak lanjutnya, Oleh sebab itu, Darsono ber- melalui Kasat Lantas Polresta Binjai AKP B S Situmeang Namun ketika puluhan korban masih aktif saat dihubungi, namun jenazah korban kemudian dibawa upaya membangunkan Lili dengan membenarkan. (a04) banjir mengatakan tidak ada mene- tidak diangkatnya. polisi ke RSUD Tanjungbalai untuk cara menggedor pintu kamarnya, ’’Hingga siang ini belum ada,’’ kata rima bantuan samasekali, Waspada Di samping itu hujan yang me- keperluan visum. namun tak berhasil. Akhirnya Dar- Jual Kaset VCD Porno Ditangkap Polisi Karim, 46, Saiful dan sejumlah warga kembali menanyakannya kepada Kabag Humas. Saat itu Syahrizal me- ngguyur sejumlah daerah Minggu dini- hari juga menjadikan Dusun Perko- Kapolsek Tanjungbalai Selatan, sono menghampiri Lili ke dalam dusun IV Dan V Desa Pantaigemi, AKP L Tarigan, ditemui Waspada kamar, dan ternyata, keponakannya BINJAI (Waspada):WS, 20, mengaku warga Pekanbaru yang Senin (31/8). Warga menambahkan ngatakan yang menyalurkan bantuan taan Desa Karanggading, Kec. Seca- di rumah sakit, membenarkan keja- itu sudah tak bernyawa lagi. “ Selama kos di Jalan Sukarno-Hatta, depan Binjai Supermall, Senin (31/ aparatur desa maupun kecamatan petugas Kantor Sosial Pemkab dikor- nggang terendam. 62 rumah warga dian itu. Menurut Tarigan, pihaknya hampir dua tahun tinggal bersamaku, 8) pukul 12:00 diringkus Reskrim Polresta Binjai, di Jalan Sukarno- saja enggan memantau warganya yang dinir Taufik Hidayat selaku Kakan di sana tergenang, namun ketinggian menerima laporan sekitar pukul Lili tak pernah mengeluh, apalagi Hatta, Kecamatan Binjai Timur persis di depan Hotel Garuda, terkena banjir, apalagi menyalurkan Sosial Minggu (30/8) sore. air hanya berkisar 7 centimeter dan 10:00. “ Pengakuan keluarganya, sakit,” ujar Darsono. tertangkap tangan ketika hendak menjual 85 keping kasetVCD bantuan. Sementara Pemkab Langkat Namun hingga Senin sore Kakan telah surut. (a01/a38) setelah makan malam dia langsung Petugas medis RSUD Tanjung- porno. tidur. Dan, ketika dibangunkan pagi balai menjelaskan, hasil visum, tidak KapolrestaBinjai,AKBPRobetsKennedymelaluiKasatReskrim AKP Muhamad Taufiq ketika dikonfirmasi mem-benarkan. Penangkapan berawal ketikaWS menjual kasetVCD di Jalan Direktur Bidang Pengadaan Barang Dan Jasa tadi, korban sudah tak bernyawa lagi,” kata Tarigan. ada ditemukan tanda-tanda mencu- rigakan. “ Tubuh korban sempat Ditanya penyebab kematian dimandikan oleh keluarga, sebelum Sukarno-Hatta, Kecamatan Binjai Timur. Selain menjualVCZD lagu-lagu, tersangka juga menyelipkan VCD porno. Petugas Tidak Tahu Ketentuan Tender Proyek korban, Tarigan mengaku belum dapat memastikannya. “ Masih divi- dibawa ke rumah sakit untuk divi- sum,” ujar petugas medis. (a37) begitu menerima pengaduan langsung mendatangi tersangka. STABAT (Waspada): Dalam persida- proyek itu berjalan sesuai ketentuan itu juga saksi Karianta Tarigan selaku Ketika diperiksa petugas, akhirnya terungkap laporan warga. (a04) ngan lanjutan perkara dugaan korupsi DAK di PN Stabat, saksi Juraida yang dihadirkan JPU sebagai saksi selaku jika tidak ada kontrak kerja, tidak dapat memperlihatkan bukti kepala sekolah telah menerima buku-buku dan tidak pemilik usaha percetakan untuk pro- gram ATK yang tidak dapat memperli- hatkan kuitansi pembelian beragam PNS Resah, BKPP Pungli Polisi Ringkus Pedagang Ayam Jual Ganja Direktur CV M, tidak mengetahui keten- tuan tender proyek, Senin (31/8). jelas biaya anggarannya. Sesaat setelah saksi Juraida tidak dapat menjawab ATK senilai Rp1,58 miliar dari sejumlah toko di Medan dengan alasan tertinggal Rp250 Ribu Pengambilan SK PNS HUTARAJA TINGGI (Waspada): Pedagang ayam potong, Juraida tahun 2007 silam berperan pernyataan JPU, majelis hakim akhirnya di rumah beberapa pekan silam, akhir- TEBING TINGGI (Waspada): penuh yang dikeluarkan sebanyak 200 Ku, 27, warga Desa Ujung Batu II, Kec. Hutaraja Tinggi yang sebagai rekanan yang mengisi buku- menutup persidangan dan melanjut- nya dihadirkan kembali. Saksi akhirnya PNS baru di lingkungan Pemko lembar, belum termasuk SK CPNS. mencoba alih profesi akhirnya berurusan dengan polisi. buku ke empat sekolah dasar di Kec. kannya Rabu (2/9) masih beragenda membawa kuitansi pembelian ATK Tebingtinggi dibuat resah dengan Jika ditotal dana yang mereka kutip Tersangka Ku, ayah satu arang anak ini menuturkan kepada Secanggang bersumber dari DAK. Na- mendengarkan keterangan saksi. sebagaimana yang diminta majelis tindakan oknum di Badan Kepega- mencapai Rp50 juta. “Kemana semua Waspada, Senin (31/8), sejak berkeluarga dua tahun lalu, ia mun dalam pekerjaan itu tidak dileng- Sebelumnya dalam persidangan hakim sebelumnya. (a38) waian Pendidikan dan Pelatihan. dana pungli itu,” kata sumber. sehari-hari berdagang ayam potong untuk menghidupi keluarga, kapi kontrak kerja. Di hadapan majelis Oknum itu melakukan pungutan liar Terkait tudingan itu, Kasubbag tetapi akibat musim kemarau berkepanjangan usahanya tidak hakim dan pengunjung sidang, saksi Terkait Dugaan Korupsi Di KONI Rp 7 M senilai Rp250 ribu per PNS saat akan BKPP Mhd. Haris, SH, saat dikonfir- lancar. mengatakan meminta jatah proyek Usaha Ku mengalami kemerosotan, ayam potong daga- kepada terdakwa AZ selaku mantan Kadis P Dan P dengan berkunjung ke Pemilik Toko Konveksi Dan Anggota DPRD Diperiksa menerima SK pengangkatan. Salah seorang PNS, Sabtu (29/ masi, Senin (31/8), membantah ada mengutip dana kepada PNS terkait ngannya banyak yang mati, hingga rugi yang membuat usahanya 8), mengatakan tindakan pungli itu penyerahan SK PNS. Menurut dia, ‘gulung tikar’. Karena tertarik untung besar, maka ia coba dagang rumah pribadinya, tanpa berbicara di BINJAI (Waspada): Pemeriksaan saksi dugaan korupsi sebesar Rp 7 miliar kantor. yang diduga terjadi di KONI Binjai terus Berlanjut. Petugas juga saat ini menemukan dilakukan seorang Kasubbag BKPP pengutipan itu tak pernah memaksa. ganja yang dibeli langsung dari Aceh Singkil dengan harga Rp500 dengan kesan mengancam. Menurut “Kalau segitu tak ada, tapi biasanya Selain itu karena bermodalkan pengadaan barang fiktif yang terjadi di KONI Binjai serta secara keseluruhan ribu per kg. Dibawanya 2 kg, dan dijual eceran hingga Rp3 juta teman dekat dengan AZ, saksi tidak sumber, pengutipan pungli dilakukan kami minta antara Rp100 sampai per kg. temuan korupsi di KONI Binjai sebesar Rp 1,1 miliar. Dan dana anggaran KONI diharuskan mengisi berbagai formulir tahun 2007 yang lalu secara keseluruhannya disedot dari dana APBD Kota Binjai. bervariasi. Untuk penerima SK PNS Rp150 ribu,” aku Haris, di ruang Namun, baru 1 kg terjual, telah tercium polisi, akhirnya masuk maupun bentuk perjanjian layaknya penuh, dikutip bayaran Rp250 ribu kerjanya. sel Mapolsek Sosa. ‘’Kini saya baru sadar, perbuatan itu telah Sebelumnya Polresta Binjai telah memeriksa 32 saksi dan Senin (31/8) polisi ketentuan tender proyek yang telah memeriksa pemilik toko konveksi dan pengadaan alat-alat olah raga Sinar Abadi, per orang. Sedangkan bagi penerima Menurut dia, itu dilakukan karena menyalahi undang-undang, Insya Allah besok setelah bebas diatur dalam keppres. SK CPNS akan dikutip antara Rp100 dana itu juga diperlukan untuk peng- saya tidak akan mengulangi perbuatan serupa,’’ katanya menyesal. Hasil dari pekerjaan itu, saksi Juraida Agus warga Helvetia Medan. Dalam pemeriksaan, Agus mengaku pembelian barang sudah sesuai dengan harga yang ditentukan. Menurut sumber Waspada, ribu hingga Rp150 ribu per orang. ambilan SK mulai dari Pusat hingga Kapolres Tapsel AKBP Pranyoto Harahap, melalui Kapolsek tidak dapat memperlihatkan bukti ter- Ditambahkan, jika pungutan tak di provinsi. Dana itu, kata dia, diperlu- Sosa AKP M. Basyir didampingi Kanit Reskrim Ipda A.M Butar tulis, empat kepala sekolah telah mene- Agus sebelumnya sudah dua kali dipanggil dua kali, namun baru kemarin hadir. Sebelumnya Polresta Binjai sudah memeriksa anggota DPRD Kota Binjai dilayani oknum itu seringkali mem- kan untuk membiayai pengambilan Butar membenarkan. rima sejumlah buku-buku yang diantar- persulitPNSyangsuatusaatberurusan SK, juga pemberian kepada pegawai- Tim Serse Mapolsek Sosa dipimpin Kapolsek M. AKP M. kannya saat JPU bertanya. Kemudian HMYusup, SH.Mhum. Pemanggilannya terkait jabatannya di salah satu pengurus cabang olah raga. Yusup dalam pemeriksaan mengaku tidak pernah menerima kembali dengan mereka. Bahkan, jika pegawai yang menangani urusan itu Basyir bersama Kanit Reskrim A.M Butarbutar dan sejumlah kuasa hukum terdakwa AZ bertanya, jumlah pungutan itu kurang dari yang dari atas sampai bawah. “Mereka pikir personil menggrebek rumah tersangka. Dia awalnya coba apakah saudara menilai proyek berjalan dana sebesar apapun namun itu hanya disuruh untuk menandatangani oleh Ketua KONI di tahun 2007 Harris Harto, tegas sumber waspada. ditentukan, maka oknum itu meng- menjemput ke atas nggak pakai duit. menghindar dan tidak mengakuinya, tetapi setelah digeledah sesuai ketentuan ? Saksi menjawab, anggapnya hutang. Nanti dimintanya Kalau harus dari kantong aku mana dan ditemukan bungkusan ganja 1 kg dalam dua kemasan serta sesuai. Namun kembali dipertanyakan Kapolresta Binjai AKBP Robers Kennedy ketika dikonfirmasi melalui Kasat Reskrim Polresta Binjai AKP HM Taufiq membenarkan. (a04) lagi kalau kita berurusan,” kata ada dananya,” keluh Haris. Ditambah- 4 amplop siap jual, Ku tak berkutik. (a32) JPU, bagaimana saudara menganggap sumber. kan, dia tidak melakukan hal itu lebih Disampaikan, saat ini SK PNS dari kewajaran. (a08) Tanah Wakaf Di Paluta Diserobot Tatkala Datok Rindukan Emak.......... GUNUNG TUA (Waspada) : Sebidang tanah milik Legiun DATUK Srilelawangsa tiasa dalam lindungan Allah SWT. jamaah yang akan melaksanakan buka Tokoh Masyarakat Besitang Berpulang Veteran Republik Indonesia (LVRI) yang merupakan wakaf Gubsu H Syamsul Arifin dalam puasa bersama. Dia juga bertanya ten- Sutan Namora Pahu pada tahun 1973, berkisar satu hektare, Hidayatullah H Syamsul Arifin BESITANG (Waspada): Muham- jenazah harus dilangsungkan hari kesempatan itu mengemukakan tang persiapan buka puasa di masjid mad Arifin Noor, 69, tokoh masyara- itu juga. Sekitar pukul 18:00, ratusan di Patok 11, Desa Aek Bayur, Kecamatan Padang Bolak, Kabu- sejak lama tersohor sebagai harapannya agar para jamaah dapat itu yang sejak lama terkenal dengan paten Padanglawas Utara diserobot oknum aparat desa. kat Besitang, Minggu (30/8) sekira warga turut mengantarkan almar- orang yang sangat menghormati terus meningkatkan amal dan taqwa- menu khusus berupa bubur pedas. pukul 10:00, menghembuskan na- hum ke tempat peristirahatannya Hal itu diungkapkan putra Sutan Namora Pahu , Mangaraja nya. Keberadaan umara (pemimpin) ‘’Malam ini aku tidur di Brandan, Somataon Siregar, 68, warga desa Aek Bayur, Senin (31/8). orang tua, alim ulama dan fasnya terakhir beberapa saat pesa- yang terakhir di pekuburan muslim dan ulama saling bersinergi tidak ter- rindu sama Emak,’’ begitu kata Syamsul wat yang ditumpanginya dari Pe- di daerah itu. Dikatakan, sebidang tanah yang wakafkan untuk para pejuang tokoh adat. Beliau yang kini pisahkan, ujar Gubsu H Syamsul Ari- sesaat meninggalkan para jamaah. nang, Malaysia, mendarat di ban- Semasa hidupnya, almarhum telah dikuasai tanpa hak dan tanpa mempunyai suatu dasar menjadi Gubernur Sumatera fin seraya menyerahkan sejumlah ‘’Begitulah orang bertuah, rindu sama hukum. Ditambahkannya, oknum itu mendirikan satu unit dara Polonia, Medan. Kepergian pernah mendapat kepercayaan dari Utara juga kerap melakukan bantuan berupa beras,kurma dan se- Emak, kita-kita kan kecipratan rezeki sang tokoh meninggalkan duka masyarakat memegang beberapa rumah permanen diatas tanah wakaf yang diperuntukkan hanya bagainya untuk keperluan para jamaah. juga,’’ ujar sejumlah jamaah berko- kepada tentara veteran RI, ujarnya. kunjungan silaturahmi secara mendalam bagi warga di Kec. jabatan di tingkat kecamatan dian- Sebelumnya Syamsul Arifin juga mentar . Menanggapi komentar Besitang. taranya, Ketua MU), Ketua MABMI, Sementara Ketua LVRI, Kecamatan Padang Bolak, Amirin mendadak, sehingga singgah di Masjid Raya Stabat,Sabtu tersebut salah ustadz menyebutkan Siregar,86, mengatakan, setelah Sutan Namora Pahu menyerah- Almarhum menderita penyakit Ketua Persatuan Sepak Bola Anak kedatangannya kerap membuat (29/8) malam. Selain bersilaturahmi perilaku Syamsul yang sangat hormat gagal ginjal dan sebelumnya dirawat Veteran, Ketua PPM, Ketua KNPI, kan tanah itu, maka tanah itu sudah sah menjadi milik mereka banyak orang menjadi kaget. dengan sejumlah jamaah , Syamsul dan sayang terhadap ibunya , patut dan disaksikan warga Aek Bayur beserta aparatur pemerin- selama delapan hari di RS Marta pernah menjadi anggota DPRD La- juga tidak lupa untuk menyerahkan ditiru. Friska, Medan. Namun, karena pe- ngkat dari Fraksi Partai Golkar, dan tahan desa. (csp) bingkisan berisi buah kurma bagi Ibnu Kasir ngobatannya tidak menampakan terakhir menjabat sebagai Ketua Seperti halnya, Minggu (30/8) pagi, kemajuan, pihak keluarga memu- PHBI. Simalungun Upayakan H Syamsul Arifin mendadak mampir ke Mahtab Al Mufarridiyah di Jalan tuskan membawa almarhum ber- H Arifin Noor, pensiunan pega- obat ke Rumah Sakit (RS) Adventis wai Dinkes Langkat yang dikenal Cetak KTP Di Kecamatan Masjid Tanjungpura. Kedatangan orang nomor satu di Sumut yang tanpa proto- Hospital di Penang, Malaysia. sebagai mantri bertangan dingin itu Sebelum jenazah sang tokoh meninggalkan lima orang putra putri SIMALUNGUN (Waspada): Kepala Dinas Catatan Sipil Kab. koler itu disambut suka cita para jamaah tiba, warga dari berbagai strata sosial dan dua belas orang cucu. Menurut Simalungun Revanus Sormin, mengatakan, dua bulan terakhir yang mayoritas merupakan deportan sejak pagi terus berdatangan ke pihak keluarga, sekitar delapan bulan Disdukcapil telah menerbitkan 4.300 KTP Nasional berbasis Timor Leste sejak akhir tahun 2004. rumah duka yang berlokasi di Jalan yang lalu, istri almarhum lebih dahulu Nomor Induk Kependudukan (NIK). Secara spontan para jamaah melakukan Raya Medan-Aceh, Kel. Pekan Besi- dipanggil Sang Khalik. Menurutnya, minimnya penerbitan KTP Nasional tersebut zikir bersama dipandu HM Syarif salah tang. Bahkan, Guberner Sumatera Imam Masjid Baitul Khair yang karena pencetakannya baru dapat dilakukan di Disdukcapil seorang kordinator deportan. Utara, H Syamsul Arifin, secara ber- juga Sekretaris PHBI Kec. Besitang, dan di Kantor Camat Raya dan Bandar. Hal itu dijelaskan Sormin Menurutnya, zikir yang dilaksana- sahaja datang bertakziah ke rumah Syalamuddin Syam, kepada Waspa- usai rapat paripurna DPRD Simalungun di Pamatang Raya, kan bertujuan agar membawa kemas- tokoh lokal yang menjadi sahabatnya da, Senin (31/8) menuturkan, almar- Senin (31/8). lahanan bagi masyarakat Indonesia itu. hum dikenal sosok pemimpin yang Dikatakan, agar lebih maksimal maka mulai September dan khususnya Sumut . Begitu juga Gubsu berharap kepada sege- rendah hati, pekerja keras suka me- pencetakan KTP itu sudah dapat dilakukan masing-masing kepada H Syamsul Arifin para jamaah Waspada/Ibnu Kasir nap keluarga yang ditinggalkan agar nolong antar sesama. “Ia selalu me- kecamatan dengan sistem on-line sehingga Disdukcapil hanya memanjatkan doa kehadirat Allah SWT, BERSAMA BUNDA:Datuk Srilelawangsa Hidayatullah H Syamsul Arifin bersabar menerima cobaan ini dan nyampaikan gagasan yang menye- menandatangani. “Ditargetkan pada 2010 KTP yang dicetak agar Syamsul berhasil memimpin Su- bersama Bundanya Hj Fadlah dalam suatu acara jelang Ramadhan di pada kesempatan itu, ia menekan- jukan untuk kemaslahatan di tengah dengan sistem manual sudah tidak ada lagi,” jelas Sormin. (a15) mut ke arah yang lebih baik dan senan- Pangkalanbrandan,Langkat, belum lama ini. kan agar prosesi pemakaman masyarakat,” ujarnya. (a02)
  • 18. 18 Sumatera Utara WASPADA Selasa 1 September 2009 Walikota Sampaikan Jawaban Atas Pandangan Fraksi DPRD T. Balai + Hancurnya Perumahan Nelayan TANJUNGBALAI (Waspada) :Walikota Sutrisno Hadi menyam- paikan jawaban atas pandangan umum fraksi DPRD Kota Tanjung- Bukan Bencana balai pada paripurna di gedung dewan, Senin (31/8). LIMAPULUH(Waspada): Kerusakan rumah dimuat Waspada coba mengkonfirmasi Riana, Pandangan umum itu dalam rangka penyampaian Ranperda yang diakibatkan hempasan ombak di Pantai ia mengatakan tidak tahu dengan peristiwa itu. tentang pertanggungjawaban pelaksanaan APBD TA 2008 dan Kuala Sipari, Kec.Medangderas, Kab.Batubara Ketua LSM Aurel Citra Independen Batubara, Ranperda tentang perubahan APBD TA 2009. dinyatakan oleh Kepala Dinas Sosial Batubara Ir Marzuki mengomentari pernyataan Riana yang Dalam jawabannya, Walikota menyatakan, pada dasarnya Riana bukan bencana. menyatakan peristiwa Pantai Kuala Sipari bukan Hal itu dinyatakan saat Waspada mengkon- bencana adalah suatu ketidak wajaran. “Melalui Pemko Tanjungbalai telah berupaya meningkatkan kemampuan gambar saja sudah terlihat bangunan rumah pen- SDM aparaturnya, terutama yang berkaitan dengan pengelolaan firmasi Riana melalui pesan singkat, Senin(31/ 8).Tanpa mau memberikan keterangan apa sebab duduk itu kupak-kapik ditambah lagi keterangan keuangan daerah.“ Beberapa tahun terakhir ini, PemkoTanjungbalai penduduk yang mengalaminya. Kita meragukan terus mengikut sertakan PNS pengelola keuangan untuk mengikuti dinyatakannya seperti itu, Riana menyatakan telah meninjau lokasi Pantai Kuala Sipari pada itikad Kadisos Batu Bara jika itu sikapnya,” jelas pelatihan-pelatihan yang dilaksanakan Pusat maupun provinsi,” Marzuki. kata Walikota. Jumat(28/8). Marzuki juga mengatakan kalau sudah seperti Ditegaskan, program peningkatan SDM tetap merupakan Seperti yang diberitakan Waspada, Rabu(26/ itu kondisinya dinyatakan bukan bencana berarti program prioritas di samping program-program yang bersentu- 8) sesuai keterangan warga setempat dan Kepala ia memang tidak melihat apa yang dialami pendu- han langsung dengan kepentingan masyarakat dan konsep The Dusun Sabri Manik, ombak besar itu datang pada duk itu sebagai tanggung jawabnya. “ Apa yang Right Man On The Right Place juga telah diterapkan dan akan Minggu dinihari. Ombak yang diikuti oleh angin telah dilakukan Kadisos terhadap korban - korban terus menerapkannya. kencang memporak - porandakan beberapa bencana itu, pernyataan seperti itu tentunya ber- Selain masalah SDM aparaturnya, menurut Walikota, Pemko rumah warga. dampak psikologis bagi warga yang terkena, tidak juga tetap akan terus berupaya meningkatkan pendapatan pajak Meskipun demikian saat berita tersebut ada yang perduli lagi dengan nasib mereka. (a31) daerah, termasuk untuk mengawasi proses pemungutan pajak daerah dan senantiasa akan terus membangun kordinasi antar SKPD. “ Tujuannya, agar peluang-peluang peningkatan pendapatan DEMO: Puluhan pelanggan listrik mendemo kantor PLN ranting Kisaran dengan tuntutan, Waspada/Sapriadi Papan Reklame Marak pajak daerah dapat dimanfaatkan serta mengeliminir kebocoran atas penerimaan pajak,” ujar Walikota. pemadaman bergilir dihentikan mengingat umat muslim yang menjalankan ibadah di malam bulan Ramdhan, sehingga mereka tidak terganggu aktivitasnya. Foto direkam, Senin (31/1). Di R. Prapat Diduga Tanpa Izin Lebih lanjut dikatakan Walikota, untuk meningkatkan penda- RANTAUPRAPAT(Waspada): Papan reklame waktu 3 bulan, sementara untuk iklan menetap Pemadaman Tetap Jalan Puluhan patan pajak daerah, Pemko melalui Dinas Pendapatan Daerah melakukan pendekatan persuasif dengan terus mengimbau para saat ini banyak berdiri di inti Kota Rantauprapat. sepertiiklanyangterpasangditoko-tokodikenakan wajib pajak. Namun papan reklame yang terpampang di biaya sebesar Rp. 150 ribu dalam satu meter dan Hadir di paripurna itu, Sekdakot Tanjungbalai Darwin Zulad, pinggiran jalan umum itu tidak terlihat izinnya untuk jangka waktunya selama 1 tahun. Kabag Humas DarulYana Siregar, para pimpinan SKPD dan seluruh dipasang dan kapan akan berakhir. Soal papan reklame seperti spanduk di inti unsur Muspida dan pimpinan serta anggota DPRD Tanjungbalai. (a37) Tanjungtiram ‘Terdepan’ Sebatas Slogan Warga Demo PLN Kisaran Berdasarkan pemantauan, di beberapa pinggiran Jalan Lintas Sumatera dan dalam inti kota terlihat papan reklame. Seperti di Perlayuan Kec. Rantau Utara, Kel. Pulopadang. kota Rantauprapat yang diduga izinnya telah berakhir, sementara dari pantauan wartawan belum ada tindakan dari instansi terkait, Ismail mengatakan, penindakan dilakukan Satpol PP Ditanya apakah pihak dinas (BPPKD) melapor . Dinas Badan Pengelola Kekayaan Keuangan KISARAN (Waspada) : Bulan be, kami hanya minta pelayanan narnya pasokan listrik kita su- ke Satpol PP tentang izin yang telah habis atau Daerah Melalui Kasi Pendapatan Ismail saat TANJUNGTIRAM (Waspada): Banyak spanduk terpasang di Ramadhan pemadaman terbaik dari PLN, sehingga kami dah cukup, karena kita menda- reklame yang dianggap liar agar diturunkan, Ismail dikonfirmasi pekan lalu mengatakan, akan mem- sekitar KotaTanjungtiram Batubara, di antaranya salah satu spanduk tidak kecewa, karena kami juga pat bantuan listrik dari Tanah mengatakan sudah pernah. bergelir tetap berjalan di persiapkanstikermasatenggangwaktuizin papan bertuliskan ‘Mo...Kito Buat Tanjungtiram, Kecamatan Terdepan membayar rekening PLN tiap Jawa dan Kuala Tanjung, tapi Namun Said Ali, Kasat Satpol PP Labuhanbatu reklame yang terpampang di seputar Kota Ran- saat dihubungi, Sabtu (29/8) melalui selular (Tertib Damai Elok jadi Panut an) menjadi tanda tanya masyarakat. Kota Kisaran, menyebabkan bulannya. karena kita menaggung aliran tauprapat.” Saat ini kita sedang mengejar tar- membantah kalau Dinas Badan Pengelola Apalagi spanduk dibuat pihak kecamatan/ PKK setempat puluhan masa berunjuk rasa “ Kami minta PLN bertindak listrik ke Kota Tanjungbalai, get iklan di Labuhanbatu sebesar Rp 216 juta Kekayaan Keuangan Daerah (BPKKD) memberi- merupakan salah satu tugas yang diemban supaya sukses. Yang profesional dalam menangani sehingga pasokan listrik tersebut di kantor PLN Ranting untuk tahun 2009 ini, “ ungkap Ismail. kan perintah atau surat tembusan untuk melaku- dipertanyakan menurut anggo ta masyarakat apakah cukup dengan masalah ini, sehinngga kami t i d a k m e n c u k u p i ,” u j a r Kisaran, Senin (31/8). Ketika disinggung soal pemasangan iklan di kan penurunan iklan yang dianggap telah berakhir memasang spanduk sedemikian akan memperoleh hasil pelanggan tidak dirugikan,” Marpung. Perlayuan, ia mengaku tidak mengetahuinya. masa izinnya .” Sejak saya menjabat sebagai kasat, “Jangan sekedar ogah pasang spanduk agak terbaca masyara- Manajer PLN Ranting Kisa- Akibatnya, ungkap Mar- Dijelaskan, untuk tarif iklan musiman dikena- tidak pernah kami melakukan penurunan, “ ucap kat, berharap terbaca oleh atasan bisa dinilai kreatif. Yang penting ran M Marpaung dikonfirmasi paung, pemadaman tetap Informasi dihimpun Was- kan biaya sekira Rp 50. 000 per meter dalam jangka Said Ali. (c01) tunjukkan kinerja ke arah yang dimaksudkan spanduk itu” sebut Waspada menjelaskan, pema- dijalankan selama perbaikan Jamaluddin, seorang warga Tanjungtiram menanggapi pemasa- pada, puluhan warga berasal daman bergilir tetap harus ber- gardu sebanyak 3 jam siang dan ngan spanduk itu, Minggu (30/8) Untuk mengharapkan ‘tertib’ apalagi jadi ‘panutan’ di perlukan dari pelanggan PLN di Kota Kisa- ran yang merasa kecewa terha- jalan, karena salah satu gardu PLN terbakar. 3 jam malam. “ Pemadaman itu tidak dapat dihindarkan, namun Akibat SK Bupati L. Batu, ekstra kerja keras, bijaksana, ketekunan, dekat dengan masya- rakatnya, bukan hanya pintar omong. (a30) dap pemadaman bergilir, sehi- ngga aktivitas dan ibadah di bulan Ramadhan terganggu. “ Salah satu gardu PLN ter- bakar tepatnya pada Jumat, (28/ karena memandang pelanggan yang begitu banyak dan meng- Rp124 M Proyek Tanpa Tender 8) malam , sehingga beban arus ingat ini bulan ramadhan, kami Aksi sempat diwarnai de- listrik tidak mencukupi, dan mempersempit pemdaman RANTAUPRAPAT(Waspada): Keluarnya Surat disebutkan, maksud satu tahun anggaran adalah PKS Batubara Dukung ngan dorong-dorongan antara pemadaman harus dijalankan,” menjadi 3 jam saja sehari sema- Keputusan (SK) Bupati Pemkab Labuhanbatu HT Milwan dengan nomor 050/205/Pemb-I/ dari tanggal 1 Januari sampai 31 Desember. “Arti satu tahun anggaran itu harus dipedomani. pendemo dan petugas keama- ujar Marpaung. lam selama kurang lebih satu Tindakan Polres Asahan nan, sehingga mereka diterima Menurutnya, gardu yang minggu,” ujar Marpaung. 2008 tentang persetujuan melakukan kembali ikatan perjanjian kontrak pekerjaan jasa pelak- Sementara di Labuhanbatu proyek tahun 2008 masih dikerjakan ditahun 2009. Semetinya untuk seorang staf PLN, setalah men- terbakar merupakan penyalur Disinggung penyebab salah LIMAPULUH (Waspada): DPD PKS Batubara memberikan dengar arahannya, mereka arus listrik ke Kota Tanjungbalai, satu gardu PLN terbakar, Mar- sanaan kontruksi APBD setempat tahun 2008, tahun 2009 harus melalui proses tender ulang apresiasi yang tinggi atas komitmen Polres Asahan yang menggelar bubar dengan tertib. karena gardu terbakar aliran pung belum bisa memberi ja- ditudingmenyebabkanpengerjaanproyekdengan karena telah melampaui tahun 2008. razia untuk memberantas penyakit masyarakat (Pekat ) di wilayah “ Kami meminta PLN berta- listrik ke Tanjungbalai terham- waban dengan alasan bagian total anggaran Rp 124 miliar, dilakukan tanpa “SK itu juga berseberangan dengan PP Nomor Kec.Limapuluh, Batubara. nggungjawab atas pelayanan bat, oleh sebab itu, lanjut Mar- penanggung jawab gardu belum proses tender ulang. 58 tahun 2005 tentang, pengelolaan keuangan Demikian disampaikan Ketua DPD PKS Hadian Kardiadinata yang mereka berikan, kepada paung, untuk sementara, PLN memberi laporan dengan pihak Sesuai dengan Undang-undang nomor 17 daerah dimana diterangkan, keuangan daerah kepada Waspada, Senin(31/8). Dikatakan dalam menjalankan pelanggan,” ujar salah satu pela- ranting Kisaran menanggung PLN penyebab gardu terbakar. tahun 2003 tentang Keuangan Negara, semestinya dikelola secara tertib, taat pada peraturan perun- dakwah di berbagai tempat di Kab.Batubara, jamaah banyak nggan yang berunjuk rasa Nan- listrik yang akan disalurkan ke “Sampai saat ini kami belum me- telahberakhirdananggaranyangtelahdibayarkan dang-undangan, efisien, ekonomis, efektif, trans- mengadukan tempat - tempat maksiat yang begitu meresahkan da Rambe kepada Waspada. Tanjungbalai, sehingga pema- ngetahui penyebab gardu itu kepada rekanan serta penggunaannya, harus paran, dan bertanggung jawab dengan memper- masyarakat. “ Namun dalam kerangka partai tidak ada wewenang Oleh sebab itu, lanjut Ram- daman terus dijalankan. “ Sebe- terbakar,” ujar Marpaung. (csap) terlebih dahulu dilaporkan prestasi kerja di lapa- hatikan asas keadilan, kepatutan dan manfaat untuk menindak kegiatan warung-warung yang diduga sarang ngan. Namun sebaliknya, sebesar Rp 124 miliar untuk masyarakat. Pengelolaan keuangan daerah kemaksiatan itu, kita telah menyampaikan ini langsung kepada Polres Asahan, alhamdulillah telah ditanggapi,” ujar Hadian. Razia yang dilakukan Polres Asahan khususnya oleh Polsek Jaringan Distribusi Listrik pengerjaan proyek di Kabupaten Labuhanbatu, akhirnya diluncurkan ke tahun 2009. “Pembayaran proyek untuk tahun 2008 harus dilaksanakan dalam suatu sistem yang terintegrasi yang diwujudkan dalam APBD yang setiap tahun ditetapkan dengan peraturan daerah,” tambah Limapuluh hendaknya dijadikan contoh oleh polsek - polsek lainnya yang belum melakukan pemberantasan atas penyakit Di Tanjungbalai Terganggu berdasarkan prestasi kerjaan dilapangan, bukan pembayarannya yang dapat dilakukan tahun praktisi hukum itu. Parahnya lagi, berdasarkan laporan penggu- masyarakat ini. (a31) TANJUNGBALAI (Waspa- ran mengalami kerusakan pada mampu memikul secara menye- 2009, ini tidak sesuai dengan ketentuan. Makanya naan anggaran per 31 Desember 2008, realisasi da):ManajerPTPLNRantingKota Jumat (28/8) malam. Dan, akibat luruh pada saat beban puncak. ada luncuran dana proyek sebesar itu,” terang pengerjaan proyek di lapangan sesuai dengan Haris Nixson Tambunan, Sekretaris Gerakan penggunaan dana yang dilaporkan kepada DPRD, Antisipasi Teroris, Muspika Data Tanjungbalai, Edi Kurnia Situme- ang, mengatakan, jaringan dis- kerusakan itu, kata Situmeang, akhirnya pelayanan listrik ke ma- Normalnya, untuk melayani pe- langgan PLN Ranting Tanjung- Anti Korupsi Indonesia (Gransi) kepada Waspada, disinyalir tidak sesuai dengan yang dilaporkan, Minggu (30/8) di Rantauprapat. karena terdapat pencairan dana di penghujung Kelengkapan Surat Penduduk tribusi listrik terganggu akibat kerusakan trafo daya 2 di Gardu syarakat mengalami gangguan, yaitu pemadaman listrik secara balai harus memakai trafo daya 2. Jadi karena terbatasnya ke- Dijelaskan Haris, pasal 4 UU 17 tahun 2003 tahun yakni, tanggal 30 Desember 2008. (c01) Induk Kisaran. bergilir di wilayah Tanjungbalai mampuan trafo daya 1, maka BERASTAGI (Waspada ): Muspika Berastagi sepekan terakhir melakukan ’sweeping’ dan sosialisasi dari rumah ke rumah di seluruh kelurahan dan desa untuk mendata surat kependudukan “SeluruhjajaranPLNRanting Tanjungbalaimintamaaf,dengan dan sejumlah daerah di Asahan. “ Ada gangguan teknis yang perlu pelanggan PLN di ranting Tan- jungbalaidanKisaranterganggu,” Perda No. 30/2008 Beratkan Pedagang pemadaman listrik secara ber- diganti materialnya, dan material jelas Situmeang. warga. Akan tetapi, Situmeang ber- RANTAUPRAPAT(Waspada): Peraturan Dae- “Padahal di Perda diterangkan, setiap pera- Selain mendata, kegiatan yang akan terus dilaksanakan hingga gilir, lantaran peralatan trafo daya pengganti itu sudah tiba di Gardu janji, dalam 3 hari ini distribusi rah (Perda) Pemkab Labuhanbatu Nomor 30 watan Rp 1 juta, biayanya ditanggung penyewa, Senin (7/9) juga untuk menindaklanjuti instruksi pemerintah 2 di Gardu Induk Kisaran menga- IndukKisaran,”ungkapSitumeang. listrik kepada pelanggan PLN Tahun2008tentangRetribusiPemakaianKekayaan diatasnya bagi dua. Tapi sampai kini tidak ada pusat, dalam mempersempit ruang gerak jaringan teroris. lami kerusakan,” kata Situmeang Disebutkan, dengan adanya Ranting Tanjungbalai bakal nor- Daerah, yang disahkan 29 Agustus 2008 lalu, dinilai bentuk pelayanan yang diberikan kepada kami. Hal ini disampaikan Camat Berastagi Swingli Sitepu, kemarin. di dampingi Supervisor Operasi gangguan pada trafo daya 2 itu, mal kembali. “ Insya Allah, dalam pedagang pemakai Ruko Kompleks Pasar Lama, Yang kami bayar cuma lahan saja, makanya kami Disebutkan kegiatan melibatkan unsur kecamatan, Satpol PP , Distribusi wilayah Tanjungbalai, makauntuksementaradistri-busi 3 hari ini akan normal kembali, khususnya yang berlokasi di Jalan Jenderal minta Perda itu ditinjau ulang, pantasnya tarif lurah dan kepling, Babinsa Koramil dan Polsek Berastagi H Panjaitan, kepada Waspada, listrik kepada masyarakat Tan- sebab material pengganti trafo Sudirman Rantauprapat, sangat memberatkan. lama, karena ini aspirasi warga,” terang Ketua Disebutkan, pendataan secara persuasif, dengan cara meng- Senin (31/8). jungbalai dialihkan pada trafo yang rusak sudah tiba di Gardu Sebab, retribusi sewa/pajak lahan milik peme- FKPRPL Rantauprapat itu. imbau warga agar tetap siaga dan waspada terhadap pendatang Situmeang menjelaskan, daya 1. “ Kemampuan trafo daya Induk Kisaran, dan akan segera rintah itu naik hingga 70 persen. Seperti contoh, Ditambah Bunda Mursida, Refolison dan baru dengan melakukan pendataan penduduk yang tidak memiliki trafo daya 1 di Gardu Induk Kisa- 1memangterbatas,sehinggatidak dipasang,” jelas Situmeang. (a37) tahun 2008 lalu, tarif sebesar Rp 11 juta per tahun. Fauzan secara bersamaan, Kadis Paskeb Pemkab kelengkapan surat surat , seperti KTP dan Kartu Keluarga. Setelah dilakukan koordinasi, pedagang hanya Labuhanbatu H Sotar Lubis, selaku dinas mena- Sedangkan kepada warga pendatang baru di Berastagi atau warga yang berpindah tempat masih di kota wisata itu (antar Peresmian Anggota Dewan Diboikot membayar Rp 8 juta seperti tarif yang lama ternya- ta, tahun 2009, tarif naik tajam rata-rata Rp ngani pajak, menekankan 1 September 2009 pem- bayaran tarif terakhir. Angka itu berdasarkan Kelurahan/Desa) diminta segera melapor ke Kepling untuk P. SIANTAR ( Waspada): pintu menuju ruang sidang serta yang diberi undangan sedang- 14.700.000 per tahunnya. perkalian permeternya tanah ditetapkan sekira didaftarkan. Peresmian dan pengambilan pintu ruang sidang pun dikawal kan sebagian besar tidak. “Kami menilai kenaikan ini tidak memenuhi Rp 17 ribu, sedang waktu lalu Rp 10 ribu. Muspika sepakat memberi kelonggaran waktu 2 X 24 jam sumpah/janji 30 anggota DPRD ketat. Sempat terjadi dialog warta- azas-azas muatan Perda, yakni pengayoman, “Yang Rp8 juta dulu saja sudah kemahalan pasca sosialisasi di setiap kelurahan/desa, untuk melapor dan Kota Pematangsiantar periode Boikot ditandai dengan wan dan Kabag Umum Setre- kekeluargaan,keadilan,keseimbangan,keserasian itu, apalagi dunia masih mengakui krisis, belum melengkapi surat/data data. Namun jika dalam batas waktu yang 2009-2014 di ruang sidang meletakkan berbagai alat kerja tariat DPRD Herry Tua Butarbu- dan keselarasan. Besarannya juga tidak memper- lagi bayar retribusi ruko, listrik, PDAM, telefon, telah ditentukan oknum warga masih tetap membandel, maka DPRD, Senin (31/8) diboikot jurnalis, seperti kamera di hala- tar dan kemudian dia pun pergi hatikan asal usul lokasi objek retribusi pada karyawan, kebersihan, pembersihan dan pema- Muspika bertindak tegas bahkan dilakukan mengusir paksa wartawan media cetak dan elek- man gedung DPRD, Selain itu ketika kembali muncul protes umumnya,” kata Ketua Forum Komunikasi Peda- kaian parit, pasar dan lainnya. Kami minta bupati warga/pendatang yang tidak memiliki kelengkapan surat tronik akibat larangan meliput menolak tegas ajakan Asisten wartawan. gang Ruko Pasar Lama (FKPRPL) Khairul Anwar- dan anggota dewan mendengar keluhan ini,” kependudukan, katanya sebelumnya. Pemerintahan dan Kesejah- Ketua KPUD Rajaingat syah Ritonga kepada wartawan, Minggu (30/ Saragih, SH yang dihubungi 8) di Rantauprapat. tambah warga itu. Dia juga menyebutkan sosialisasi mulai dari Kelurahan Tambak Sementara, pengamanan teraan Rakyat Pemko Jonson mengatakan, undangan bukan Sementara, dari awal keberadaan ruko di Kadis Paskeb Pemkab Labuhanbatu H Sotar Lau Mulgap I, Tambak Lau Mulgap II, Gundaling I, Gundaling II, kegiatan itu ekstra ketat dan Simanjuntak. Desa Sempajaya, Doulu, Rumah Berastagi, Gurusinga dan Raya. urusan KPUD lagi. Serangkaian jalan itu sekira 30 tahun lalu, dibangun dengan Lubis saat dihubungi wartawan, Minggu (30/8) berlapis diawali dari penutupan Boikot dan penolakan itu peresmian itu Ketua DPRD pe- d mempersilahkan pedagang melayangkan surat (a17) jalan mulai dari Jalan Jenderal semakin kuat, karena ada peng- dana pribadi, oleh orang terdahulu mereka. Kelas riode 2004-2009 Lingga Napitu- I yang dikategorikan juga tidak tepat, sebab jumlah keberatannya ke Pemkab Labuhanbatu. “Apa Sudirman dan Jalan Merdeka umuman pembawa acara, war- pulu, pada saat sambutan Ketua nanti hasilnya, ya kita lihat saja. Kalau toh mereka angka perbelanja jauh lebih banyak dibanding HTI Sektor Aekraja Juara Lomba sampai ke persimpangan Jalan P. Diponegoro. Sedangkan tawan hanya boleh meliput paling lama 10 menit. DPRD sementara Marulitua Hutapea, langsung keluar ruang Kelas II dan III, serta pemerintah membatasi juga enggak sanggup, kita buat lelang terbuka,” angkutan yang melintas dijalan itu. kata Sotar. (c01) Pemadaman Kebakaran Hutan pintu gerbang masuk dan keluar gedung DPRD juga dikawal ketat. Boikot itu juga timbul akibat pilih kasih terhadap wartawan, sidang bersama beberapa ang- gota DPRD lama dan pergi me- PARAPAT (Waspada): Toba Pulp menggelar lomba memadam- kan api kecil dengan kain basah atau goni/karung basah, kemudian Sementara, pintu utama dan dan hanya beberapa wartawan ninggalkan gedung dewan. (a14) Ada Oknum Hambat Pembangunan Kota Kisaran menggunakan apar powder atau oksigen (CO2), serta patroli tim kebakaran dengan mobil pick-up, bulk tank dan mini strike Padam Dan Padam Lagi....... KISARAN (Waspada): Oknum PT BSP Tbk di kantor pusat Kisaran jangan coba untuk “Lho? Kalau memang benar ada hasilnya Rp10 juta per bulan, silahkan setor ke kas daerah di HTI Sektor Aeknauli, dekat Parapat, Rabu (26/8). menghambat pembangunan Kota Kisaran melalui Badan Keuangan dan Aset Daerah Perlombaan bertajuk “Cegah dan Kendalikan Kebakaran PLN kembali mengulah. masyarakatTanjungbalai selama Belum lagi kebingungan itu (Kecamatan Kisaran Barat dan Kisaran Timur) Kabupaten Asahan, tercatat sebagai PAD dan Hutan dan Lahan secara Cepat, Tepat dan Efisien”. Listrik padam, air PDAM menghadapi Ramadhan yang terjawab, pada hari yang sama, berkaitan dengan HGU perusahaan per- ber-gunabagimasyarakat.Jangandiisukanditerima Perlombaan itu disaksikan Kadishut Kab. Simalungun Amran penuh berkah, sudahlah listrik tapi sekira pukul 20:30, lagi-lagi kebunan. Bupati Asahan secara pribadi,” tandas Dayat. Sinaga, Kepala Balai Besar Konservasi Sumber Daya Alam juga ikut-ikutan padam. padam terus-terusan, air listrik padam selama 3 jam. Dan, “Tidak ada lahan perkebunan dalam kota, Karyawan (BBKSDA) H. Jati Wijaksono, Camat Girsang Sipangan Bolon Sementara, warga PDAM juga macat, bahkan lapa- kejadian itu terus berlangsung coba lihat di seluruh kota Indonesia. Dan ingat, Selain rencana pembangunan Masjid Agung, Iman Nainggolan, Camat Jorlang Hataran Rosdiana Damanik, Kabupaten Asahan dan ngan pekerjaan juga sulit diper- sampai hari ini, minimal dalam Kapolsek Parapat AKP Tarsan Gultom, Kapolsek Tanah Jawa pembebasan lahan HGU PT.BSP d/h Uniroyal Pemkab Asahan juga merencanakan pemba- oleh,” kata Tedy melalui pesan sehari listrik padam 4 x 12 jam. di Kisaran dengan kompensasi lahan pengganti ngunan GOR dan Kolam Renang yang sudah AKP Samson Sinaga, Kapolsek Tiga Dolok AKP Espryanto, Manggala Kota Tanjungbalai hanya singkat via ponsel kepada Manager PT PLN Ranting di Aek Silabat Mandoge, harus diukur ulang. dilakukan Deputi Menegpora peletakan batu Agni diwakili Darmanto, Pengendali Kebakaran (Dalkar) Wilayah- bisa pasrah sambil Waspada. Tanjungbalai, Edi Kurnia Situ- I Aeknauli diwakili Parasian Sinaga, serta para dosen USI (Universitas Diduga lahan di Aek Silabat melanggar batas pertamanya, Hutan Kota, Alun-Alun, bahkan mengelus dada. Ingin Andai saja Lembaga Survei meang, menjelaskan, pemada- Hutan Lindung,” ungkap Kabag Humas Pem- Pemkab Asahan juga sudah merancang pem- Simalungun) Tioner Purba, Simon H Sidabukke dan Frederik di Indonesia turun ke Asahan man listrik di kota kerang terjadi Hutabarat. Dari TobaPulp hadir Direktur Juanda Panjaitan dan marah, takut pahala puasa kab Asahan Rahmad Hidayat Siregar, S.Sos.MSi bangunan perumahan karyawan PT BSP Tbk dan Tanjungbalai, hasilnya pasti akibat kerusakan trafo daya 2 kepada Waspada, Minggu (30/8). Kisaran di lahan Kota Kisaran. Manajer HTI sektor Aeknauli Jasmin Parhusip. berkurang. Ingin anarkis, hampir seratus persen masya- di Gardu Induk Kisaran pada Para peserta terdiri atas tim pengendali kebakaran sektor khawatir disangka teroris. Tokoh pemuda yang baru saja terpilih “Sehingga karyawan memiliki rumah setelah rakat merintih seperti Bulian Jumat (28/8) malam. Atas na- menjadi Ketua DPD KNPI Asahan ini mengajak pensiun. Apa oknum PT.BSP Tbk Kisaran pernah Aeknauli, Aekraja (Tarutung), Tele (Humbahas) dan Habinsaran dan Tedy Erwin. ma jajaran PLN Ranting Tan- (Tobasa) dengan para juri Darmanto (Manggala Agni), Parasian untuk menghitung kompensasi lahan Aek memikirkan hal ini? Apapun akan dilakukan Jumat (28/8) sekira pukul jungbalai, Situmeang minta Silabat dengan pembebasan areal di Kisaran, Pemkab Asahan untuk merealisasi rencana Sinaga (Dalkar Aeknauli), Hemlan Silaen (Planning sektor Aekraja) “ Masyarakat Desa Bagan dan Aron Pasaribu (Porsea). 23:00, tiba-tiba saja aliran listrik maaf dan berharap masyarakat tidak sebanding. itu dan siap berhadapan dengan hukum,” tukas Asahan menjerit minta tolong, di dua daerah itu padam. Lantu- bersabar atas pemadaman listrik Materi lomba meliputi gelar selang (bentuk sandang, ransel, “Pesaham terbesar PT BSP Tbk Aburizal Rahmad Hidayat Siregar. melon, ganda, tunggal dan angka 8), teknik pemadaman api, listrik padam berjam-jam, air nan ayat-ayat suci Al Quran yang secara bergilir, lantaran perala- juga macat total. Tolonglah para Bakrie dan keluarga bahkan akan ikut berpar- Dayat juga mempertanyakan dana CSR PT serta kecepatan dan akurasi pengukuran areal terbakar. Setelah berasal dari mesjid-mesjid pun tan trafo daya 2 mengalami tisipasi dalam pembangunan Masjid Agung BSP Tbk Kisaran dan perusahaan lainnya yang melalui seleksi ketat, HTI Sektor Aekraja (Tarutung) keluar sebagai pemimpin kami, kapan kami menghilang. Semula warga me- kerusakan. hidup nyaman di negara ini jika bernama Al Bakrie. Mengapa oknum di PT harus dikeluarkan sekira empat persen kepada juara pertama dengan nilai 3.115, juara dua Sektor Aeknauli (3.080), nyangka pemadaman hanya “ Ada gangguan teknis yang BSP Tbk Kisaran mencoba menghambatnya?” masyarakat sekitarnya, apakah sudah dilakukan juara tiga Tele (3.025) dan juara harapan Habinsaran (2.825). kondisinya terus seperti ini,” sebentar. Ternyata, Sabtu (29/ perlu diganti materialnya, dan rintih Bulian, warga Bagan Asa- kata Dayat. secara ideal dan penuh. Penyerahan tropi oleh Kadishut Simalungun kepada juara- 8) sekira pukul 15:00, listrik baru material pengganti sudah tiba Dayat juga mempertanyakan lahan 4,5 hek- “Ini menjadi tanda tanya besar? Jangan 1, Juanda Panjaitan kepada juara-2, Jati Wijaksono kepada juara- han, Kecamatan Tanjungbalai, menyala kembali. Artinya, PLN dan akan segera dipasang. Insya Kabupaten Asahan. tare di seberang Graha Asahan Indah Kisaran sampai terjadi di tingkat direksi jumlah itu 3, dan Darmanto kepada juara harapan. telah memecahkan rekor Ra- Allah, dalam 3 hari ini distribusi yang sudah dibebaskan tetapi belum digunakan disetujui, tetapi penerapan di lapangan berbeda, Kadishut Simalungun Amran Sinaga mengatakan, pemerintah Hal sama dinyatakan salah madhan di Asahan danTanjung- listrik akan normal kembali,” satu anggota DPRD Kota Tan- Pemkab Asahan ditanami Sawit oleh PT BSP terjadi korupsi besar-besaran di tingkat staf. dapat bermitra dengan Toba Pulp yang memiliki tim efektif dalam balai, yakni pemadaman listrik pesan Situmeang. menanggulangi kebakaran kawasan hutan, sehingga bisa menekan jungbalai, Tedy Erwin. “ Benar- Tbk, diisukan Bupati Asahan mendapat Rp10 Silahkan publik mempertanyakan dana CSR berlangsung selama 15 jam. Kok juta per bulan dari hasil sawitnya. itu?” tukas Dayat. (csap) luas kebakaran. (rel/m05) benar komplitlah penderitaan bisa ya ? Ada apa ini ? Rahmad F Siregar
  • 19. WASPADA Selasa 1 September 2009 Sumatera Utara 19 600 Masjid Di Labura Dapat 600 Paket MERBAU (Waspada): Sebanyak 600 masjid di Kabupaten Labu- hanbatu Utara (Labura) mendapat 600 paket gula, teh dan kopi Umat Islam Tapteng Buka Puasa Bersama Melepas Tim Safari Ramadhan Di Langkat Diminta Doakan Daerahnya dari H Kharuddinsyah Sitorus alias H Buyung Sitorus, 23 Agustus lalu. Paket itu disumbangkan untuk keperluan tadarus. Salah seorang tokoh masyarakat Desa Merbau Selatan (Marsel), Kec. Merbau, Labura, Khalifah Ali Aman Rambe, mengungkapkan STABAT (Waspada): Bupati Langkat Ngogesa Tangkahan Meranti (Brandanbarat), Masjid Al itu kepada Waspada, Minggu (30/8) melalui selular dari Marsel. Sitepu bersama unsur Muspida, alim ulama, tokoh Rahman Jl Hasan Perak Teluk Meku (Babalan), Sang khalifah menyebutkan, rumah ibadah yang mendapat PANDAN,Tapteng (Waspa- masyarakat dan pemuda mengadakan acara buka Masjid Raya Batangserangan, Masjid Al Ikhsan sumbangan dari tokoh pengusaha itu adalah Masjid Muttadin. da):BupatiTapanuliTengahTuani puasa bersama di Serambi utama rumah dinas Kwalabegumit (Stabat), Masjid Ar-Rahman Na- Sementara menurut Ustadz Ahmad Sampurna MA, Ketua DPD Lumbantobing minta kepada bupati di Stabat, Senin (31/8) malam. motongan (Kutambaru), Masjid Al Ikhlas Kuta BKPRMI Labura terpilih, masjid di Kec. Kualuh Selatan, yang menerima seluruh umat Islam di Tapteng Bupati juga melepas keberangkatan Tim Safari Gajah (Kutambaru), Masjid Al Muhajirin Bukitmas paket adalah Masjid Jami’ Siamporik. agar mendoakan pembangunan Ramadhan yang akan mengunjungi sejumlah (Besitang) dan Masjid Nurul Huda Serangjaya Khalifah Ali Aman didampingi rekannya HM.Temu menyatakan, setiap kali melakukan ibadah. masjid di daerah ini , selama dua hari berturut- Hilir. memberikan sumbangan, bantuan atau santunan sepertinya sudah Diharapkan, pada gilirannya turut, Selasa dan Rabu (2/9). Hari kedua, Rabu (2/9) masjid yang dikunjungi menjadi kebiasaan. berbagaiprogrampembangunan Menurut jadwal, Bupati Langkat Ngogesa tim di antaranya Masjid Al Ikhlas Dsn Mekar Sari Ali Aman mengatakan, figur pengayom seperti H Buyung inilah yang saat ini sedang digalakkan Sitepu bersama unsur Muspida melakukan Safari (Wampu), Masjid Ar-Rahim Kepala Sungai kiranya diharapkan dapat memimpin masyarakat Labura ke depan. Pemkab Tapteng akan berjalan Ramadhan ke Masjid As-Syobirin di Pekan Selesai, (Secanggang), Masjid Nurul Iman DsnVI Sukajadi Kepedulian sosial yang tinggi dari H Buyung sudah merupakan baik sesuai rencana, demi kema- Selasa(1/9)danMasjidJami’ DusunIIIDesaTanjung , (Hinai), Masjid Al Ikhlas Psr VI Kwalamencirim, ciri-ciri dari seorang pemimpin besar. juan pembangunan dan kesejah- Mulia, Kec. Hinai , Rabu (2/9). Sementara Wakil Masjid Istiqomah Pantaigading (Secanggang), Sementara tokoh masyarakat Labura lainnya seperti Burhanuddin teraan masyarakat. Bupati, Budiono menginjungi Masjid Nurul Falah, Masjid Al Hidayah Purwobinangun (Sei Bingei), Nasution alias Obin saat ditemui di Green House (Mess) PBR Jl Hal itu disampaikannya saat Kelurahan Pekan Bahorok dan Masjid Nurul Islam, Masjid Al Mida Sei Rebet Pantaicermin (Tanjung- Padang Matinggi Rantauprapat, juga menampakkan kekagumannya melepas tim Safari Ramadhan Dusun V, Desa Sukamaju, Tanjungpura. pura), Masjid NurulYaqin Desa Jentera (Wampu), kepada H Buyung yang juga anggota DPRDSU itu. Pemkab Tapteng dirangkai de- Masjid-masjid yang dikunjungi tim pada hari MasjidTaqwaSambirejo(Binjai),MasjidArRahman Informal leader ini mengungkapkan, jauh sebelum menjadi ngan buka puasa bersama dan Waspada/Zulfan Nasution pertama, Selasa(1/9) di antaranya Masjid Sabilul Turangi Lama (Salapian), Masjid Baiturrahman anggota DPRD L.Batu apalagi anggota DPRDSU, H Buyung telah shalat berjamaah, Jumat (28/8) BINGKISAN RAMADHAN : Bupati Tapteng Tuani Lumbantobing, Muttaqin, Pelawi Utara (Babalan), Masjid Al Ihksan Alurgadung (Sawitsebrang), Masjid Nurul Qomar membuktikan kedermawanannya dengan membangun jembatan malamdiaulaBinaGraha,Kantor menyerahkan bingkisan Ramadhan kepada tim Safari Dusun Pembangunan (Kuala), Masjid Nurul Sei- LiturTasik ( Sawitsebrang), Masjid Nurul Huda Aek Sipogas-Aek Pinarik dan memberikan santunan tanah wakaf Bupati Tapteng. Ramadhan Pemkab Tapteng untuk dibagikan ke tiap masjid Hikmah, Pangkalanbatu (Brandan Barat), Masjid Tanjungkeriahan (Sirapit), Masjid Nurul Huda di Kampung Getek (Keduanya di Kec. NA IX-X). Banyak lagi infras- Hadir dalam acara itu Ketua yang dikunjungi, Jumat (28/8) malam. Al Ikhlas Sei Dendang (Stabat), Masjid Al Hidayah, Alurdua (Sei.Lepan), Masjid Al ikhlas Kramatjaya truktur jalan yang diperbaiki H Buyung di kawasan Labura lainnya. DPRD Tapteng H. Maratua Sei Limbat (Selesai), Masjid Al Hilal, Paluhmanis Desa Lama (Sei Lepan), Masjid Amanah Beras Jauh-jauh hari juga sebelum menjadi anggota legislatif L.Batu Siregar, Wakil Bupati Tapteng dukungan, doa dan keterlibatan Oktober 2009 setengah badan (Gebang), Masjid Agung Jatisari Padangtualang, Basah (Pangkalansusu), Masjid Baiturrahman ataupun legislatif tingkat Provinsi Sumut, tokoh masyarakat Kec. HMA Effendy Pohan, Ketua MUI komponen masyarakat,” ujarnya. patung mulai dari kepala hingga Masjid Al Huda, Desa Sematar (Bahorok), Masjid Aman Damai (Sirapit), Masjid Al Ikhsan Dsn 1 Merbau, HM, Temu, yang juga dikenal dermawan mengungkapkan Tapteng H Ngadiman KS, Ketua Dikatakan, selama ini masih dada seberat 500 ton akan diang- Al Kautsar Perkb.Perapen (Pematangjaya), Masjid Mintakasih (Salapian), Masjid Asy-Syakirin Dsn secara senada dengan tokoh-tokoh tersebut. TP PKK Tapteng ibu Dina Riama banyak warga Tapteng belum kut dari Bandung menggunakan AtTaqwaPekanKuala,MasjidAlJam’aturruhamma Tahun X Seibamban (Batangserangan) dan Masjid Menurut HM temu, Buyung Sitorus melalui PBR lah yang pertama Br. SamosirTuani LTobing, unsur mengetahui atau kurang percaya, puluhan truk trailer. “Mudah- Bukitkubu Pekan Besitang, Masjid Al Ikhlas Nurul Quran Ds Perdamaian, Kecamatan Binjai. kali mengoperasikan mobil ambulans untuk mengangkut orang Muspida dan Muspida Plus, para bahkan malah mengeluarkan mudahan akhir tahun ini, sudah Lubuktapa,Tanjungputus(Padangtualang),Masjid Masjid-masjid yang dikunjungi tim memperoleh sakit ataupun mengantar jenazah warga ke kuburan secara gratis. pimpinan dan staf SKPD di fitnah terkait program-program dapat dilihat dan dinikmati ma- Sejak pertama beroperasi sekira tahun 2003 lalu dengan satu unit Amaliyah PasiranTimur (Gebang), Masjid Al Falah bantuan masing-masing sebesar Rp 3 juta . (a01) lingkungan Pemkab Tapteng, pembangunan yang saat ini se- syarakat,” jelasnya. ambulans, PBR kini memiliki 4 ambulans guna memudahkan akses warga menggunakan jasa gratis ambulans dimaksud. Kepada ahli musibah yang keluarganya meninggal dunia, Buyung tokoh pemuda dan tokoh agama dari berbagai keyakinan. “Di bulan suci Ramadhan ini, dang dirintis pemerintah. “Oleh karena itu, kepada tim Seusai sambutan, Tuani me- nyerahkan bingkisan Ramadhan dari Pemkab Tapteng kepada Pedagang Dan Perajin Gelar Pasar Ramadhan Safari Ramadhan Pemkab Tap- Sitorus melalui PBR juga memberikan bantuan kemalangan berupa air mineral, kopi, gula bubuk teh. Sudah tidak terhitung lagi banyaknya warga yang menggunakan jasa gratis ambulans dan menerima hendaknya kaum Muslim men- doakanpembangunandiTapteng teng harus mampu menjelaskan hal tersebut kepada seluruh ja- masjid yang dikunjungi tim . Tim diketuai Wakil Bupati Dekranas L. Batu Di 5 Kecamatan dalamtiapibadahnya,agarkema- maah di masjid-masjid yang di- Tapteng, H. MA Effendy Pohan LABUHANBATU (Waspada) : Pasar Rama- produk baru hasil kreativitas perajin dan ped- bantuan kemalangan itu. mengunjungi 98 masjid di 18 juan ekonomi maupun kemis- kunjungi,” harap Tuani. dhan setiap tahun tetap digelar oleh masyarakat. agang binaan Dekranas, ungkapnya. Bahkan, masyarakat masih mengetahui, sejak dilantik menjadi kecamatan dari 20 kecamatan anggota DPRD L.Batu tahun 2004 lalu, sekali pun H Buyung tidak kinan daerah ini dapat tertang- LanjutBupati,pembangunan Bulan yang penuh berkah dan rahmat itu selalu Sariun warga Urung Kompas Kec. Rantau gulangi segera. Sebab, program Patung Anugerah yang menjadi yang ada di Kabupaten Tapteng dimanfaatkan pedagang dan perajin Labuhan- Selatan yang menggelar dagang makanan dan pernah menerima gajinya untuk keperluannya sendiri. Gaji itu sebagai- mana janjinya saat kampanye, disumbangkan kepada masyarakat pembangunan yang dijalankan, ikon wisata di Bukit Anugerah selama 3 hari sejak 29 Agustus batu untuk menjual hasil produknya kepada Sugiat warga Kelurahan Perdamean yang men- yang kurang mampu. tidak akan tercapai tanpa ada Labuanangin, dijadwalkan hingga 31 Agustus 2009. (a18) masyarakat. jajakan hasil kerajinannya di pasar Ramadhan Gaji itu diberikan kepada SD Mandiri, Lingkungan Tj Makmur, Kegiatan pasar Ramadhan itu tidak pernah kepada Waspada mengungkapkan rasa senang Kelurahan Bandar Durian, Kec. Aek Natas selama 5 tahun. Selain itu, janda-janda miskin juga disinggahi oleh bantuan-bantuan beras Kejari Balige Periksa Staf Ahli absen dilaksanakan Dewan Kerajinan Nasional Kabupaten Labuhanbatu yang diketuai Hj. hatinya. Kita merasa bangga dengan kepedulian dari H Buyung. Adlina T.Milwan. Kali ini, beliau memprogram Dekranas Kab. Labuhanbatu untuk memfasilitasi Lain lagi dengan anak-anak mulai tingkat SD, SLTP dan SLTA, H Buyung membiayai mereka mulai, pakaiannya, buku, alat tulis, Bupati Samosir pasar Ramadhan serentak di lima kecamatan, yaitu Desa Sei Kasih Kec. Bilah Hilir, DesaTanjung pasar Ramadhan tahun ini, dimana fasilitas seperti tenda, kursi, meja, dan lampu dipasilitasi biaya sekolahnya dan biaya-biaya yang timbul lainnya. Sarang Elang Kec. Panai Hulu, Desa Tanjung dekranas. Kita pedagang hanya dikenakan biaya Dengan aneka bantuan dari segenap kepedulian sosial dan SAMOSIR ( Waspada): terkait proyek 2007. berikan jawaban. Harapan Kec. Pangkatan, Desa Kampung Dalam listrik dan kebersihan. Itu pun yang mengelola kedermawanan itu, tidak heran apabila tokoh-tokoh seperti Khalifah Kejaksaan Negeri (Kejari) Balige Kasi Pidsus Kejari Balige Mantan Kadis PU itu Kec. Bilah Hulu, dan Kelurahan Perdamean bukan dekranas, papar mereka. Ali Aman Rambe, Ustadz Ahmad Sampurna MA, Obin, HM Temu bagian Pidana Khusus (Pidsus) Nelson Sembiring,SH kepada saat ditanya Waspada terkait Kec. Rantau Selatan. Kegiatan ini tentu tidak terlepas dari program dan warga lainnya hafal akan sosok H Buyung yang telah berbuat memeriksa staf ahli bupati Waspada, Senin (31/8) menga- pemeriksaan atas dirinya, tidak “ Pasar Ramadhan 1430 H Tahun 2009 ini dekaranas yang diketuai oleh Hj. Adlina T. Mil- kepada orang banyak dan populer sebelum adanya pemilu ataupun DR.Ir. AS yang sebelumnya takan, mantan Kadis PU Samo- memberikan komentar. digelar dari tanggal 22 Agustus sampai dengan wan. Dan pasar ramadhan ini setiap tahun dige- pilkada. (a27) pejabat Kadis PU Kab. Samosir, sir itu diperiksa Kejari Balige Sementara,Wakil Ketua LSM 18 September, “ papar Sekretaris Dekranas Kab. lar. Jadi sangat membantu kita para pedagang pekan lalu. Untuk lebih lanjut, Perjuangan Hukum dan Politik Labuhanbatu M.Dariyaksa, SE kepada Waspa- dan perajin kecil, papar mereka. kata Nelson kepada Waspada, (PHP) Kab. Samosir Charles Tim Safari Ramadhan DS Kunjungi 22 Kecamatan tanyakan saja kepada Jaksa Pemeriksa Pidana Khusus Kejari Rumapea, SE kepada Waspada, Senin (31/8) meminta kepada da, Minggu, (29/8) saat mengunjungi pasar Ramadhan di Kelurahan Perdamean. Kami tahu ibu Hj. Adlina Milwan dekat dengan rakyat kecil. Sebab kitapun walau jelek- LUBUK PAKAM (Waspada): H Azwar S, MSi (Ketua) dan Kadis Batu dan Pagar Merbau. Sebab, pasar Ramadhan merupakan salah jelek gini sudah pernah lho salaman dengan Balige Erwin Napitupulu,SH. Tim Jaksa Kejari Balige tidak Bupati Deliserdang H AmriTam- PerindagIrHMarapintaHarahap, Tim VII dipimpin Kadis satu visi dan misi Dekranas dalam melakukan pak Bupati dan ibu bupati, paparnya seloroh. Saat dikonfirmasi, Senin pandang bulu dalam penanga- bunandalamsuratkeputusannya MM.MAP (Wakil Ketua) dengan Kesehatan dr Masdulahq Siregar, pembinaan dan ajang promosi hasil kerajinan Jadi, kalau ibu maju mencalon bupati, kita ber- (31/8), Jaksa Pemeriksa Pidsus nan kasus dugaan korupsi demi telah membentuk tim Safari anggota Pl Kadis Infokom Meiber SpOG(K) MHA (Ketua) dan para perajin dan pedagang kecil kepada masya- keyakinan peluang itu itu sangat besar untuk Kejari Balige Erwin Napitu- terciptanya azas transparansi Ramadhan Kabupaten Deliser- Sitompul SE, Kabag Hukum Red- Kabag Perekonomian Drs H rakat yang selama ini belum mengenal produk- meraih kemenangan, ungkap Sariun. (a26) pulu,SH belum bersedia mem- dan akuntabilitas. (c10) dang tahun 2009 M/1430 M. win, SH, Kakan Penanaman ZainalArifin(WakilKetua)dengan Tim berjumlah 66 orang Modal Prayitno, SH, Ketua IPHI anggota Pengurus Muhamma- dibagi dalam 11 kelompok tim, DrsHErwinNurdinPelos,Kasub- diyah H Waluyo, Pengurus IPHI dan setiap tim masing-masing bag RT-Protokol dan Drs HYusuf, H Sulaiman Hasibuan dan Drs akan mengunjungi dua masjid MA (penceramah) mengunjungi Jasman (penceramah) mengun- di dua wilayah kecamatan dimu- Kec.Pagar Merbau dan Batang- jungi Kec.Biru-Biru danTanjung- lai hari ini Selasa (1/9) dan Rabu kuis. morawa. (2/9). Tim III dipimpin Pl Asisten TimVIII dipimpin Kadis Peri- Dalam kunjungan ke seluruh I/Ketua Bappeda Ir H Irman Dj kanan dan Kelautan Ir H Roniazir kecamatan (22 kecamatan-red), Oemar,MSi (Ketua) dan Kadis AH (Ketua) dan Drs H A Rukman tim selain memberi penyuluhan Pertanian Ir H Wirdan Yusuf Ra- Pane (Wakil Ketua) dengan tentang pemerintahan, pemba- ngkuti (Wakil Ketua), Kabag Pe- anggota Kacab BRI Lubuk Pakam ngunan dan kemasyarakatan merintahan Umum Drs HM D.Suryahadi, Pengurus IPHI H kepada masyarakat khususnya Amin Daulay (wakil Ketua) de- OK Khairul Adenin dan Drs Abd jamaah shalat Tarawih sekaligus ngan anggota Pengurus IPHI Drs Manan Jamil (penceramah) me- juga menyampaikan ceramah H Amri Siregar dan Drs H ngunjungi Kec.Beringin dan agama yang berkaitan dengan Lukmanul Hakim Siregar (pence- Patumbak. pelaksanaan ibadah puasa serta ramah) mengunjungi Kec. Percut Tim IX dipimpin Staf Ahli menyerahkan paket Sei Tuan dan Lubuk Pakam. Bupati Ir Zulkifli Nasution (Ketua) Bupati Deliserdang H Amri Tim IV dipimpin Kadis Kope- dan Kadis Kebudayaan dan Tambunan dan Wabup H Zai- rasi H Kali Paruhum Pane, SE dan Pariwisata Drs Iqbal Nasution nuddin Mars selaku Ketua dan Kabag SDA Ir Ramlan Refis (Wa- (Wakil Ketua) dengan anggota Wakil Ketua tim I bersama ang- kil Ketua) dengan anggota Staf Ketua KPU Drs M Yusri MSi, Pe- gota Kapolres AKBP Mashudi, Kantor BPN Ediwan, BSc, Pengu- ngurus IPHI Ir H Ali Tambunan SIk.MH,DanDim0204/DSLetkol rus NU Abd Rahman dan Drs dan Drs Hapnan Simbolon (pen- Inf Herianto Syahputra SIP Dan, Rijaluddin Dasopang (pencera- ceramah) mengunjungi Kec.Deli Yon 121/MK Letkol Inf DwiTugas mah) mengunjungi Kec. Namo- Tua dan Bangun Purba.Tim X Irianto, Kajari L.Pakam Tambok rambe dan Kutalimbaru. dipimpin Kadis Kehutanan Ir Arli Nainggolan SH, Ketua PN L. TimV dipimpin Kadisdikpora MSi (Ketua) dan Kadis Perhubu- Pakam Sudaryadi SH, Ketua Drs Sofian Marpaung, MPd (Ke- ngan Ir Saleh Idoan Siregar (Wakil DPRD H Wagirin Arman, Ketua tua) dan Sekwan DPRD Drs H Ketua) dengan anggota Kacab PA Drs H.Abd Hamid Pulungan, Rahmad Nasution MA (wakil BNI Lubuk Pakam Liansyah, SIp Asisten III Setdakab H Irham Ketua) dengan anggota Kabad dan Drs Ismail Husin (pencera- Dinni Nasution S.Sos, Kaban Pembangunan Ir Anda Subrata mah) mengunjungi Kec.Gunung Kesbang Drs H Eddy Azwar, Kadis dan Abd Razak Hamzah, SAg PU Ir Faisal, Kakandepag HWan (penceramah) mengunjungi Kec. Meriah dan STM Hulu. Iwan Zulhami, SH. MAP Kabag , Hamparan Perak dan Sibolangit. Tim XI dipimpin Kadis PKD Kemasyarakatan Drs H Herman- Tim VI dipimpin Staf Ahli Parlaungan Lubis, SH.MSi syah, Staf Dinas Infokom Sarjan Bupati Drs H Paraduan Siregar (Ketua) dan Kadisdukcapil Drs Rambe S.Sos dan Drs H Majahid- (Ketua) dan Kadis Sosial Drs H H Abdul Malik Dalimunthe duddin (penceramah) pada hari Susmono (Wakil Ketua) dengan SH,MM (Wakil Ketua) dengan pertama Selasa (1/9) mengun- anggota Kacab Bank Sumut Lu- anggota Kakan Perpustakaan Drs jungi kecamatan Pantai Labu dan buk Pakam Armansyah Dali- Ridwan Said Siregar dan Drs H hari kedua Rabu (2/9) mengun- munthe, Pengurus IPHI H Anwar Mansyur BR (penceramah) me- jungi Kecamatan Galang. dan KH Husin Kasim (pencera- ngunjungi Kec.Labuhan Deli dan TimIIdipimpinSekdakabDrs mah) mengunjungi Kec.Pancur STM Hilir. (a05)
  • 20. 20 Sumatera Utara WASPADA Selasa 1 September 2009 PT MAI Portal Jalan Umum, Pemkab Palas Lamban Dan Lembek P.SIDIMPUAN (Waspada): Portal itu dijaga ketat security perkebunan di luar PT MAI dan dilakukanPTMAIatasdasar,jalan meliharaan jalan. Kata Rustam, “Saya heran, kenapa Pemda Bantah Lagi soalpemortalanjalanumumyang Pemkab Padang Lawas terlalu PTMAIdandikawalaparatnegara masyarakat pemilik kebun sangat sepanjang 9,7 kilometer itu, portalitutidakberlakubagisemua membela orang seperti itu,” ujar Sementara itu Camat Huta- merugikan masyarakat banyak. lamban dan lembek menyikapi yang seharusnya mengayomi kesusahan untuk menjual hasil pemeliharaannya diserahkan warga. Tapi hanya untuk PT HSC Rustam balik bertanya, seraya raja Tinggi, Gunungtua Hamo- Kemudian akan berlanjut pada pemasangan portal di jalan rakyat. Setiap kendaraan yang kebunnya. Karena harus lapor Pemkab Tapsel kepada mereka. dan R Hutapea selaku pemilik masih berharap Pemkab Palas nanganDaulay,kepadawartawan yang lainnya, termasuk me- umum oleh PT Mazuma Agro melintas dan membawa hasil dan setor uang, barulah portal Pihaknya selaku pengguna kebundisekitarnyadanpengguna mau memfasilitasi musyawarah via telefon mengatakan, Pemkab nyangkut keberadaan perusa- Indonesia (MAI) di Desa Sungai kebun selalu dihentikan dan dibuka. jalanbersediadanberharapperu- jalan itu. penyelesaiannya. Palas akan menggugat PT MAI haan itu. (a20) Korang, Kec.Hutaraja Tinggi. dimintai uang dengan alasan “Dari aspek hukum, tidak ada sahaan lainnya yang memanfaat- Padahal, musyawarah yang untuk pemeliharaan jalan. alasan bagi PT MAI untuk me- kan jalan berpartisipasi. Awalnya difasiltasi Pemkab, antara perusa- Padahal jalan merupakan mortal jalan umum. Perbuatan partisipasiberjalanlancar,namun haan dan pemilik kebun sawit jalan umum milik pemerintah. itu telah melanggar UU tentang sejak 2,5 tahun (periode 2007, yang memprotes PT.MAI, sudah Hanya saja PT MAI beralasan jalan dan sudah melakukan pe- 2008 dan Mei 2009) pembayaran tercapaikatasepakatuntukmem- merekalah yang memeliharanya mungutanliar(pungli).Jadisudah dana partisipasi macat. buka portal itu, Rabu (29/7). Na- sesuai MoU yang dibuat dengan selayaknyadipidanakan,”ujarTris “Mereka tidak mau lagi mun PT MAI tidak juga mengin- PemkabTapanuliSelatansebelum Widodo yang juga Sekretaris Ika- membayarnya dan kita dituding dahkannya. Pemkab Palas dimekarkan. tan Advokad Indonesia (IKADIN) mengakal-ngakali perkalian Tris Widodo, SH, Humas PT “Kenapa harus PT MAI yang Tapanuli Bagian Selatan. partisipasi itu. Padahal kalkulasi Hasilindo Sawita Ciptama (HSC), menerima penyerahan pemeli- Pemkab Palas diminta segera beban biayanya sangat jelas dan perusahaan yang mengajukan haraannya, itu merupakan satu menindak tegas sikap PT MAI perhitungannya tidak ada yang protes keberatan atas pemortalan hal yang wajar. Pasalnya, ken- yang melakukan pemortalan ditutup-tutupi,” katanya. itu ke Pemkab Palas, mengatakan daraan PT MAI lah yang paling jalan umum. Apalagi unsur Mus- Karenanya, untuk menekan itu di Padangsidimpuan, Senin banyak menggunakan jalan pida dalam musyawarah terakhir agar PT HSC dan pemilik kebun (31/8). tersebut.Lagipun,kitadanpemilik membahas masalah itu, telah R Hutapea mau membayar parti- Menurutnya, sikap arogansi kebun lain siap berpartisipasi menyatakan dukungannya ter- sipasi dana pemeliharaan jalan diperlihatkanmanajemenPTMAI sesuai tingkat pemakaian jalan,” hadap Pemkab apabila melaku- tersebut, PT MAI memortal jalan. sudahterlaluberlebihandantidak katanya. kan tindakan berupa pembong- Ditanya kenapa mereka melakukan pemortalan jalan dapat ditoleransi. Karena pemor- JikaPemkabPalastidaksegera karan portal. umum. “Siapa bilang itu jalan talanjalanumumitubenar-benar menindaknya, dikhawatirkan Bantah umum, kami yang melakukan mengganggu dan menyengsa- dapat menimbulkan konflik hori- General Manajer PT MAI pemeliharaan jalan dan sampai rakan masyarakat. zontal. Pasalnya, jalan umum Rustammembantahkalaupihak- sekarang belum pernah melihat Paling sengsara adalah peru- yang diportal itu merupakan nya bermaksud sewenang-we- Perda yang menyatakan itu jalan sahaan perkebunan kelapa sawit, satu-satunya akses transportasi nang dan melecehkan segenap umum,” ujarnya balik bertanya. pemilikkebunsawitdanmasyara- untuk keluar dan masuk wilayah unsur Muspida Palas terkait Disinggung mengenai kesu- kat yang berdomisili serta bekerja itu. pemortalan. litan dialami warga lainnya jika di sejumlah perkebunan sekitar Akibat pemortalan dan pe- Kepada wartawan via telefon melintasi pemortalan itu dan lokasi PT.MAI. ngawalan ketat itu, perusahaan diamengatakan,pemortalanjalan harus membayar partisipasi pe-
  • 21. WASPADA Selasa 1 September 2009 Sumatera Utara 21 Adik Bupati Tapsel Bantah Ancam Kasek Mahasiswa Kawal Eksekusi Register 40 MEDAN (Waspada): Kelom- Agung (MARI) No. 2642/K/PID/ ploitasi kekayaan alam negara, pok mahasiswa yang aktif men- 2006 dalam eksekusi itu, maka kita pro aktif mendiskusikan P.SIDIMPUAN (Waspada): tidak benar,” katanya. kerja. Tapsel agar bisa memperoleh dorong dan memantau pelak- akan dilakukan tahapan-tahapan masalah ini,” tandasnya. Anggota DPRD Tapanuli Selatan Menurutnya, isu itu sengaja “Hasilnya, dari 20 lebih proyek. sanaan eksekusi Register 40, siap eksekusi di lapangan. Dia juga menyatakan tegas, dari Partai Demokrat, Moham- ditiupkan orang yang takut ter- kepala sekolah yang berulang- “Saya menyadari, jika saya mengawalnyauntukkepentingan Yang pertama adalah peng- jangan ada skenario dan konspi- mad Ike Taken Hasibuan MT, ganggu, karena punya rencana kali saya datangi, cuma satu yang melakukan itu maka akan me- rakyat serta negara. ambilalihanmanajemenlangsung rasi lagi. Gema Padang Lawas (foto) adik kandung Bupati busuk untuk meraup keuntu- mau bermitra dengan saya dan rusak nama baik dan kredibilitas DemikiandisampaikanKetua oleh negara pada perusahaan meminta kepada seluruh pihak Ongku P Hasibuan, menegas- ngan pribadi. Dia heran, isu itu selebihnya mengaku sudah pu- abang saya selaku Bupati Tapsel. Umum Pengurus Pusat Gerakan yang terdapat dalam wilayah pemerintah dan pihak terkait kan, tidak pernah mengancam justru sangat cepat berkembang nya mitra. Saya tidak pernah Saya tidak pungkiri, pernah Mahasiswa Padanglawas (PP eksekusi termasuk PT Torganda termasuk perusahaan agar tidak orang di Dinas Pendidikan dan dan bersumber dari Disdik. memaksa atau marah, karena minta tolong kepada pimpinan Gema Palas) Ansor Harahap di- dan Koperasi Bukit Harapan. melakukan skenario dan kons- para kepala SD agar dapat pro- Kepada para kepala sekolah, itu hak mereka. Tak percaya, SKPD, tetapi sebatas yang wajar dampingi pengurus Ahmad “Kita akan terus mengawasi dan pirasi di balik layar yang mem- yek pembangunan dari Dana Ike meminta agar menolak dan tanyakan saja langsung,” kata dan tidak pernah memakai Habibi Dalimunthe dan Jabal mengkritisi setiap proses dan pengaruhi kemurnian proses Alokasi Khusus (DAK) 2009. bila perlu mengusir siapa saja Ike. perantara,’’ ujarnya. Siregar, Minggu (30/8) menyikapi tahapan lanjutan eksekusi terse- hukum dan keberpihakan terha- “Saya juga tidak pernah me- yang datang minta kerjasama Dia heran diisukan telah Jika butuh pertolongan, eksekusi simbolik Register 40 di but demi terkawalnya kepenti- dap kepentingan rakyat dan KantorKejaksaanTinggiSumatera ngan umum yang lebih banyak,” negara dalam pelaksanaan ekse- nyuruh orang lain untuk mela- proyek DAK dengan cara meng- mengkapling 20 paket DAK tambahnya, dia pasti datang kusi ini, baik dalam pengam- kukan itu,” paparnya kepada gertak, menjual-jual nama, karena posisinya sebagai adik langsung menyampaikannya. Utara (Kejatisu), di Medan, 26 kata Ansor. Agustus 2009. Ansormengatakan,inibukan bilalihan manajemen atau aset wartawan di Padang Sidimpuan, anggota LIRA, GIB, Pers, LSM, bupati. Jangankan 20, untuk ‘’Saya juga mengikuti prosedur register. Sabtu (29/8). maupun organisasi lain. mendapatkan yang satu itu saja sebagaimana orang lain,” Eksekusi dilakukan Kejatisu akhir dari perjuangan mahasiswa Sudah terlalu banyak keru- Ike yang juga Ketua Dewan Ike tidak memungkiri jika sudah sangat sulit, ujarnya sem- tegasnya. selaku eksekutor disaksikan dan pemuda terhadap masalah gian negara dan rakyat akibat pendekatan secara profesional Penasihat DPD Lumbung Infor- dia sendiri melakukan pendeka- bari menyebut itupun akan Kepada seluruh pimpinan Gubsu H Samsul Arifin, pihak Register 40, tetapi baru salah satu persoalan register ini. Dimohon dan tanpa didasari unsur paksa- perusahaan, Muspida plus dan titik keberhasilan yang membu- masi Rakyat (LIRA) Tapsel, tan kepada para kepala sekolah an. Apalagi selaku sarjana teknik terpaksa dilepasnya jika ternyata SKPD di PemkabTapsel, Ike min- kepada pemerintah dan kepada membantah telah menyuruh agar bisa dihunjuk sebagai mitra menyalahi kedudukannya ta agar tidak takut terhadap orang instansi serta pihak terkait, meski tuhkan pengawalan yang lebih siapa pun agar sama-sama peka sipil, dia merasa mampu untuk ada penolakan mengatasnama- ketat dan terarah lagi. orangnya maupun dari LIRA kerja paket proyek DAK. “Sebe- sebagai anggota DPRD Tapsel. yang menggertak dan menga- dan peduli terhadap persoalan melaksanakan proyek DAK itu. kan pemuda dan masyarakat di “Kita tidak ingin pemerintah ini, bukan malah mengambil ke- mendatangi para kepala sekolah lum dilantik jadi anggota DPRD Selain bermohon, Ike juga Mohammad Ike Taken tasnamakan adik bupati untuk sekitar wilayah register 40. jadi kapitalis kedua setelah peru- sempatan yang dapat merugikan agar dijadikan mitra. Tapsel, saya mendatangi bebe- menjelaskan apa dan bagai- Hasibuan mantan Dosen Uni- mendapatkan proyek. (a20) Sesuai putusan Mahkamah sahaan yang selama ini mengeks- rakyat, kata Ansor. (m34) “Di Disdik saya disebut telah rapa sekolah dan rumah kepala mana sebenarnya DAK itu. Ke- versitas Sriwijaya dan pernah mengkapling 20 paket DAK. sekolah untuk bermohon agar pada para kepala sekolah dia bekerja di berbagai perusahaan Saya juga diisukan mengancam dijadikan mitra kerja,” katanya. memberitahu apa dasar kerja- swasta menegaskan, dirinyaa kepala sekolah, dan jika tidak Hal seperti itu, sebutnya, sama dengan pihak ketiga, dan tidak pernah memaksakan ke- mengikuti kemauan saya maka merupakan hal yang wajar. Ka- cara-cara seperti apa yang pada pimpinan dinas, kantor, akan dicopot. Itu sama sekali rena yang dilakukan adalah ditempuh agar bisa bermitra dan badan manapun di Pemkab
  • 22. Aceh 22 B. Aceh, Sigli, Bireuen, Lhokseumawe WASPADA Selasa 1September 2009 Jamaah Tarawih Menciut Tangkap Residivis, 10 Ha PEUSANGAN (Waspada): Camat Peusangan, Anwar, BA mengatakan sangat sedih melihat jamaah tarawih Ladang Ganja Dimusnahkan di masjid besar Matang Glumpang Dua Peusangan mema- BIREUEN (Waspada): Berawal peroleh dari DPO bernama Nyak suki malam ke sepuluh Ramadhan jumlahnya menciut. dari penangkapan seorang residivis, Di, 27, warga desanya, setelah di- Kesedihan itu diungkapkan Camat alam memberi jajaran Polres Bireuen berhasil me- kembangkan lagi di rrumah Nyak sambutan menyambut kedatangan tim-3 Safari Rama- musnahkan 10 hektar ladang ganja Di, polisi menemukan setengah dhan Kabupaten Bireuen, Minggu (30/8) malam. di kawasan perbukitan Desa Pante kilogram ganja dan beberapa ba- Menurut Camat, malam pertama hingga malam Karya, Kecamatan Peusangan rang siap saji di rumah DPO tersebut. kelima Ramadhan jamaah tarawih memadati masjid. Siblah Krueng. “Nyak Di berhasil kabur, saat Kaum laki-laki mencapai delapan saf, kaum ibu enam Hal tersebut disampaikan Ka- anggota lapangan Polsek Peusang- saf. Saya sangat sedih melihat jamaah tarawih menciut polres AKBP T. Saladin, SH melalui an melakukan penggerebekan,” drastis, papar Camat. Kapolsek Peusangan Ipda Benny kata Benny sembari menambah- Dikatakan, Ramadhan bulan penuh rahmat dan Cahyadi, saat berlangsungnya kon- kan, informasi lain mengatakan, magfirah untuk beribadah kepada Allah. Beribadah ferensi pers di Aula Mapolres Bi- ganja tersebut ditanam di kawasan di bulan Ramadhan memiliki kelebihan-kelebihan yang reuen, Senin (31/8). pegunungan Pante Karya. tidak terdapat di bulan lain. Kata Benny, 10 hektar ladang “Menerima laporan itu kita Ramadhan akan cepat berlalu dan kita semua belum ganja tersebut dimusnahkan dari langsung bergerak ke lokasi, dan tentu dapat bertemu kembali dengan Ramadhan yang tujuh titik di kawasan pegunungan kita temukan 10 hektar ladang akan datang, kata Camat Anwar.(b16) Pante Karya dan Lebok Setui de- ganja di tujuh titik. Di lapangan kita ngan jumlah kekuatan 40 personil sempat memergoki ayah Nyak Di Mulia Orang Yang Cinta Masjid dari Polsek Peusangan, Polres Bi- reuen dan Pospol Peusangan Sela- (DPO), tapi saat hendak ditangkap melarikan diri ke tengah hutan. Ki- Dan Menyantuni Anak Yatim tan dan Peusangan Siblah Krueng. “Penemuan ladang ganja itu ta juga memasukkan ayah Nyak Di sebagai DPO,” terang Kapolsek PEUSANGAN (Waspada): Orang-orang yang sangat merupakan hasil pengembangan Peusangan itu lagi. mulia adalah orang-orang yang cinta masjid dan me- pemeriksaan terhadap residivis Maenurut Kapolsek, Er menga- nyantuni anak yatim. Nusa Kambangan berinisial Er bin ku pernah ditahan di LP Nusa Konon lagi bulan suci Ramadhan memiliki kelebi- SB, 35, warga Desa Meunasah Timu, Kambangan selama sepuluh tahun han istimewa, Allah akan melipatgandakan pahala ke- Kecamatan Peusangan yang ber- dalam kasus ganja pada 1999. “Un- pada orang-orang yang bertaqwa melaksanakan ibadah, profesi sebagai kurir ganja. Dari Er tuk Er kita kenakan Undang-Un- bersedekah dan menyantuni anak yatim. Waspada/Irham Hakim kita sita delapan amplop ganja de- dang no. 22 tahun 1997 tentang Demikian antara lain penceramah tim-3 Safari Ra- POHON GANJA: Dari 10 hektar ladang ganja yang berhasil dimusnahkan jajaran kepolisian Bireuen, 150 batang ngan harga Rp5 ribu per amp, serta Narkotika dengan hukuman lima madhan Kabupaten Bireuen Drs. H. Sulaiman Al Fasyimi pohon ganja dibawa ke Polres untuk dijadikan barang bukti. uang hasil penjualan Rp25 ribu tahun penjara,” demikian Kapolsek dalam ceramahnya usai shalat tarawih di masjid besar pada 26 Agustus 2009.” kata Benny. Peusangan Ipda Benny Cah- Matang Glumpang Dua Peusangan, Minggu (30/8) Dari pengakuan Er, ganja di- yadi.(cih) Mantan Bupati Pidie malam. Kecintaan hati memakmurkan masjid dan menyan- tuni anak yatim menjadi kewajiban kita semua sebagai upaya menegakkan Syari’at Islam secara kaffah di Aceh Angin Kencang Landa umumnya dan Kabupaten Bireuen khususnya. Sulaiman Al Fasyimi mengatakan, maju mundur- Pidie Dan Pidie Jaya nya Islam sangat tergantung kepada umat Islam itu sendiri dalam melaksanakan perintah Allah dan me- ninggalkan segala larangannya. Untuk menegakkan Syari’at Islam harus cinta masjid serta mengajak generasi muda meningkatkan Divonis Bebas MEUREUDU (Waspada): Pulu- han pohon dan tiang listrik tum- bang. Puluhan rumah warga dila- porkan hancur akibat dilanda angin kencang yang melanda kawasan hancur dihantam angin kencang, sebagian besar roboh terutama yang berada di pesisir Pantai Aron dan Kiran. Selain itu puluhan bahkan ibadah di bulan suci Ramadhan, bertadarus membaca SIGLI (Waspada): Pengadilan alasan banyak masyarakat meng- negara senilai Rp57.150.000. Al Quran di masjid-masjid dan meunasah-meunasah Kabupaten Pidie dan Pidie Jaya.. ratusan pohon tumbang. Di Desa Negeri (PN) Sigli, memvonis bebas ungsi akibat konflik. Selain memvonis bebas mantan ketimbang keluyuran yang tidak ada mafaatnya.(b16) Karena itu para anggota dewan bupati dan wakil bupati Pidie priode Tiang listrik yang tumbang itu Jurong, Kecamatan Meurah Dua, mantan Bupati Pidie Ir. H. akan membagi dana itu kepada rak- 2001-2007, PN Sigli juga membebas- di lintasan Kecamatan Simpang dilaporkan rumah milik Rohana Tiga-Kembang Tanjong, menye- rusak berat tertimpa pohon kelapa. Calhaj Bireuen 237 Orang Abdullah Yahya, MS dan wakilnya Drs. H. Djalaluddin Harun pada yat untuk membeli daging meugang. Kendati dalam penyaluran dana kan mantan Sekda Pidie Ir. Imran Usman dari tuntutan tindak pidana babkan sejumlah kawasan Sim- Begitu juga rumah Syarifuddin Ilyas BIREUEN (Waspada): Calon haji Kabupaten Bireuen tersebut beberapa anggota dewan korupsi. Sidang terpisah itu di- pang Tiga, Kembang Tanjong dan dan Ratnawati, di Desa Jurong Ara, sidang Tindak Pidana Korupsi Glumpang Baro gelap gulita 20 jam Jangka Buya rusak tertimpa pohon. yang sudah melunasi BPIH (Biaya Pemberangkatan tidak menyalurkannya, sehingga pimpin Hakim Ketua Zulfikar, Ibadah Haji) sampai batas pelunasan akhir 26 Agustus, (Tipikor), Senin (31/8). harus mengembalikan uang itu ke SH.(b20) lebih. Ruas jalan ke lintasan terse- Sementara di Desa Meuko 237 orang. but sempat ditutup sejak maghrib Kuthang, Ulee Gle, Kecamatan Para Calhaj yang sudah melunasi BPIH Insya Allah hingga perbaikan selesai dilakukan Bandar Dua, sebuah bangunan dipastikan berangkat menunaikan ibadah haji ke tanah Sidang dipimpin hakim ketua Said pihak PLN Cabang Sigli. porak-poranda. Jaringan telepon suci musim haji tahun ini. Kakan Depag Bireuen Drs. Husen, SH. Menurut majelis hakim, Keterangan yang diperoleh, dan listrik di depan SMPN 1 tertim- H. Zulhelmi, M.Ag menjelaskan hal itu menjawab Was- bedasarkan bukti-bukti yang ada serta badai menghantam sebagian wila- pa pohon cemara. pada di kantornya, Senin (31/8). keterangan para saksi, terdakwa tidak yah Pidie itu terjadi sejak pukul 16:30, Untuk meringankan beban Dikatakan, para Calhaj yang sudah melunasi BPIH memenuhi unsur melakukan tindak Jumat (27/8) dan sekira pukul 18:30 dan mengatasi suasana panik, melalui Bank BNI Bireuen 158 orang, BRI 54 orang, Bank pidana penyalahgunaan dana tak ter- tiang listrik tumbang, ungkap warga Pemkab Pidie Jaya melalui Satkor- Mandiri 15 orang dan Bank Pembangunan Daerah sangka APBD Pidie tahun 2002 senilai kepada Waspada, Sabtu (29/8). lak membantu para korban yang (BPD) 10 orang. Rp7,7 miliar lebih. Disebutkan, peng- Angin kencang yang juga me- rumahnya rusak. Selama tiga hari Kuota Clhaj Kabupaten Bireuen diberikan satu ke- gunaan dana tak tersangka tersebut landa Pidie Jaya, menyebabkan pu- langsung turun ke lapangan, diren- lompok terbang (Koter) 328 orang. Untuk memenuhi berdasarkan Surat Keputusan Otorisasi luhan bangunan di Kecamatan canakan hingga Senin (31/8). kuota masih bisa menampung 83 Calhaj dari Kabu- (SKO). Jangka Buya hancur. Musibah seru- Sebelumnya, bantuan tanggap paten lain, ujar Zulhelmi.(b16) Lagi pula terdakwa dalam menja- pa menimpa sejumlah pemukiman darurat berupa uang kontan, disa- lankan roda pemerintahan, saat itu di kecamatan lainnya. Sejauh ini lurkan kepada tiga kepala keluarga Aceh dilanda konflik. Sehingga untuk Pembinaan Akhlak Bagi menjalankan roda pemerintahan da- belum ada laporan korban jiwa. Data yang diperoleh, di Keca- (KK) melalui camat tiga kecama- tan, Trienggadeng, Meurah Dua lam menggunakan anggaran tak ter- Pelajar Sangat Penting sangka, sebelumnya terdakwa me- matan Jangka Buya 34 bangunan dan Ulim. melalui Satkorlak.(b21) lakukan konsultasi dengan pimpinan BIREUEN (Waspada): Pembinaan akhlak bagi pelajar sejak dini sangat penting. Karena pelajar marupakan gene- rasi calon pemimpin masa depan. Tanpa memiliki akhlak dewan. Hal itu juga sesuai permintaan pim- 25 Anggota DPRK Pidie Jaya dan pengetahuan agama yang selaras, generasi calon pemimpin mendatang akan mudah terombang-ambing. pinan DPRD Tgk. Yusri Ahmad untuk merestui penggunaan anggaran dana tak tersangka kepada pimpinan dan Waspada/Muhammad Riza Diminta Lebih Transparan Kepala SMPN-4 Bireuen Bahrol Walidin, S.Pd me- anggota dewan dengan jumlah dana SIDANG: Mantan Bupati Pidie Ir. H. Abdullah Yahya, MS divonis bebas atas MEUREUDU (Waspada): Ber- Manaf dan Ketua Pengurus Daerah nyampaikan hal itu saat menutup pesantren kilat, Sabtu masing-masing Rp10 juta, dengan kasus korupsi di Pengadilan Negeri (PN) Sigli, Senin (31/8). bagai elemen masyarakat terdiri (PD) Muhammadiyah Kabupaten (29/8). Kasek berharap bimbingan pengetahuan agama yang diperoleh selama seminggu tentang ibadah, akh- dari organisasi sosial, kemasyara- Pidie Jaya, Drs. A. Wahab Ahmad. lak, tauhid, tasauf dan wirit yasin (baca al Qur’an) harus diamalkan di tengah-tengah keluarga sendiri dalam 20 Anggota DPRK Sabang Dilantik katan, keagamaan dan lembaga adat mengharapkan sekaligus me- minta 25 anggota Dewan Perwaki- Wahab Ahmad berharap, DPRK dapat mendorong lahirnya qanun prioritas berkaitan langsung kehidupan sehari-hari, agar menjadi generasi berkua- litas. Peliharalah dirimu dan keluargamu dari sisksa SABANG (Waspada): Ketua Peng- si pengawasan bukan berarti sebagai tem pemerintahan. lan Rakyat Kabupaten (DPRK) Pidie dengan kebutuhan masyarakat, se- api neraka, pinta Kasek. adilan Negeri Sabang, Makmur, SH atas manuver untuk mencari kesalahan Anggota DPRK Sabang periode Jaya yang dilantik Selasa (25/8) lalu, perti qanun pendidikan sebagai Asri, S.Pd, koordnator Pesantren kilat menjelaskan, nama Ketua Mahkamah Agung RI me- dan kelemahan eksekutif, kata 2009-2014 yang dilantik terdiri Zul- agar lebih transparan terhadap acuan Restra pendidikan dalam pesantren kilat diikuti 109 peserta. Sebagai pemateri guru- lantik 20 anggota DPRK Sabang masa Husaini. kifli H. Adam (Partai Aceh), Nazarud- publik. rangka kualitas pendidikan di Ka- guru SMPN-4 Bireuen dibantu beberapa guru Dayah bakti 2009-2014 di gedung dewan, Snin Sementara pimpinan dewan se- din (Partai Aceh), Hasan Basri (Partai Kepada mereka juga diminta bupaten Pidie Jaya. “Qanun yang (pesantren) Darus Istiqamah dan Darussakdah.(b16) (31/8). mentara, Zulkifli H. Adam mengha- Aceh), Tgk. Kamaruzzaman (Partai Ketua DPRK Sabang periode 2004- rapkan masyarakat Sabang memberi lebih membuka akses informasi bersentuhan langsung terhadap Aceh), Abdullah Imum (Partai Aceh), transparansi anggaran sehingga masyarakat perlu diutamakan se- 2014, H. Husaini mengatakan, mema- dukungan seperti yang telah diberi- Abdul Manan (Partai Aceh), Hj. Cut Disperindagkop Gelar Pasar Murah suki masa purnabakti ia berharap ang- kan kepada anggota dewan lama. Yulita Darwin (Golkar), H. Abd. Wa- publik ikut berpartisipasi dalam pembangunan. Demikian antara perti pendidikan dan kesehatan,” harapnya. gota dewan periode 5 tahun ke depan Gubernur Aceh, Irwandi Yusuf BIREUEN (Waspada): Mengatasi meningkatnya hab Thaib (Golkar), Abdul Mutalib, lain harapan dan permintaan kepa- Mantan anggota DPRK Pidie dapat berperan aktif sesuai dinamika dalam pidato tertulis dibacakan Wa- harga kebutuhan pokok di Bireuen, Dinas Perindagkop/ demokrasi yang sedang dibangun saat likota Sabang, Munawar Liza Zainal SE (Golkar), Syafie LB (Golkar), Ich- da anggota dewan, Senin (31/8). Jaya, Drs. Agussalim, minta semua UKM bekerjasama Disperindagkop/UKM Provinsi Aceh ini, sesuai perundang-undangan yang mengatakan, anggota legislatif hasil wan Mirza (PKS), Qadri, S.Ag (PKS), “Partisipasi publik sangat dibu- anggota dewan baru benar-benar menjelang Idul Fitri menggelar pasar rakyat (murah). berlaku untuk terbentuknya perim- Pemilu 2009 yang bertugas untuk Indra Nst (PD), Emk. Muntadhir, tuhkan dalam pembangunan, ba- membawa aspirasi masyarakat. Kadis Perindagkop/UKM Bireuen, Drs. Asnawi Ha- bangan fungsi legislatif. masa 5 tahun ke depan terdiri dari S.Sos (PD), Sofyati Alfiana, SH (PAN), gusnya dokumen anggaran perlu “Yang sangat penting adalah bagai- san melalui Kabid Perdagangan Amiruddin, S.Sos men- Peran legislatif menjadi sangat ur- berbagai kelompok, parpol dan par- H.Abdullah Usman (PAN), Aidilan dikritisi masyarakat, jangan hanya mana menjalankan aspirasi mas- jelaskan hal itu di kantornya, Senin (31/8). gen untuk mengoptimalkan fungsi lok, supaya dapat meninggalkan ke- Helmi Arch (PBB), Zulhilmi, MY, S.Ag oleh eksekutif dan legislatif,” papar yarakat, seperti apa janji kita kepa- Dikatakan, Disperindagkop/UKM Bireuen bekerja- pengawasan yang selama ini telah di- biasaan, sikap dan tingkah laku yang (PBB), drg. Marwan (PBR), Ridwan Ketua Lembaga Swadaya Masyara- da mereka saat kampanye,” kata- sama Disperindagkop/UKM Provinsi Aceh menggelar laksanakan anggota dewan lama. Fung- lama ketika masuk dalam suatu sis- Manan (PDK).(b29) kat (LSM) Malem Dagang, Drs. Abd. nya.(b21) tiga tahapan pasar rakyat (murah), memasuki bulan suci Ramadhan, jelang hari Idul Fitri dan jelang hari Raya Idul Adha. Pasar murah yang sudah digelar menyambut puasa 30 Anggota DPRK Aceh Selatan Disumpah Berjualan Siang Hari, Satpol PP Ramadhan di enam titik, masing-masing Keude Matang Glumpang Dua Peusangan, Keude Jangka Kecamatan Jangka, Glumpang Payong Kecamatan Jeumpa, Beunyot TAPAKTUAN (Waspada): Ketua Pengadilan Negeri Tapaktuan, M. Ka- dim, SH atas nama Ketua Mahkamah janji tersebut, dilanjutkan penyera- han pimpinan DPRK lama H.Abdul Salam didampingi dua wakilnya sidiq, Syahril,S.Ag, Ir.A.Aziz Kadir, dan Rajuddin Abbas. Empat dari PKPI, meliputi Hendriyono, Muhizar, Dan WH Amankan Dua Pedagang Kecamatan Juli. Keude Alue Rheing Kecamatan Peu- Agung, Senin (31/8) melantik dan Syahrul Miswar dan Ridwan Mas Zulfar, S.Ag dan Khaidir, SE. dada dan Cot Batee Kecamatan Kuala. SIGLI (Waspada): Untuk me- berbuka puasa siang hari. mengambil sumpah 30 anggota Dewan kepada pimpinan sementara Zirhan, Tiga dari Partai Golkar masing- Barang-barang yang disalurkan gula pasir 17 ton nertibkan para pedagang yang me- Sesuai aturan Qanun No. 11/ Perwakilan Rakyat Kabupaten (DPRK) SP dari Partai Aceh dan Marsidiq dari masing T. Mudasir, Khairul Yakob, dengan harga Rp7.500 per kg, tepung tarigu 10 ton de- langgar aturan, dua wanita peda- 2002, perbuatan pedagang itu Aceh Selatan, periode 2009-2014. Partai Demokrat. SH dan H. Abdul Salam dan tiga dari ngan harga Rp6.000 per kg, telor ayam 25.000 butir de- Prosesi pelantikan dan penyum- 30 Anggota dewan yang dilantik PKPB yaitu Said Amri, Azmir, SH dan gang yang menjual penganan ber- mengganggu kelangsungan dan ngan harga Rp700 per butir. Migor 17 ton Rp7.000 per pahan berlangsung dalam suatu sidang sepuluh di antaranya dari Partai Nazaruddin. Menyusul dua dari PAN buka di siang hari diamankan Sa- stabilitas masyarakat sedang men- kg, sirup 7.200 botol Rp6.500 per botol.(b16) paripurna istimewa, di ruang sidang Aceh (PA). Mereka adalah Rusdianto, yaitu Ir. H. Ridwan A. Rahaman dan tuan Polisi Pamong Praja (Satpol- jalankan ibadah puasa. Pasal 10 utama Kantor dewan Jalan Syech Abdur- Irwandas, Safiron, Syafruddin, Said Saiful. Kemudian Ridwan Mas PP) dan Wilayatul Hisbah (WH) Pi- ayat (1) ditegaskan setiap orang/ die sekira pukul 13:30, Sabtu (29/ badan usaha dilarang menyedia- Pesantren Kilat SMPN-4 rauf Tapaktuan. Disaksikan Bupati Tgk Husin Yusuf bersama Unsur Muspida. Tgk.Ismizar, Zirhan,SP, Sudirman, Martunis, Subki dan Zulfadhli. Em- dari PPP, Deni Irmansyah, ST dari PRA, Sulaiman dari PPRN dan 8). Kedua wanita itu masing-masing kan fasilitas kepada orang muslim Bireuen Berakhir Seusai pengucapan sumpah dan pat dari Partai Demokrat yaitu Mar- Abdullah dari SIRA.(b19) IW, 29, warga Pante Teungoh dan RH, 47, warga Gampong Blang Pa- untuk tidak berpuasa pada bulan ramadhan. BIREUEN (Waspada): Kepala SMPN-4 Bireuen Bahrol Walidin, S.Pd menutup penyelenggaran Pelantikan 35 Anggota DPRK Aceh Timur Khidmat seh, Kota Sigil. Kepala Satpol PP dan WH Pidie, Menurut Sabaruddin, bila diru- juk pada hukumannya, mereka pesantren kilat di sekolahnya, Sabtu (29/8). Sabaruddin, SH mengatakan, kita bisa dikenakan hukuman kurung- Hasil penilaian tim juri tiga peserta putera dan puteri LANGSA (Waspada): 35 Anggota langsung mempersilahkan Ketua mam Bin Hasbuh, Mansur Abuba- terpaksa mengamankan kedua wa- an satu tahun atau denda Rp3 juta masing-masing Noviadi peserta terbaik I, Nurul Khairi DPRK Aceh Timur hasil Pemilu 9 April DPRK Aceh Timur sementara ke- kar, Zulkifli M Thaeb, Tgk M Thahir nita tersebut karena berdasarkan dan dicambuk 6 kali. Tapi sebagai terbaik II dan Rista Alfira terbaik III. dilantik. Pengambilan sumpah dilaku- pada Tgk. Hasanuddin dari Partai MD, Tgk Hasan Basri Adam, Ahmad laporan masyarakat, IW dan RH tahap peringatan, semua barang Bahrol berharap semua peserta mengamalkan dan kan Ketua Pengadilan Negeri Idi, Sala- Aceh (PA) dan Mirnawati dari Partai Emda, SH, Abdurrahman M Jamil, huddin, SH, MH atas nama Ketua Mah- Demokrat untuk memimpin sidang Tgk Munir dan Iskandar. menggelar makanan sejak pukul bukti yang disita dikembalikan ke- melaksanakan dalam kehidupan sehari-hari ilmu yang 10:00 setiap hari selama Ramadhan. pada pemiliknya. Semoga kejadian diperoleh dalam pesantren kilat. Mengamalkan ilmu kamah Agung. selanjutnya. Selanjutnya, lima orang dari Prosesi pelantikan berlangsung Ke 35 anggota DPRK yang dilan- Partai Demokrat, masing-masing, “Saat kita tangkap ternyata mereka ini tak terulang lagi. agama terutama untuk diri dan keluarga untuk memeli- sedang menggelar makanan berbu- Ketua Nahdatul Ulama (NU) hara dirimu dan keluargamu dari siksaan api neraka. khidmat tampak semua peserta yang tik terdiri dari, 25 anggota DPRK dari Mirnawati, Cut Lismariati, T Zakaria, hadir tekun dan larut dalam prosesi Partai Aceh (PA), yakni Alauddin, Tgk Muslem, dan Syahrizal M Thaib. Se- ka puasa berupa mi lidi dan mi-hun Kabupaten Pidie yang juga anggota Ketiga peserta terbaik itu diberi sertifikat masing- di jalan Pante Teungoh, Kota Sigli, Wilayatul Hisbah (WH), Tgk. Razali masing diserahkan Kasek SMPN-4 Bahrol Walidin, Ketua pelantikan, kecuali hanya beberapa Zainal Abidin, Fadhil Muhammad, mentara lima lagi terdiri dari, Mul- anggota DPRK yang lama. Pengamatan Muh Yusuf, Sulaiman Hamzah, Tgk yadi dari Partai SIRA, Tgk Abdullah, siang bolong sekira pukul 13:30,” Yusmar menyatakan, meski seruan panitia pelaksana Ruslam, S.Ag dan koordinator Asri, S.Pd. kata Sabaruddin. bersama menjual makanan baru Asri, S.Pd menjelaskan, pesantren kilat SMPN-4 berlang- Waspada, bertindak selaku pimimpin M Yunus M Yusuf, Abdul Hamid, Mu- dari Partai daulat Aceh (PDA), Mus- sidang paripurna istimewa tersebut hammad Isa,SH, Muhtar Lutfi, Tgk lim A Gani, SH dari Partai Golongan Padahal, selain seruan bersama dibolehkan pukul 16:00, namun sung seminggu diikuti 109 siswa-siswi dengan pemateri adalah Ketua DPRK Aceh Timur periode Kamaruddin, Tajul Ula, Mai-mun, Karya, Zainal Abidinsyah dari PKPI juga lewat tim petugas patroli su- dalam prakteknya pedagang para dewan guru SMPN-4 dibantu Tgk. Zulkifli guru Dayah Isiqamah dan guru Dayah Darussakdah. (b16) 2004-2009 Asnawi M. Zein, SE. Tgk Hasanuddin, Muzakir, Tgk dan Mat Rais, SE dari Partai Bersatu dah memperingatkan para peda- melakukannya sejak pukul Usai pidatonya, Asnawai M. Zein Hamzah Sulaiman, Busyra Busta- Aceh (PBA).(cmad) gang tidak berjualan penganan 14:00.(b21)
  • 23. WASPADA Selasa 1 September 2009 Langsa, Kualasimpang, Kutacane, Singkil 23 Demo Warnai Pelantikan DPRK Langsa LANGSA (Waspada): Pe- Dalam aksi damai itu, pu- nyampingkan kepentingan gota dewan terpilih merealisa- dir dan jalankan dengan sebaik lantikan dan pengambilan luhan kader HMI menuntut pribadi dan golongan. sikan janji-janji yang telah di- mungkin. Kita harap ke depan sumpah jabatan anggota De- para anggota legislatif bekerja “Anggota dewan baru ini ucapkan saat kampanye, dan HMI dapat menjadi mitra bagi wan Perwakilan Daerah Kota sesuai hati nurani demi kepen- harapan baru masyarakat. Ka- mengutamakan kepentingan pemerintah Kota Langsa dalam (DPRK) Langsa hasil Pemilu tingan kesejahteraan masyara- rena itu kami sangat mengha- rakyat di atas kepentingan pri- menjalankan roda pemerinta- 2009 periode 2009–2014 di kat Kota Langsa. rapkan dewan tidak meng- badi, kelompok dan partai. han,” kata M. Zulfri. Aula Sekretariat dewan oleh Dalam orasi dipimpin Ke- khianati rakyat dan tidak Serta diminta menyatukan visi Dia juga menegaskan, de- Kepala Pengadilan Negeri tua Umum HMI Cabang Lang- menyia-nyiakan kepercayaan dan misi positif demi pem- wan akan bekerja sesuai ama- Langsa Suwono, SH diwarnai sa, Masrizal, S.Pd meminta rakyat,” terangnya. bangunan dan kemakmuran nah MoU Helsinki dan UUPA aksi demo Himpunan Maha- anggota dewan menjalankan Setelah orasi, para maha- masyarakat Kota Langsa. sebagaimana ditetapkan. siswa Islam (HMI) Cabang amanah masyarakat dengan siswa membacakan petisi Ketua DPRK M. Zulfri, ST “Intinya damai Aceh menjadi Langsa, Senin (31/8) pagi. penuh keihklasan dan menge- pernyataan sikap HMI yang di hadapan massa demo me- prioritas kita dalam bekerja,” dibacakan Ketua Masrizal, di ngatakan, dirinya atas nama demikian Zulfri. hadapan Ketua Sementara dewan terpilih yang baru di- Setelah menyampikan pe- DPRK Langsa Zulfri, ST. Dalam lantik mengucapkan terima tisi, mahasiswa demo lang- petisi tersebut HMI menuntut kasih atas perhatian HMI da- sung membubarkan diri de- anggota DPRK baru mewujud- lam menyikapi dan meng- ngan tertib dibawah pengawa- kan kesejahteraan masyarakat kritisi keberadaan dewan. san aparat keamanan dipim- dalam membuat kebijakan “Semua ini adalah masu- pin Kapolres Langsa AKBP parlemen. kan dan tuntutan yang telah Marwan Syukur, SH, MH. Dia juga menuntut ang- disampaikan akan kita akomo- (cmad/b22/cmus) Polisi Ringkus Pencuri Ranmor Dan Emas TAKENGON (Waspada): berapa kasus-kasus kejahatan Agustus 2009 masyarakat yang Jajaran Polres Aceh Tengah lalu yang telah dilakukannya. tinggal di Jalan Man 2, Kampung berhasil meringkus seorang Kapolres Aceh Tengah Kute Ni Reja, Kecamatan Lut Ta- pelaku pencurian sepedamo- AKBP Edwin Rachmat Adiku- war melaporkan kepada polisi, tor, setelah diperiksa ternyata suma melalui Kasatreskrim sepeda motornya merkYamaha pelaku juga mengakui sebe- Iptu Ade Zamrah, Senin (31/ hilang. Setelah polisi beberapa lumnya dia telah mencuri 200 8) menyebutkan, awal tertang- kali menelusuri kasus itu, meng- gram emas dan mobile phone kapnya Jamaluddin Bin Amir, arah kepada salah seorang resi- di tempat yang berbeda. 25, warga Kampung Kuyun divis (pernah di penjara). Sekali mendayung, dua, Uken, Kecamatan Celala, Ka- Penyidikan demi penyidi- tiga pulau terlewati. Agaknya bupaten Aceh Tengah adalah kan berhasil dan tepat kepada peribahasa ini yang patut dibe- berkat jasa masyarakat yang sasaran, lalu hanya dalam rikan kepada jajaran Polres melihat tersangka jalan-jalan beberapa minggu aparat polisi Aceh Tengah. Pasalnya, setelah menggunakan sepeda motor meringkus Jr, 25, warga Kam- menangkap seorang residivis curian di kampungnya. pung Kuyun Uken, Kecamatan yang berprofesi maling, begitu Awalnya, menurut kete- Celala, Aceh Tengah diringkus ketangkap terbongkarlah be- rangan Kasatreskrim, pada 13 tanpa ada perlawanan.(cb04/
  • 24. 24 Otomotif WASPADA Selasa 1 September 2009 Mini Coupe, Sang Predator Baru Jika sebelumnya Peugeot RCZ masuk dapur produksi, ceritanya akan dan kemudian berpikir bahwa banyak Coupe ini bobotnya akan lebih ringan