Edisi9aceh
Upcoming SlideShare
Loading in...5
×
 

Edisi9aceh

on

  • 3,961 views

 

Statistics

Views

Total Views
3,961
Views on SlideShare
3,955
Embed Views
6

Actions

Likes
0
Downloads
6
Comments
0

1 Embed 6

http://epaper.waspada.co.id 6

Accessibility

Categories

Upload Details

Uploaded via as Adobe PDF

Usage Rights

© All Rights Reserved

Report content

Flagged as inappropriate Flag as inappropriate
Flag as inappropriate

Select your reason for flagging this presentation as inappropriate.

Cancel
  • Full Name Full Name Comment goes here.
    Are you sure you want to
    Your message goes here
    Processing…
Post Comment
Edit your comment

    Edisi9aceh Edisi9aceh Document Transcript

    • Luar Negeri 3 WASPADA Senin 9 November 2009 Badai Tropis Ida Landa Jepang Desak Myanmar Karibia Baratlaut Bebaskan Aung San Suu Kyi MEXICO CITY, Meksiko (Antara/Reuters): Badai tropis Ida TOKYO, Jepang (Antara/ tindakan Washington baru-ba- kembali menjadi topan kategori 1 di lepas pantaiYucatan, Mexico, AFP): Jepang mendesak Myan- ru ini, mengatakan itu akan Karibia baratlaut, kata Pusat Topan Nasional Amerika Serikat. mar membebaskan pemimpin membuatTokyomelakukanpen- Lembaga topan yang berpusat di Miami itu Sabtu (7/11) oposisi yang ditahan Aung San dekatan lebih erat. mengatakan Ida, yang pertama menjadi topan, Kamis di lepas Suu Kyi sebelum pemilu tahun Perundingan antara Hatoya- pantai Nikaragua, Karibia sebelum melemah melewati negara depan,danmenambahkanTokyo ma dan Jend. Thein Sein berlang- itu, mencapai kecepatan angin maksimum 120km per jam, dan siap memberikan bantuan lebih sung di sela-sela KTT di Tokyo berada 120km tenggara bagian timur Cozumel, Mexico. Badai- badai tropis menjadi topan apabila kecepatan anginnya menca- banyak jika demokratisasi di antaranegara-negara—Kamboja, pai 119km km per jam. negara itu maju. Laos, Myanmar, Thailand dan Para ahli cuaca memperkirakan badai itu akan melemah Pernyataan itu muncul be- Vietnam. Ini adalah pertama kali ketika memasukiTeluk Mexico pekan depan. Langit cerah , Sabtu berapa hari setelah satu delega- sejaktahun2003 seorangpemim- di daerah wisata Cancun, Mexico dan Ida diperkirakan akan si Amerika Serikat berkunjung pin Myanmar mengunjungi melewati bagian timur kota itu Minggu petang. Mexico menge- ke Myanmar sebagai bagian da- Jepang. luarkan waspada topan bagi SemenanjungYucatan dari daerah ri kebijakan pendekatan baru Hatoyama mengakui adanya wisata Tulum sampai Cabo Catoche, utara Cancun. pemerintah Presiden Barack tanda-tanda yang membaik da- Peringatan badai tropis berlaku bagi Pulau Grand Cayman Obama. lam proses demokratisasi di dan provinsi Pinar del Rio, Kuba barat, kata lembaga topan itu. “Pembebasan Aung San Suu negara yang dulu bernama Bur- Pemerintah Mexico mendesak penduduk untuk tidak melaku- Kyi dan para tahanan politik lain- ma itu dan menyambut baik hu- kan perjalanan ke SemenanjungYucatan dan memberlakukan nya sangat penting sebelum pe- bungan yang meningkat antara larangan bagi kapal-kapal berada di pantai. milu yang akan diselenggara- Washington dan Myanmar. kan tahun 2010,” kata PM Jepang “Berdasarkan langkah- AS Dan Pakistan Rundingkan Yukio Hatoyama kepada PM Myanmar yang mengunjungi langkah positif baru-baru ini, Jepang secara bertahap akan Jepang, kata seorang jurubicara memperluasbantuannyakepada Kesepakatan Keamanan Nuklir Kementerian Luar Negeri Sab- Myanmar dalam bidang-bidang tu (7/11). bantuan kemanusiaan termasuk WASHINGTON, AS (Antara/AFP): Amerika Serikat memba- has kesepakatan sangat sensitif dengan militer Pakistan menge- Hatoyama juga mendesak melalui kelompok swadaya ma- nai keamanan persenjataan nuklir negara tersebut, kata warta- Jendral Thein Sein untuk menja- syarakat, dan bantuan pemba- The Associated Press min semua kelompok dapat ikut ngunan manusia,” kata Hatoya- wan investigatif Seymour Hersh dalam laporannya pada maja- lah The New Yorker terbitan terakhir. TRUK TANGKI Seorang tentara Afghanistan mengamankan satu jalanan di mana satu truk serta dalam pemilu tersebut. Je- ma kepada Jend. Thein Sein. tangki bahan bakar di luar Jalalabad, provinsi Nangarhar, di timur Kabul , ibuko- pang melepaskan diri dari kebi- “Jika pemilu tahun 2010 dise- Wartawan tersebut menulis, dalam pertemuan dengan para bekas pejabat diWashington dan Pakistan belakangan ini, diba- TERBAKAR ta Afghanistan, Minggu (8/11). Satu iring-iringan kendaraan pemasok NATO dan jakan negara-negara Barat, yang lenggarakan sesuai dengan kon- has kesepakatan-kesepakatan yang akan mengizinkan satuan- DISERANG MILITAN pasukan koalisi telah diserang oleh militan dekat Jalalabad, dua truk tangki terba- memberlakukan sanksi-sanksi disi yang kami harapkan, Jepang satuan Amerika yang terlatih khusus untuk memberikan kea- kar dan tiga lainnya rusak. keras terhadap Myanmar, dari akan meningktakan bantuannya manan tambahan terhadap pasukan Afghanistan dalam kasus China, yang mengucurkan uang kepada Myanmar,” tambahnya. terjadi krisis. miliaran dolar kepada negara itu. Dalam tahun fiskal yang berakhir Walikota, 11 Orang Tewas Pada saat yang sama, militer Pakistan akan diberi dana untuk Jepanginginmelakukanpen- Maret 2008, Jepang memberikan pengadaan peralatan dan pelatihan terhadap prajurit Pakistan, dekatan dan dialog untuk men- bantuan 1,18 miliar yen (kira-kira serta memperbaiki fasilitas-fasilitas dan perumahan mereka, kata dorong demokratisasi negara AS$13,13 juta ) dalam bantuan laporan Sabtu (7/11) itu. Kekhawatiran terbesar adalah bahwa yang diperintah militer yang hibah dan 1,64 miliar yen dalam kaum ekstremis yang berada di dalam militer Pakistan mungkin otoriter itu, dan menyambut baik bantuanteknikkepadaMyanmar. akan melakukan kudeta, menguasai beberapa aset nuklir, atau bahkan menyelewengkan hulu ledak mereka, kata Hersh. Doktrin nuklir Pakistan menyerukan agar hulu ledak dan pemicu mereka ditempatkan secara terpisah, antara satu dengan lainnya, dan dari kemungkinan terjadinya penyimpangan. “Kami memberikanbantuankepadamerekamasing-masing,dantingkat Dalam Serangan Bom Taliban Ribuan Orang Ikuti Demonstrasi Anti-Pangkalan AS Di Jepang bantuan yang bagus, karena setiap orang menghormati integritas PESHAWAR, Pakistan Serangan di pagi hari itu berpaling dan membentuk satu di antara korban tewas dan be- siapapun,” kata Hersh mengutip Presiden Pakistan Asif Ali Zardari, KADENA, Jepang (Antara/ dengan kelebihan suara banyak yang mengatakan kepadanya dalam wawancara mengenai (AP): Seorang pengebom terjadi di kota Adazai, sekitar 16 milisi lokal untuk memerangi berapa korban cedera dalam AFP): Ribuan warga pulau Oki- dan menjanjikan hubungan yang hubungan keamanan dengan Washington. bunuhdiri yang sepertinya km sebelah selatan kota Pesha- Taliban. kondisi kritis, kata para pejabat. nawa di bagian selatan Jepang kurang tunduk denganWashing- “Para perwira militer kami tidak gila, seperti Taliban,” kata mengincar seorang war. Pasar itu ramai dengan para “Malik sebelumnya sela- Khan Zamir tengah membeli melancarkan protes terhadap ton — mengatakan dalam kam- Zardari. “Suatu pemberontakan tak kan pernah terjadi di Pakist- walikota anti-Taliban pembeli dan kambing yang dijual mat dari beberapa kali serangan kambing untuk Hari Raya Idul kehadiran militer AS pada ma- panyepemilihandiaakanmenin- an. Tapi ketakutan itu telah disebarkan oleh beberapa orang Minggu (8/11) meledakkan menjelang Hari Raya Idul Adha. sejak dia berbalik memerangi Adha ketika ledakan itu mengo- lam demonstrasi besar menen- jau kembali perjanjian tersebut yang berupaya menyebarkan kekacauan,” ujarnya. dirinya di satu pasar yang Walikota tersebut, Abdul Malik, Taliban,” kata Anis. “Namun ha- yak jalan tersebut. tang pangkalan udara yang kon- dan menginginkan pangkalan itu Sementara itu mantan Presiden Pakistan, Pervez Musharraf, ramai di bagian baratlaut yang sebelumnya dilaporkan se- ri ini pihak militant akhirnya “Tempat itu berubah menja- troversial. dipindahkan dari pulau atau bah- mengakui bahwa pemerintahnya telah mendapat para pakar Pakistan, menewaskan lamat,meninggaldalamserangan membunuhnya.” di neraka di mana korban tewas Sekitar 2.500 orang yang ting- kan dari negara itu. non proliferasi dari AS untuk mengawasi komando dan penga- sang walikota dan 11 orang itu, kata Shaibzada Anis, pejabat Sebelas jenazah dan 25 kor- dan cedera bergelimpangan di gal di kota Kadena, yang telah Namun mendapat tekanan wasan persenjataan Pakistan, dengan mengutamakan prose- menampung sebuah pangkalan dari AS, yang minta Jepang untuk dur keselamatan dan keamanan, kata laporan itu. lainnya serta menyebabkan tinggi di Peshawar. ban cedera dilarikan ke rumah- mana-mana dan darah serta po- puluhan lainnya cedera, Malik, sebelumnya pen- sakit,katapolisiAbdulSattarKhan. tongan tubuh juga berserakan,” udara AS yang sering memancing menghormatiperjanjiantersebut, kata polisi. dukung Taliban, kemudian Seorang gadis muda termasuk katanya, sambil menambahkan keluhan karena suara gaduh pe- MenluKatsuyaOkadamengusul- Bus Masuk Jurang dua keluarganya menderita ce- dera parah. sawat jet yang terbang siang dan malam,Sabtumemprotesusulan kan operasi Futenma digabung- kandenganpangkalanudarayang Di Nepal, 12 Tewas KATHMANDU, Nepal (AP): Satu bus tergelincir dari jalan Thaksin Mulai Kerjanya “Sekarang darah kami te- lah tumpa dalam perang ini,” katanya sambil bersumpah akan pemerintah agar kota itu mene- rima instalasi AS lainnya. Demonstrasi itu tiba satu hari sudah ada di Kadena — usulan yang membuat marah warga Kadena. “Apapun alasan atau sebelum masyarakat Okinawa apapun penjelasan yang diberi- di kawasan pegunungan dan jungkir balik sepanjang 200 me- ter Minggu (8/11) di bagian barat Nepal, menewaskan sedikit- nya 12 orang dan mencederai beberapa orang lainnya, kata sejumlah pejabat. Di Kamboja Pekan Ini balas dendam terhadap para penyerang. Kalangan militant melancar- melakukan demonstrasi besar terhadap perjanjian militer Je- pang-AS 2006 menjelang kun- kan, saya tidak akan menerima- nya,” kata walikota KadenaToku- jitsu Miyagi pada unjuk rasa itu. Kecelakaan itu terjadi dekat desa Hungasapur, sekitar 320 PHNOM PENH, Kamboja menteri luar negeri ASEAN untuk Tenggara pada 1976, maka selu- kan serangan di Pakistan dalam jungan pertama Presiden AS Ba- PangkalanFutenma,yangter- km sebelah barat Kathmandu, dan tim penyelamat dikirim ke (Antara/AFP): Mantan PM Thai- membantukeduanegaraanggota ruh anggota ASEAN wajib mena- beberapa minggu terakhir dan rack Obama ke Tokyo. Demo- letak di sebuah daerah perkotaan wilayah itu, kata pemimpin distrik Argakhachi Balbadra Giri. land Thaksin Shinawatra akan ASEANitumenyelesaikanperseli- warkanbantuanuntukmemban- menewaskanlebih300wargasipil strasi Minggu (8/11) ini diperki- berpenduduk padat, telah mun- Usaha penyelamatan mengalami kesulitan karena tempat mengunjungi Kamboja pekan ini sihantersebutdenganpenuhper- tu negara anggota ASEAN me- dan tentara dalam serangan yang rakan akan dihadiri sekitar 30.000 cul sebagai titik nyala bagi para kejadian kecelakaan sangat terpencil di mana tidak ada jaringan untuk menjalankan peran baru sahabatan sesegera mungkin. nyelesaikan isu-isu dwipihak me- ditujukan untuk melemahkan demonstran. penentang setempat yang telah telepon, dan terletak beberapa jam dari kota utama distrik itu. sebagai penasehat ekonomi pe- Surin mengatakan Sekjen reka, bahkan jika kedua negara operasi militer pemerintah terha- Menurut perjanjian tersebut, dibuat marah oleh suara gaduh Di kawasan itu banyak jurang curam, jalanan yang tidak mu- merintah, kata Perdana Menteri ASEAN menerima banyak perta- yang berselisih tidak sepakat jika dapTaliban dan al-Qaida diWazi- pemerintah konservatif Tokyo pesawat, risiko kecelakaan dan lus dan tidak ada pagar pengaman, kata Giri. ristan Selatan. ketika itu setuju dengan Wash- kejahatan yang dilakukan oleh Polisi mengatakan kecelakaan itu menewaskan sedikit- Kamboja kepada wartawan, nyaan dan ungkapan kepriha- penyelesaian permasalahan me- Pemerintah melancarkan ington bahwa Pangkalan Udara personil militer AS. nya 12 orang, dan petugas penyelamat membawa beberapa Minggu (8/11). tinandari para mitra dan saha- reka dibawa ke tingkat kawasan. Futenma Korps Marinir AS, yang “Masyarakat Okinawa siap korban cedera ke rumahsakit di kota-kota terdekat.(m18) “Thaksin akan berada di bat ASEAN terkait dengan Lebih jauh, pasal itu menye- ofensif mulai pertengahan Okinawa telah lama minta un- untuk memikul beban menam- Kementerian Perekonomian dan memburuknya hubungan an- butkan bahwa“pihak-pihak yang Oktoberdikawasansukuitu,yang tuk dipindahkan dari daerah ke- pung militer AS jika rakyat Jepang Keuangan 12 November untuk tara Kamboja dengan Thailand, berselisih berkewajiban meneri- terletak di sepanjang perbatasan Dalai Lama Kunjungi Wilayah memberikan pengarahan kepa- yang puncaknya tampak dari ma dengan baik bantuan terse- Afghanistan dan di mana peme- diaman itu, dipindahkan ke tem- pat Kamp Schwab di pantai pu- lainnya juga berbuat sama,” ujar Miyagi, yang kotanya telah me- rintahkurangmemilikipengaruh. Budhis Meskipun Diprotes China da 300 ahli ekonomi Kamboja,” kata Hun Sen dalam jumpa war- pemanggilan pulang masing- masing duta besar mereka awal but”. Pertikaian antara kedua ne- gara ini berpusat pada semak Daerah itu menjadi pertahanan lau itu. PM baru JepangYukio Hato- nyerahkan sekitar 83 persen da- ri tanahnya untuk pangkalan TAWANG, India (Antara/AFP): Dalai Lama terbang ke seki- tawan di Bandara Internasional pekan ini. Surin menekankan belukar seluas 4,6 km persegi di utama Taliban dan al-Qaida di yama — yang memperoleh ke- udara itu, menurut dokumen ko- tar biara Tibet di dataran tinggi India timur laut Minggu (8/ Phnom Penh. perselisihan itu dapat mem- dekat kuil kuno berusia 900 tahun negara itu. (m18) kuasaan melalui kemenangan ta tersebut. 11), dalam suatu kunjungan yang membuat marah China, yang Kamboja dan Thailand, Ka- pengaruhi kredibilitas ASEAN. PreahVihear di hutan tebing cu- mengklaim wilayah sekitar Himalaya itu sebagai miliknya. mis saling memanggil pulang “Kami di ASEAN tidak sang- ram yang memisahkan kedua Pemimpin spiritual Tibet, yang tinggal di pengasingan di dutabesarnya setelah Kamboja gup dilihat sebagai suatu perhim- negara tersebut. India selama 50 tahun itu, tiba dengan helikopter sekitar Ming- mengangkat Thaksin, yang digu- puna yang terpecah terutama Kedua negara sudah terlibat gu siang di biara Tawang, yang terletak pada ketinggian 3.500 lingkan sebagai perdana menteri menjelangpelaksanaanpertemu- pertikaian sejak berabad-abad meter di negara bagian Arunachal Pradesh. Wilayah yang terletak di antara Myanmar, Bhutan dan Tibet Thailand dalam kudeta tahun an tingkat tinggi Forum Kerjasa- lalu ketika kerajaan Thailand dan itu terletak di negara bagian Arunachal yang berhutan lebat 2006,sebagaipenasehatekonomi. ma Ekonomi Asia Pasifik (APEC) Khmer saling berperang mem- dan diperintah oleh India, namun selama ini juga diklaim oleh Hun Sen juga mengumum- danpertemuanbersejarahtingkat perebutkan wilayah dan kekua- China. Beijing mengecam kunjungan itu sebagai aksi provokasi kan bahwa ia akan menarik sa- kepalanegaraASEAN-ASdiSinga- saan. Pada tahun 1962, pengadi- yang bertujuan merusak hubungan antara China dan India. tuan elit pasukan payung dari pura bulan ini,” katanya. lan internasional memutuskan Tawang, biara Tibet terbesar kedua dan telah berumur 400 daerah yang disengketakan dekat Surin menegaskan sejalan Kamboja sebagai pemilik candi tahun di India itu, punya sejarah sendiri bagi Dalai Lama. Ketika kuilPreahVihear,tempatpasukan dengansemangatPiagamASEAN itu, namun tanah yang mengeli- dia melarikan diri dari Tibet pada 1959 menyusul pemberontakan Thailand dan Kamboja terlibat dan Kesepakatan Persahabatan linginya masih menjadi wilayah yang gagal melawan penguasa China, Arunachal menjadi tujuan pertikaian perbatasan berdarah dan Kerjasama (TAC) di Asia yang diperebutkan. utamanya untuk memasuki India. Dia kemudian mengungsi ke Tawang yang menjadi awal kehidupannya di pengasingan. sejak tahun lalu. T.G. Rinpoche, pemimpin senior spiritual Budha di Aruna- ASEAN: Tahan diri chal mengatakan, 800 biksu Tawang akan memberikan sambu- Sekretaris Jenderal ASEAN tan tradisional kepada Dalai Lama, saat memulai kunjungan- Surin Pitsuwan menyampaikan nya selama sepekan. keprihatinannya atas peningka- Ketegangan antara India dan China berkait dengan sengketa tan ketegangan antara dua ne- perbatasan Himalaya, telah menimbulkan perang singkat pada gara anggota ASEAN, Thailand 1962. Dalam beberapa bulan belakangan ketegangan hubungan dan Kamboja, dan menyerukan merekameningkatlagi,denganadanyalaporan-laporanmengenai kedua negara itu untuk saling gerakan tentara dan serangan kecil-kecilan di kedua pihak. menahan diri. PM India Manmohan Singh meninjau wilayah itu bulan lalu dalam kaitan kampanye pemilihannya, yang menimbulkan pe- Hal itu, menurut keterangan ringatan-peringatan dari Beijing bahwa kunjungan itu bisa meru- dari Sekretariat ASEAN di Jakarta, sak hubungan bilateral mereka. Kunjungan Dalai Lama, yang disampaikan Surin dalam surat- oleh China disebut sebagai ‘pemecah-belah’ dituduh mengha- nya Minggu (8/11) kepada para sut pemberontakan separatis di tanah airnya, sehingga juga menteri luar negeri ASEAN akhir dipandang sebagai provokasi bermata-dua. pekan ini terkait dengan perselisi- China menuduh Dalai Lama dan komplotan di penga- han batas negara antara kedua singannya membantu menghimpun protes-protes sengit anti negara anggota ASEAN tersebut. China yang meletus di Lhasa Maret tahun lalu, dan menyebar Mantan menteri luar negeri di seluruh wilayah itu. Thailand itu mendesak para
    • 4 Nusantara WASPADA Senin 9 November 2009 Lagu KPK Di Dadaku Bergema Di Bundaran HI JAKARTA (Waspada): Miunggu (8/11) pagi Bundaran Hotel Indonesia (HI) dipenuhi ratusan pendukung KPK. Mereka menyanyikan bersama lagu KPK di Dadaku menggunakan nada lagu Garuda di Dadaku, yang dipopulerkan oleh grup band Netral. Ada yang berani melawan buaya?” tanya MC acara, salah satu aktivis koalisi Cinta Indonesia Cinta KPK (Cicak), kepada lima ratusan pendukung yang rata-rata Facebookers ini. Berani....,” teriak massa. Saat MC mengiringi menyanyikan lagu KPK di dadaku, massa pun tampak semangat dan antusias menyanyikan lagu ini. KPK di dadaku, KPK kebanggaanku, keenaran pasti menang. Kobarkan semangatmu, kobarkan semangatmu, ku yakin kebenaran pasti menang...pasti menang...,” begitu lirik lagu ini memanaskan Bundaran Hotel Indonesia. Massa yang datang pun semakin bertambah banyak, mengingat orang-orang yang sedang bersepeda menikmati hari libur pun ikut bergabung mendekati panggung yang ada di depan Ho- tel Indonesia ini. Massa kemudian diminta satu-persatu menyanyikan lagu ini di atas panggung. Panitia memberikan sedikit oleh-oleh bagi yang bisa menyanyikan dengan sempurna. Antara Antara Bberapa artis ibukota ambil bagian dalam aksi solidaritas ANTI KORUPSI. Beberapa aktivis anti korupsi membawa poster berwajah pengusaha Anggodo yang KONSER CICAK: Grup musik Slank memeriahkan Konser CICAK (Cinta Indonesia Cinta terhadap penegakan hukum ini. Slank, Oppie Andaresta, Once menggunakan seragam Polri ketika menggelar aksi damai anti korupsi di sekitar Bunderan HI, Jakarta, Komisi Pemberantasan Korupsi) di Bundaran Hotel Indonesia, Jakarta, Minggu (8/11). Dewa, Efek Rumah Kaca, Bagus Netral dan beberapa artis lainnya Minggu (8/11). Perseteruan antara KPK dengan Polri yang berlarut-larut itu membuat kepercayaan Konser digelar sebagai bentuk dukungan segera dituntaskannya kasus yang menjerat akan menggoyang aksi ini mulai pukul 08:00. masyarakat terhadap lembaga negara itu semakin menurun. pimpinan KPK nonaktif Bibit Samad Rianto dan Chandra M Hamzah. Hancurkan buaya Buaya menjadi pusat kemarahan dalam aksi massa berbagai elemen di Bundaran HI, Jakarta Pusat. Sekitar 100-an orang yang Presiden Diminta Tegas menggelar konvoi buaya, membawa buaya warna biru berukuran besar yang menjadi bulan-bulanan massa. Buaya itu diseret-seret, lalu ditendang-tendang oleh massa dari Facebooker dan Perhimpunan Rakyat Pekerja. “Kami membawa buaya sebagai lambang upaya pelemahan KPK,” kata sang orator. Lalu massa menyanyikan lagu yang disadur dari lagu anak-anak Bintang Kecil: Lawan Korupsi “Cicak kecil, siapa berani melawan korupsi, hancurkan buaya ciptaan setan!” Massa juga menutup buka mulut buaya lalu menendanginya. “Saatnya buaya dibumihanguskan!” ujar massa. Massa yang baru datang ini juga membawa spanduk berisi aspirasi mereka yaitu “Tangkap Anggoro dan Anggodo, ganti Kapolri dan Jaksa Agung serta tuntaskan kasus Bank Century.” JAKARTA (Antara): Pegiat “Ketidaktegasan Presiden masyarakat yang menginginkan untuk posisi Jaksa Agung. mengingatkan Presiden Yu- konsekuensinya. Aksi massa di Bundaran HI selain dihadiri oleh publik yang Koalisi Masyarakat Sipil Anti dapat mengubah kemuakan adanya pemerintahan yang Sementara untuk pengganti dhoyono agar menggunakan Oknum-oknum aparat Polri tengah meluangkan hari libur, juga diikuti oleh aktivis Kontras, Korupsi (Kompak) Fadjroel masyarakat anti korupsi ini bersih dan berwibawa. Kapolri saat ini, Fadjroel me- momentum saat ini untuk dan Kejaksaan, terutama para YLBHI, Komunitas Sepeda Onthel, Komunitas Vespa, ICW, WALHI, Rachman mintaPresiden berubah menjadi kemarahan Menurut Fadjroel yang juga nyarankan Presiden untuk me- memberantas keberadaan pejabatnya yang terindikasi Forum Facebookers Peduli Keadilan dan Perhimpunan Rakyat Susilo Bambang Yudhoyono publik yang berujung pada Ketua Pedoman Indonesia itu, milih perwira tinggi kepolisian jejaring mafia di lembaga terlibat dalam berbagai tindakan Pekerja & Konfederasi Kongres Aliansi Serikat Buruh Indonesia agar tegas dan berani me- kerusuhan politik,” ujar Fadjroel salah satu bukti ketegasan itu yang berada dua atau tiga ang- penegak hukum Indonesia. tidak terpuji harus segera di serta dimeriahkan artis-artis dalam konser Cicak.(dtc) mimpin perang melawan di Jakarta, Minggu (8/11). adalah dengan memecat pim- katan di bawah Jenderal Pol “Kepercayaan masyarakat pecat dari jabatan mereka. korupsi setelah adanya Karenanya, Presiden pinan Polri dan Kejaksaan Agung Bambang Hendarso Danuri. terhadap hukum selama ini pengakuan Ari Muladi, salah Yudhoyono harus tegas dan saat ini dan menggantikannya Tujuannya adalah untuk me- nyaris sirna karena ketidakber- Laporan ke: 28 satu saksi kunci kasus Bibit- berani memimpin perang mela- dengan tokoh-tokoh anti korupsi mutus mata rantai ketidak- dayaan menghadapi kolusi Chandra. wan korupsi bersama-sama seperti Adnan Buyung Nasution beresan yang ada di tubuh kepolisian saat ini. oknum penegak hukum dengan para koruptor,” ujarnya. DOMPET PEDULI UMMAT WASPADA “SBY membutuhkan figur Karena itu, Teguh menam- Setiap sedeqah yang kita salurkan di jalan Allah akan menjadikan pelindung kita dari Keluarga Cak Nur Minta DPR Kapolri dan Jaksa Agung yang benar-benar anti korupsi,” ujarnya. bahkan, Presiden Yudhoyono harus memastikan apapun hasil penyelidikan tim pencari api neraka. Salurkan Zakat, Infaq dan Shadaqah Anda ke lembaga yang Amanah, Profesional & Transparan Transfer via bank, AC. Peduli Ummat Waspada Desak Kapolri Minta Maaf Secara terpisah,Wakil Ketua Komisi II DPR (bidang peme- rintahan) Teguh Juwarno juga fakta yang dipimpin Adnan Buyung Nasution harus ditegakkan dengan berbagai Zakat BMI 211.00002.15 Infak/Sedekah BMI 211.00044.15 JAKARTA (Waspada): Meski Kapolri itu telah pula dibantah daan Cak Nur. BSM 006.0022407 BSM 006.0008321 saat ini Komisi III DPR menuai oleh MS Kaban. Memang, dalam Raker itu BCA 022.1750828 BNI 005.7504808 kecaman, tetapi simpatisan dan keluarga Nurcholish Madjid “Karenanya minimal Kapolri berjiwa ksatria mengakui Kapolri menyebut inisial-inisial MK, CMH dan N. Kapolri me- Pertikaian KPK Dan Polri BNI Syariah 0092687629 Bank Sumut 100.02.04.034144.5 Bank Mandiri 106.0002203803 berencana menemuinya. Mere- ka hendak memberikan klari- kesalahan dan meminta maaf. Bila tidak, semua yang dia nyebut MK sebagai pimpinan sebuah departemen yang kini Ganggu Kepentingan Bangsa ZIS terpublikasi 1 Januari 2009 s/d laporan 27 Rp 879.492.928 fikasi atas spekulasi keterkaitan sampaikan di Komisi III patut tak menjabat lagi. CMH sebagai JAKARTA (Antara): Pertikaian antara KPK, Kepolisian RI dan Cak Nur dengan Chandra Ham- diragukan akurasinya,” tegas pimpinan KPK dan N meru- Kejaksaan Agung dikhawatirkan mengganggu ketertiban dan ZIS ZIS zah dalam kasus suap Masaro aktivis tersebut. pakan bapak dan tokoh yang kepentingan bangsa, sehingga masalah ini harus segera dituntaskan Rp 12.300.000 yang disampaikan Kapolri Jende- Langkah memberikan sangat dihormati. tanpa pandang bulu demi tegaknya Indonesia sebagai negara 1935. Irwan A.R Lubis Rp 3,000,000 1992. Rabiullah Harahap Rp 75,000 ral Bambang Hendarso Danuri. klarifikasi kepada Komisi III DPR Inisial MK dibuka oleh hukum. 1936. Ir. H. Baginda M.A Pulungan, MM Rp 625,000 1993. Abdul Gani Rp 75,000 Demikian tegas Ray Rang- ditempuh, sebab pemaparan anggota FDIP Gayus Lumbuun. “Secara kasat mata dan ka-sat pikiran, pertikaian tiga lembaga 1937. Ir. Hj. Nurmala Dewi Hasibuan, MM 1994. RM. Widyawan HNKP, ST Rp 60,000 kuti, wakil dari Nurcholish Mad- Kapolri juga disampaikan da- Sedangkan CMH sudah dike- penegak hukum itu mengganggu ketertiban dan kepentingan Rp 500,000 1995. Ir. H. Makmur Rp 50,000 jid Society. Desakan disampai- lam forum tersebut. Padahal tahui bahwa itu inisial Chandra. bangsa. Karena itu harus segera dituntaskan tanpa pandang bulu 1938. Ir. Chairansyah Rp 500,000 1996. Ir. Muchlis Murad Rp 50,000 kannya dalam keterangan pers itu merupakan forum resmi dan Lantas N? Informasi yang bere- siapa yang terlibat dalam kejahatan itu, demi tegaknya Indo- 1939. Ir. H.Hanif Soekasman Rp 500,000 1997. Ir. Ahmad Sulaiman Lubis Rp 50,000 di kantor Yayasan Paramadina, sudah seharusnya data yang dar N merupakan inisial Nur- nesia sebagai negara hukum,” kata tokoh senior Golkar, Pinantun 1940. Hamba Allah Rp 500,000 1998. Ir. Asral Tanjung Rp 50,000 Pondok Indah, Jakarta, Minggu disampaikan adalah data valid. cholish Madjid alias Cak Nur. Hutasoit, di Jakarta Minggu(8/11). 1941. Ir. M. Dedy Pratopo Rp 300,000 1999. Swelli Sholihah Nasution, SP Rp 50,000 (8/11). “Soal bagaimana tindak lanjut- Bagaimana Kapolri me- Mantan anggota penasehat DPP Partai Golkar ini khawatir, 1942. Hamba Allah Rp 250,000 2000. Mhd. Ihsan Rangkuti, SE, Ak Rp 50,000 “Selasa malam kami akan nya kita lihat nanti,” sambung ngaitkan hubungan Chandra, kasus yang terkuak di ketiga lembaga itu terus mengalir bagaikan 1943. H. Effendi Nasution Rp 250,000 2001. Ir. Mohd. Syafii Batubara Rp 50,000 Komisi III DPR untuk memberi Ray. MS Kaban dan Cak Nur? Infor- bola salju yang terus menggelinding atau “snow balling” yang 1944. Ir. Eddy Usman Rp 250,000 2002. Ir. Erwin Zulkarnain Hasibuan Rp 50,000 klarifikasi dan meminta untuk Dalam Raker dengan Komisi masi yang didapatkan, Kapolri bermuara pada ketidakpercayaan rakyat kepada pemerintah 1945. Hamba Allah Rp 250,000 2003. Wispramono Budiman, SE Rp 50,000 juga mendesak Kapolri me- III DPR, Kamis hingga Jumat dini menduga Chandra memiliki terutama para penegak hukum. 1946. Ir. M. Thamrin Hasibuan Rp 200,000 2004. Ir. Hidayat Darpo, MM Rp 50,000 minta maaf,” kata dia. hari (6/11), Kapolri mencurigai utang jasa terhadap Kaban, “Kalau itu yang terjadi, secara kasat mata dan kasat pikiran, 1947. Ir. Riswan Effendi Siregar Rp 200,000 2005. Ir. Nanang Sumintarsono Rp 50,000 Menurutnya, spekulasi KPK tidak menindaklanjuti karena diperkenalkan dengan 1948. drg. H. Syaiful Anwar Nasution Rp 200,000 2006. Andry Sally, SP Rp 50,000 akan muncul masalah yang lebih besar dari yang ada sekarang, Chandra Hamzah berusaha 1949. Syahruddin Ali, SH Rp 200,000 2007. Surya Brata, MCP, SE Rp 50,000 temuan bukti aliran dana ke Nadia Madjid, putri Cak Nur. dan itu membahayakan kehidupan bangsa dan negara ke depan,” 1950. Ir. Hj. Deriati, MM Rp 200,000 2008. H. M. Anwar Rangkuti, SH Rp 50,000 melindungi MS Kaban dari ka- mantan Menhut MS Kaban dari Lewat Kaban, akhirnya Chandra katanya menegaskan. 1951. Ir. Rizal Hotpaham Damanik Rp 200,000 2019. Dra. Indah Triharyani Rp 50,000 sus dugaan korupsi di Departe- PT Masaro Radiokom. Salah pun menikahi Nadia pada 1994 Pinantun Hutasoit meng-ingatkan para pemimpin agar tak 1952. Ir. H. Zulham Audi, MM Rp 200,000 2010. Andriansyah, SE Rp 50,000 men Kehutanan karena ada satu dugaan Kapolri, karena silam, meski akhirnya kedua menganggap sepele suara yang digemakan rakyat baik dalam 1953. Abdul Chalik, SE Rp 150,000 2011. Suharso Rp 50,000 unsur utang budi dalam per- Wakil Ketua Pimpinan KPK pasangan ini bercerai. Dengan bentuk aksi unjuk rasa, pendapat-pendapat di media massa, 1954. Drs. H.R. Triawarman Rp 150,000 2012. Ir. Indra Azhari Rp 50,000 nikahannya dengan Nadia Chandra M Hamzah punya cerita inilah, Kapolri menduga maupun di laman internet. 1955. Mohd. Armein Daulay Rp 150,000 2013. Ismailsyah Rp 50,000 Madjid dibangun atas data yang kedekatan dengan MS Kaban. Chandra tidak memproses Pinantun menyatakan curiga bahwa semua “huru hara” politik 1956. Ir. Ilyas Armein Pane Rp 100,000 2014. Ir. Amrin Pane Rp 50,000 tidak akurat. Bahkan spekulasi Kedekatan ini terkait kebera- kasus Kaban itu.(dtc) yang bermotif suap-menyuap di kalangan penegak hukum itu 1957. Drs. H. Abdul Hadi Nasution Rp 100,000 2015. A. Rahim Yunus Rp 50,000 adalah bagian dari skenario memecah-belah NKRI, supaya 1958. A. Rahim Purba, SE Rp 100,000 2016. Ir. Nasrul Rp 50,000 Indonesia tidak tumbuh menjadi super power seperti China.’ 1959. H. Buana Ginting, SH Rp 100,000 2017. Zulfan Nasution Rp 50,000 Rp1,3 T Disiapkan Untuk PKH Dia mengingatkan, sejak era revolusi dan awal kemerdekaan, pihak luar selalu berupaya untuk mengerdilkan Indonesia, yang 1960. Ir. Rasyid Dian 1961. Ir. Elfi Diana Lubis 1962. Ir. Souvenir, MM Rp 100,000 Rp 100,000 Rp 100,000 2018. Siman 2019. Rudi Hartono, SH 2020. Farida Jayasumarta, SE Rp 50,000 Rp 50,000 Rp 50,000 YOGYAKARTA (Antara): depan dari kisaran 14-15 persen berdaya,” katanya. memiliki sumber daya besar dan berpotensi menjadi negara besar. 1963. Ir. H. Hobol Mulia Siregar Rp 100,000 2021. Rohana Sinaga, SE Rp 50,000 Pemerintah melalui Departe- fakir miskin pada 2009. Calon penerima bantuan Upaya-upaya itu antara lain terbukti dengan adanya Konfe- 1964. Ir. H. Sriyono Susilo Rp 100,000 2022. M. Asri Rambe Rp 50,000 men Sosial akan menyiapkan PKH adalah program yang wajib menandatangani per- 1965. Taufiq Qurrachman Rp 100,000 2023. Mustar Peranginangin Rp 50,000 dana sebesar Rp1,3 triliun untuk memberikan bantuan tunai setujuan yaitu menyekolahkan rensi Meja Bundar (KMB), yang menghendaki perpecahan RI. “Kalau dulu, pihak luar berusaha memecah-belah RI melalui 1966. Mili Mahardhika, SE Rp 100,000 2024. Ir. Mazriefnal Muaz Rp 50,000 mendukung salah satu program kepada rumah tangga sangat anak 7-15 tahun serta anak usia 1967. Haris Muda Siregar Rp 100,000 2025. Ir. Ima Sulastri Rp 50,000 penanggulangan kemiskinan miskin (RTSM) yang memenuhi 16-18 tahun yang belum menye- pemberontakan-pemberon-takan bersenjata, maka kini mereka 1968. Hamba Allah Rp 100,000 2026. Drs. Edi Syahputra Rp 50,000 yakni program keluarga hara- persyaratan terkait upaya lesaikan pendidikan dasar sem- menciptakan perti-kaian-pertikaian dengan dalih demokrasi 1969. Dr. Mazrisyaf Muaz Rp 100,000 2027. Ir. A.Aziz Rp 50,000 pan (PKH) 2010. peningkatan kualitas sumber bilan tahun, membawa anak dan HAM,” katanya. 1970. Ir. Andi Wibisono Rp 100,000 2028. Erwin Syafii Siregar, SE Rp 50,000 “Dana tersebut diperuntuk- daya manusia khususnya di bi- usia 0-6 tahun ke fasilitas kese- Menurut Pinantun , refor-masi yang dinilainya kebablasan 1971. Drs. Muhtadin Harahap, SmH Rp 100,000 2029. M. Ridho Nasution Rp 50,000 kan kepada sekitar 720 ribu dang pendidikan dan kesehatan. hatan sesuai dengan prosedur justru mencabut roh bangsa Indonesia, dengan dihilangkannya 1972. Ir. Ansari Rp 100,000 2030. Azwar Tanjung, BA Rp 50,000 kepala keluarga (KK) yang me- Sasaran PKH adalah RTSM kesehatan dan untuk ibu hamil lembaga tertinggi negara (MPR) dan demokrasi musyawarah- 1973. Ir. Bambang Wishnu Wardhono Rp 100,000 2031. Ishak Tupon Rp 50,000 menuhi syarat untuk menerima yang memiliki anggota keluarga harus memeriksakan kesehatan mufakat. 1974. Latifah Hanum Rp 100,000 2032. Alamsyah Ramli, BE Rp 50,000 bantuan PKH,” kata Menteri antara lain anak usia 0-15 tahun diri dan janinnya ke fasilitas “Kini, tak ada lagi lembaga tertinggi yang bisa menengahi 1975. Ir. H. Dasam Marwan Saragih Rp 100,000 2033. Suhermin Rp 50,000 Sosial Salim Segaf Al Jufri usai dan/atau ibu hamil/nifas dan kesehatan sesuai dengan pro- konflik antarlembaga yang ada. Roh bangsa seakan sudah tidak 1976. Ir. Syaiful Amri Rp 100,000 2034. Ir. M. Sueib Thahir Nasution Rp 50,000 bertemu dengan kepala panti berada pada lokasi terpilih. sedur PKH. melekat di tubuh bangsa ini, dan indikasinya terjadi setelah 1977. Sunardi, B.Sc Rp 100,000 2035. Suroso Rp 50,000 sosial pusat dan daerah di “Penerima dana dari pro- Program PKH telah dilaku- reformasi,” ujarnya. 1978. Ir. Dendi Affianto Rp 100,000 2036. Pranoto Rp 50,000 Yogyakarta, Minggu (8/11). gram ini adalah perempuan, bisa kan di beberapa negara, khu- 1979. Eddy Sufri Hutasuhut, SE Rp 100,000 2037. Ramadansyah, SP Rp 50,000 Menurut dia, program PKH merupakan bagian dari upaya ibu atau perempuan dewasa yang mengurus anak pada susnya Amerika Latin dan untuk Indonesia dimulai pada 2007 Pilkada Lewat DPRD Harus 1980. Ir. H. Muchlis Nasution 1981. Ir. Agusmarthin Pane Rp 100,000 Rp 100,000 2038. Ir. Hendri Yono 2039. Roy Kinanta Sitepu, SH Rp 50,000 Rp 50,000 pemerintah untuk menurunkan angka fakir miskin menjadi 8- rumah tangga yang bersang- kutan. Maksudnya adalah agar dan diharapkan dapat dilaksa- nakan secara berkesinam- Jamin Calon Independen 1982. Razak, B.Sc 1983. Effendi Pohan, SE Rp 100,000 Rp 100,000 2040. Ahmad Fadli Zebua, SP 2041. Darmanto , B.Sc Rp 50,000 Rp 50,000 JAKARTA (Antara): Wakil Ketua Panitia Perancang Undang- 1984. Amrizal Rp 100,000 2042. Lubbi Hidayat Pohan Rp 50,000 10 persen dalam lima tahun ke kaum perempuan juga dapat bungan hingga 2015. 1985. Hamba Allah Rp 100,000 2043. Sutrisno Saragih Rp 50,000 Undang Dewan Perwakilan Daerah (PPUU-DPD) Parlindungan 1986. Ir. Mohd. Nur Hutabarat Rp 100,000 2044. R.A. Hasibuan, SE Rp 50,000 Purba berpendapat, pemilihan kepala daerah kembali melalui 1987. Ir. Sudjatmiko, M.Sc Rp 100,000 2045. Hamba Allah Rp 50,000 DPRD harus membuka peluang kemunculan calon independen. 1988. Bambang Agustian, ST Rp 100,000 2046. Hamba Allah Rp 25,000 Kepada pers di Jakarta pada Minggu (8/11), Parlindungan 1989. Siti Indriani K Rp 75,000 2047. M. Edward Samudra, ST Rp 25,000 mengungkapkan, pemilihan kepala daerah melalui DPRD 1990. Syahrul A. Siregar Rp 75,000 2048. Fitra Rinaldy, ST Rp 25,000 mempunyai banyak keuntungan jika dibandingkan dengan 1991. Ir. Eka Priari Rp 75,000 pemilihan langsung. “Pemilihan kepala daerah melalui DPRD itu perlahan-lahan Jumlah laporan ke: 28 Rp 15.135.000 juga bisa menumbuhkan kepercayaan masyarakat pada partai,” katanya. Penerimaan dan Pemanfaatan Dana Penerimaan Pemanfaatan Saldo Harus diakui bahwa sekarang, kepercayaan masyarakat pada partai politik menurun tajam, katanya. Periode Mei 2000 s.d Desember 2007 4.197.061.507 3.709.066.585 487.994.922 Karenanya, menurut wakil rakyat asal Sumatera Utara itu, Periode 1 Januari s.d Desember 2008 712.917.041 489.562.714 223.354.327 citra partai harus dihidupkan lagi dengan memberikan kepercayaan kepada perwakilan partai di DPRD dalam memilih kepala daerah. Total 4.909.978.548 4.198.629.299 711.349.249 “Harus difahami bahwa tidak mungkin hidup berdemokrasi tanpa ada partai politik. Itu faktanya,” katanya menuturkan. Keterangan : Seluruh donatur adalah staf PTPN IV anggota Majlis Ta’lim Syiar Islam (MTSI) PTPN IV Parlindungan mengharapkan kalangan partai semakin profesional dengan kepercayaan itu. Konsultasi Zakat Bersama Ustadz M. Nuh Abdul Muis Keuntungan lain ialah pemilihan kepala daerah melalui DPRD SMS: 08126526295 itu akan berdampak pada penghematan biaya negara untuk e-mail: peduliummat@waspada.co.id Waspada/Muhammad Riza menggelar hajat demokrasi di daerah. Hubungi Kami: SEKOLAH AMBRUK: Wakil bupati Pidie Nazir Adam, SE,MM sedang berdialok dengan seorang “Biaya kerawanan sosial-politik juga bisa ditekan jika murid SD Negeri Cubada Air, Kec Pariaman Utara, Pemko Pariaman, Sumbar. Akibat gempa dibandingkan dengan pemilihan langsung,” katanya. Lembaga Amil Zakat Provinsi Sumatera Utara Peduli Ummat Waspada bumi gedung SD tersebut ambrul. Masyarakat Pidie melalui Pemkab Pidie memberi bantuan Parlindungan menggambarkan di sejumlah daerah, Jl. Brigjen Katamso No. 1 Medan telp. 061-4511936 - 4150858 (evi) Fax. 061-4511936 berupa kebutuhan sekolah bagi 446 murid SD di Pemko Pariaman yang diserahkan langsung masyarakatnya menjadi terpecah dan suasana keamanan menjadi E-mail: peduliummat@waspada.co.id oleh Wabup Pidie. kurang baik pada pasca-pemilihan kepala daerah. Khusus Kodya Medan, ZIS diatas Rp 500.000,- kami siap menjemput (4511936 - 08126375062)
    • WASPADA Senin 9 November 2009 Sport 5 Kisruh Atlet Aceh Di Paraguay Sanchez Sesalkan Visa Turis BANDA ACEH chezgol Management adalah Konsulat Kehormatan RI di HotelAquariumdankuncikamar pengaruhi pemain lainnya. rekanan yang ditunjuk Pemerin- Paraguay. di Hotel Olympico juga dibawa. Selama setahun di Paraguay, (Waspada): Direktur PT tah Aceh dalam program pelatih- Untuk menjelaskan Saat kembali dari sana, kejadian tim muda Aceh telah melakukan andanpembinaanatletsepakbola persoalan tersebut, Nelson berlangsungdankacahotelpecah. uji coba dengan tim peserta Sanchezgol Management, U-15 di Paraguay. didampingi Kadispora Aceh T Sebenarnya, pihak polisi Para- kompetisi di Paraguay dan Nelson Sanchez “Sebenarnya, visa tersebut Rayuan Sukma serta Ketua PSSI guay ingin menangkap pelaku hasilnyacukupmenggembirakan. tidak sesuai karena anak-anak Aceh Zainuddin Hamid diminta tapi dihalangi mereka,” jelasnya. Dari 45 pertandingan, 24 di menyebutkan, visa para atlet sudahsetahunlebihikutprogram langsungGubernurIrwandiYusuf Sebelumnya,KadisporaAceh antaranya menang dan selebih- Aceh baru berakhir pada 27 latihan,namunmerekamendapat membahas masalah yang T Rayuan Sukma menyebutkan, nya seri maupun kalah. visa turis yang hanya berlaku melibatkan atlet sepakbola Aceh ada beberapa anak yang tidak “Masyarakat Aceh sekarang November mendatang di selamatigabulan,”sebutSanchez, di Paraguay. mengalami perkembangan ini sangat berharap banyak Paraguay, sehingga dia Minggu (8/11). Dalam pertemuan dengan selama berlatih di Paraguay. dengan tim muda ini, sehingga Menyikapi masalah ini, kata gubernur, Nelson sudah men- “Kalau ada di antara mereka kehadiran mereka nanti bisa menyayangkan sikap Sanchez,akansegeradiselesaikan jelaskanperkarayangsebenarnya yang dinilai tidak ada perkem- membangkitkan kembali per- bersama tim yang ditunjuk dan soal pemukulan yang bangan, maka terpaksa kita coret sepakbolaandiAceh,”kataRayuan kedutaan yang hanya Gubernur Irwandi Yusuf yang sebenarnya tidak benar. Nelson dan digantikan dengan pemain Sukma. mengeluarkan visa turis. akan berangkat ke Paraguay pada mengakui, saat kejadian dirinya lain,” katanya, seraya menam- “Akan ada tim khusus yang Waspada/ist 14 November nanti. memang ingin ke lokasi atlet bahkan anak-anak yang tidak akan mengevaluasi perkemba- Nelson menambahkan saat menginap. berkembang justru bisa menim- ngan anak-anak selama mengi- Atlet Aceh yang sedang berguru ilmu sepakbola di Paraguay diabadikan di salah satu tempat latihan ini paspor para atlet ada bersama “Awalnya pemain mau ke bulkan masalah dan mem- kuti latihan setahun ini.” (b05) beberapa bulan lalu sebelum kabar bentrok dengan kepolisian setempat. Seperti diketahui PT San- Divisi II Liga Indonesia Grup A PSGL Pukul PS Sergai KUTACANE (Waspada): yang melihat kurang menggi- gol setelah memaksimalkan PSGL Gayo Lues berhasil meme- gitnya barisan penyerang tim umpan Teguh Wira Sanjaya. tik poin penuh dengan memukul MacanLeuser,mengambilinisiatif Tertinggal satu gol, pelatih PS PS Serdang Bedagai 1-0 pada memasukkan Tata Setiadi, Sergai Suganda Lubis melakukan pertandingan perdana Kompetisi sehinggaseranganPSGLsemakin tiga kali pergantian pemain. Divisi II Liga Indonesia Grup A hidup dan tajam. Masuknya Bambang Sugondo di Stadion H.Syahadat Kutacane, Menit 28 dan 34, tendangan yang berpostur tinggi membuat Minggu (8/11) sore. Irvan Myidin dan Hamdan serangan Sergai melalui umpan Dihadapanribuanpenonton Febriansyah nyaris membuat panjang semakin hidup. dan disaksikan Bupati Gayo Lues PSGL unggul, tapi kiper Ewin Bahkan sepuluh menit jelang H Ibnu Hasyim SSos MM, Bupati Nuriadin sangat cekatan pertandinganusai,Sergaimampu Agara H Hasanuddin B, Ketua mengawal gawang tim tamu. mengurung daerah pertahanan DPRK Gayo Lues HM Amru dan Memasuki babak kedua, PSGL dan menciptakan peluang Ketua DPRK Agara HM Salim PSGL dan Sergai sama-sama gol melalui Dedek Afrizal dan Fakhri.SE.MM, PSGL menerap- meningkatkan tempo permain- Julham. kanpermainancepatdanumpan an. Sergai bahkan mulai berani Namun kokohnya ben-teng pendek dari kaki ke kaki. Namun main cepat dibarengi umpan Macan Leuser dikoordinir serangan yang dibangun Irvan panjang yang merepotkan bek Hamdan Febriansyah dan Ham- Mydin cs sering kandas di barisan M Ridwan dan Tegar Prasetio. danFebriansyahsertacemerlang- Waspada/Zafrullah pertahanan Sergai. Tuan rumah tetap menerap- nya penampilan kiper Larika Atlet Aceh, Muhammad Riza, berhasil melampaui mistar setinggi 1,91 meter dalam cabang lompat tinggi Popnas X-2009 di lapangan atletik UNY untuk menggondol Sampai dua puluh menit kan permainan pendek dan Prima, membuat skor 1-0 tetap medali perak, Minggu (8/11). jalannya laga dipimpin wasit Arif serangan balik. Lima menit usia bertahan hingga bubaran laga. Johan,serangankeduatimterlihat babak kedua,Tata Setiadi berhasil Di tempat yang sama, Senin Atletik Aceh Persembahkan Sepakbola, Voli Gagal menonton karena terlalu berhati- hati. Pelatih Gayo Lues Superdi memecah kebuntuan dan membuat penonton tuan rumah bersorak sorai. Tata mencetak (9/11) ini, PSAU Lhoksukon akan bertanding melawan Poslab Labuhan Batu. (b27) YOGYAKARTA (Waspada): Tim sepakbola dan bola voli Aceh Perak Kedua gagal melaju ke semifinal dan harus angkat koper dari arena Popnas X-2009 di Yogyakarta, setelah sama-sama menyerah dalam babak 8 Besar, Minggu (8/11). Divisi III Wilayah Sumbagut Popnas X-2009 Yogyakarta Dengan demikian, Aceh masih memiliki harapan menambah pundi-pundi medali dari cabang atletik, dayung dan panahan yang PS Pidie Jaya Tinggal Selangkah masih akan bertanding hingga Selasa (10/11) mendatang. “Meski YOGYAKARTA (Waspada): Rudiniyangberlagadinomor tidak diunggulkan, kita masih menaruh harapan dari tiga cabor TAPAKTUAN (Waspada): PS jer HYusri Abdullah SH yang juga Jaya mengakibatkan kemelut di Cabang atletik mempersembah- Klasemen perolehan medali lempar cakram hanya mampu Pidie Jaya yang turun dalam dua KetuaHarianPSPidieJayakepada muka gawang Pidie Jaya. Meski tersebut,” ujar Ketua Kontingen Aceh, Musri Idris. kan medali perak kedua bagi kon- Jatim 22 11 22 berada di peringkat 12 dari 14 Begitu pun, Musti menyatakan pihaknya akan melakukan evaluasi pertandingan dengan hasil sekali Waspada, Minggu (8/11). “Jika tidak gol, sepak pojok itu berbun- tingen Aceh di ajang Pekan Olah- DKI 14 20 17 peserta, setelah melaku-kan atas kegagalan Aceh di ajang Popnas X ini. “Kita akan lakukan evaluasi menang dan sekali seri, hampir tim kesayangan masyarakat Pidie tut panjang karena tiba-tiba wasit raga Pelajar Nasional (POPNAS) Jabar 15 18 11 lemparan sejauh 22,75 meter. untuk mengetahui letak kesalahan sehingga sulit mencapai hasil dipastikan menjadi juara grup Jaya itu berhasil menjadi juara Rispannaiditergulingdilapangan. X-2009 Yogyarakta, Minggu (8/ Jateng 11 9 19 Hafiz Akbar yang bertanding yang memuaskan,” sebut Kabid Olahraga Dispora Aceh tersebut. III kompetisi Divisi IIIWilayah Su- grup, maka kita tinggal selangkah Selanjutnya, kiper Bintang Jaya 11). Medali ini disumbangkan Kaltim 6 7 9 di nomor bergengsi lari 100 meter Langkah tim sepakbola Aceh terhenti di babak 8 Besar setelah matera Bagian Utara (Sumbagut) lagi untuk menembus Divisi II,” mengejar sekaligus menghajar Muhammad Razi yang berlaga D IY 2 6 9 putra,hanyamampumenembus dipaksa menyerah 1-3 oleh Maluku Utara melalui drama adu penalti. di Tapaktuan, Aceh Selatan. katanya. wasit. di nomor lompat jauh putra. Sumut 3 3 7 babak final. Di final, Hafiz yang Sepanjang waktu reguler 2x40 menit, kedua tim bermain imbang Dalam pertandingan kedua- Pada pertandingan melawan Kerusuhan yang berlanjut DilapanganatletikUniversitas Aceh - 2 1 mencatat waktu 11.06 detik tanpa gol. nya, Pidie Jaya menahan Bintang BintangJaya,permainanberlang- pengejaran dan penghajaran wa- Negeri Yogyakarta (UNY), Razi berada di peringkat VIII serta Dalam adu penalti tersebut, empat algojo Aceh gagal dan hanya Jaya Kisaran 0-0 di lapangan Naga sung kurang menarik karena sit itu dipicu kemarahan pemain berhasil mencatat lompatan ditentukan kegagalan pelompat Fliyanti Chairunnisa di nomor Rian Saputra yang mampu menjebol gawang Maluku Utara. Tiga Tapatuan, Aceh Selatan, Sabtu kedua tim sulit mengembangkan Bintang Jaya, ketika kemelut setinggi 1,91 meter dan hanya tinggiasalBali,Agung,yanghanya lari 100 meter hanya sampai di eksekutor yang gagal adalah Martunis, Muakkil dan Muhammad (7/11). Sehari sebelumnya, Pidie permainan menyusul kondisi terjadidimulutgawangPidieJaya. selisih 2 cm dari peraih medali mampu tetap bertahan di semifinal dan Depita Sari harus Riandi. Dari kubu Maluku Utara, hanya dua yang gagal melaksanakan Jaya bermain gemilang dan lapangan yang licin. Bahkan di Anak-anak Kisaran menuding emas Faturrahman (NTB) yang lompatan setinggi 1,89 meter. tersingkir di babak awal lari 5000 tugasnya, sedangkan Ruud Gulit S Yunus, Ridwan Malagapi dan menggulingkanPersitasTakengon menit 70, pertandingan sempat telah terjadi handsball, namun mencatat lompatan setinggi 1,93 “Alhamdulillah, ternyata meter. Maskur Idris berhasil memperdaya penjaga gawang Aceh Zulkifli. (Aceh Tengah) 1-0. Dari hasil itu, terhenti beberapa menit akibat wasit tidak meniup peluit. Akibat- meter. Medali perunggu direbut lompattinggimasihtetapmenjadi Selain itu, Fliyanti yang Mengikuti jejak sepakbola, tim bola voli Aceh juga harus tersingkir Pidie Jaya memperoleh nilai pemain kedua tim nyaris terlibat nya,wasitmenghadiahiduakartu Agung (Bali) yang melompat penyumbang medali bagi Aceh. kembali turun di nomor lempat dari pertarungan di arena Popnas X setelah dipaksa menyerah 0- empat sekaligus memimpin baku hantam. merah kepada penjaga gawang setinggi 1,89 meter. Meski di Popnas sebelumnya jauh, Siska Soraya dan Hasrizal 3 oleh Jawa Timur dalam babak 8 Besar di GOR FIK Universitas klasemen sementara. Setelah pertandingan dilan- Bintang JayaWarsinto dan kapten Semula, para ofisial kon- nomor ini menyumbang medali di nomor lari 400 meter putra Negeri Yogyakarta. Demikian dilaporkan Mana- jutkan, tendangan pojok Bintang tim Lesman Hardi. (b21) tingenAcehsempatwas-wasakan emas,” tutur Ketua Kontingen dan putri, juga tidak mampu Kekalahan ini memang sudah terlihat sejak Ibrahim cs dipaksa keberhasilan Razi merebut me- Aceh, Musri Idris SE MSi. menambah pundi-pundi medali menelan kekalahan 12-25 di set pertama. Ketika itu sudah jelas terlihat dali. Pasalnya, Razi sempat dua Namun, keberhasilan Razi bagi kontingen Aceh yang hingga kualitas pemain-pemain Aceh masih berada jauh di bawah lawannya. Dana PL Rp90 Juta kali gagal melakukan lompatan menyumbangkan medali ter- kini masih tertahan di peringkat Terbukti, meski masih mampu memberikan perlawanan, anak- setinggi1,89meter.KepastianRazi meraih medali perunggu nyatatidakdiikutirekan-rekannya yang lain. 18 klasemen perolehan medali dari 33 kontingen.(b07) anak Aceh kembali menyerah 22-25 di set kedua dan akhirnya harus tersingkir setelah di set ketiga 20-25. Diakui pelatih Saiful Hazainun, kemampuan Aceh memang belum bisa mengimbangi tim-tim dari Lapangan Sepakbola Direhab Cilet-Cilet pulau Jawa. (b07) GANDAPURA (Waspada): “Ditimbun hanya sekitar 70 telepon. PSAP Siap Jajal PSMS Dayung Besitang Mendominasi Sejumlah warga Desa Lhok Mambang,KecamatanGandapu- ra, Bireuen, melaporkan pekerja- truk tanah saja, sedangkan harga satu truk tanahnya itu Rp300 ribu saja, lalu diratakan begitu saja,” Malahan, lanjutnya, dana rehab lapangan desanya itu awalnya diinformasikan Rp90 tangkan persiapan. Pada Rabu an dari Penang FC. Dikatakan, an rehabilitasi lapangan sepak- kata seorang warga yang dibenar- juta,namunyangadahanyaRp58 (11/11) di Stadion Kebun Bunga, dua laga itu akan dijadikan seba- P.BRANDAN (Waspada):Tim sebagai juara setelah mengalah- bola di desanya dikerjakan pihak kan warga lainnya. juta,sedangkansisanyatidaktahu. PSAP yang dimanajeri M Yasin gai ajang fokus mental pertan- Pedayung Stasiun Besitang kan pedayung dari tim Raksasa, pemborongcilet-cilet (asal jadi). “Coba lihat sendiri, bagai- “Masalah ini telah kami Amin akan menjajal kekuatan dingan. mendominasi lomba dayung KecBrandanBaratdantimLantak Padahal, dananya proyek mana hasilnya setelah ditimbun serahkankepihakDisporabudpar PSMS Medan. Kustiono menyebutkan, yang digelar Marinir Yonif-8 Sian asal Kec Sei. Lepan. penujukanlangsung(PL)bantuan lapangan ini. Selain hanya Kabupaten Bireuen untuk disele- Untuk laga tersebut, skuad kendati PSMS merupakan tim Tangkahan Lagan dalam rangka Wadanyon Mayor (Mar) MH provinsi Rp90 juta. Menurut ditimbun saja, kubang di sebelah saikan dan saya harap kepada menyambut HUT Korps Marinir Silalahi mengingatkan, para keterangan,lapanganyangberada baratnya tidak diapa-apakan,” rekanan cek langsung kondisi Laskar Aneuk Naggroe (The besar tapi pemain-pemainnya ke-64, Minggu (8/11) peserta agar dapat menjaga di Dusun Matang Jrok itu meru- ujarnya sambil menunjuk ke arah lapangan itu dan segera diselesai- Lan) memboyong 26 pemain akan berusaha mengimbangi Ribuan masyarakat pun sportivitas dan kebersamaan. plus tiga legiun asing. ”Ujicoba lawan. ”PSMS itu tim besar dan pakan lapangan kecil tempat lapangan yang dimaksud. kan,” tegasnya. memadati pesisir Sungai Babalan Silalahi berharap event yang anak-anak muda bermain Informasi lainnya, pekerjaan Sementara itu, Sekretaris Dis- ini sebagai tahapan akhir dari sejauhmana kemampuannya untuk menyaksikan perlombaan digelar ini dapat melahirkan persiapan menjelang kompetisi. nanti akan kita lihat,” katanya. sepakbola setiap sore hari. lapanganbolakakididesakawasan porabudpar Bireuen, Abdullah dayung perahu karet yang diikuti pedayung tangguh. Namun, beberapa bulan lalu pinggiran Gandapura itu, telah Ali membenarkan lapangan itu Waspada Kita ingin lihat kekurangan dan Masalah kelemahan pada 19 tim tersebut. Para penonton Selain lomba dayung, Yonif kelemahan tim,” ungkap Yasin lini tengah dan bawah, Kustiono memadati badan jembatan Marinir menyelenggarakan atau saat menjelang pemilu legis- diserahterimakan pihak pekerja belum selesai dibangun. “Itulah Arsitek PSAP Kustiono a, Minggu (8/11). menyatakan para pemainnya Jalinsum Medan-Aceh bahkan turnamen bola voli yang diikuti latif, warga desa itu mengajukan dengan kades setempat dan yang kami herankan informasi- SIGLI (Waspada):Tiga pekan Dalam kesempatan yang telah bertanding di banyak level sampai ke pinggiran sungai. 14 tim dari Telukaru dan dibuka permohonan dana rehab pada buktinya telah dikirim ke pihak nyalapanganbelumsiapdirehab, menjelang bergulirnya kom- sama, arsitek PSAP Kustiono plus latihan pagi-sore sehingga Tim dayung Stasiun Besitang Danyon Mayor (Mar) Umar pemerintah provinsi. Begitu da- Dispora provinsi. Namun, hal itu namun kabarnya itu telah dise- petisi Divisi Utama musim 2009/ mengungkapkan timnya juga faktor kelelahan akan ber- yang hampir setiap tahun men- Farouq pada 3 November lalu. nanya turun, proyek dikerjakan dibantah oleh Kades Lhok Mam- rahterimakan antara pemboro- 2010, PSAP Sigli terus mema- mendapat tantangan kehormat- pengaruh. (b20) juaraiperlombaankembalitampil (a02) asal jadi oleh rekanan. bangTaufiqYyangditanyamelalui ng dengan kades,” tanyanya.(b03)
    • 6 Sport WASPADA Senin 9 November 2009 Grenoble Senang Pecah Telur PARIS (Waspada): Grenoble senang ‘pecah telur’ dengan memetik poin pertamanya di Ligue Hasil Sabtu (Minggu WIB): 1 Perancis musim ini, setelah menahan 0-0 AS Monaco vs Grenoble 0-0 Monaco, Sabtu (Minggu WIB). Nancy vs St Etienne 0-1 “Selamatkepadasemuapemainyangberada Lorient vs Boulogne 5-0 di tim. Kami tidak menampilkan sepakbola indah, Sochaux vs Rc Lens 1-2 tapi sekali lagi kami tidak pulang kandang tanpa Le Mans vs Auxerre 0-1 hasil,” kata kiper Grenoble Ronan Le Crom. Paris SG vs OBL Nice 0-1 Tim papan bawah itu menahan Monaco Valencs vs Montpellier 1-1 di Stade Louis II, setelah mengalami 11 kali kekalahan beruntun. Le Crom yang jadi Klasemen Ligue 1: pahlawan lewat penampilan gemilangnya, antara Bordeaux 11 8 1 2 20- 7 25 lain saat menyelamatkan gawangnya dari Lyon 11 7 2 2 17-11 23 tembakan Yohan Mollo pada awal duel. Auxerre 12 7 2 3 13-10 23 Monaco yang tampil tanpa diperkuat mesin Monaco 12 7 1 4 16-11 22 golnya asal Brazil, Nene, terpaksa mengganti Lorient 12 6 3 3 20-11 21 pemain Korsel Park Chu-young pada babak Montpellier 12 6 3 3 19-16 21 pertama karena cedera. Mereka mendominasi Valenciennes 12 6 2 4 23-16 20 pertandingan,namuntetaptakmampumenjebol Marseille 10 5 3 2 17-10 18 gawang Le Crom. AS Nancy 12 5 2 5 17-17 17 Akibatnya tim asuhan Guy Lacombe itu OBL Nice 12 5 2 5 15-21 17 merosot ke urutan empat klasemen dengan 22 St Rennes 11 4 4 3 15- 9 16 poin dari 12 pertandingan. “Bagi kami ini seperti Paris SG 11 4 4 3 17-12 16 kemenangan,” dalih Lacombe. Toulouse 11 4 3 4 11- 8 15 Dalam duel lainnya, AJ Auxerre meraih Sochaux 12 5 0 7 13-19 15 kemenangan keenam beruntun untuk naik ke Lille 11 3 4 4 12-14 13 posisitigadengan23poindengankemenangannya St Etienne 12 4 1 7 10-15 13 1-0 di Le Mans. Rc Lens 12 3 3 6 11-20 12 Sedangkan Paris St Germain merosot ke Boulogne 12 2 3 7 9 -22 9 urutan 12 setelah Loric Remy mencetak gol jelang Le Mans 12 2 2 8 10-18 8 akhir pertandingan untuk membawa tim tamu Grenoble 12 0 1 11 5 -23 1 OBL Nice menang 1-0 di Parc des Princes. Kejutan terjadi ketika Montpellier kehilangan peluang naik ke posisi tiga setelah hanya bermain imbang 1-1 diValenciennes. Kevin mencetak dua gol ketika Lorient membantai Gameiro dan MaramaVahirua masing-masing Boulogne 5-0. (h01/ant/rtr/uefa) AP Bintang Real Madrid Ricardo Kaka (atas) memenangkan pertarungannya melawan bek Atletico Antonio Lopez dalam derbi La Liga Primera di Stadion Vicente Calderon, Madrid, Minggu (8/11) pagi WIB. Firasat Positif Real MADRID (Waspada): Real Hasil Sabtu (Minggu WIB): Atletico Sergio Aguero. Real kini memiliki 25 poin, Klasemen Liga Primera Setelah itu, Los Rojiblancos satuangkadibawahElBarcayang Madrid tetap selisih satu poin Atletico vs Real Madrid 2-3 terus menekan Los Merengues. menang 4-2 saat menjamu Real Barcelona 10 8 2 0 28- 7 26 Tenerife vs Malaga 2-2 Didukung para penonton, Diego Mallorca. Pedro Rodriguez Real Madrid 10 8 1 1 26- 8 25 di bawah Barcelona, setelah Barcelona vs Mallorca 4-2 Forlan mampu memperkecil mencetak dua gol dan Thierry Sevilla 9 6 1 2 16- 5 19 kedua tim teratas La Liga Getafe vs Deportivo 0-2 ketertinggalan 11 menit jelang Henry mengukir gol pertamanya Deportivo 10 6 1 3 14-11 19 bubaranpertandingan.Berselang musim ini untuk memantapkan Valencia 9 5 3 1 16- 9 18 Primera itu mendulang tiga menit, giliran Aguero men- dominasi Los Azulgranas. Mallorca 10 5 2 3 18-13 17 kemenangan pada journada sama sekali tidak mencerminkan cetak gol kedua Atletico, tapi Real Pelatih Barca Pep Guardiola S Gijon 9 3 4 2 11-10 13 jalannya pertandingan,” ucap tetap mampu mempertahankan mengaku, tidak memasang Espanyol 9 3 4 2 8 - 9 13 ke-10. pelatih Real asal Chile Manuel kemenangannya. pemain sesuai formasi yang biasa Ath Bilbao 9 4 1 4 9 -13 13 Pellegrini. “PadababakpertamaAtletico diturunkannyadalamdueldiNou Osasuna 9 3 3 3 11-10 12 Bintang Brazil Ricardo Kaka mampumengancamkami.Kami Camp tersebut, setelah El Catalan Getafe 10 4 0 6 12-16 12 danMarcelopadababakpertama main bagus pada babak pertama beruntun main seri melawan Zaragoza 9 3 2 4 13-18 11 El Real menang 3-2 dalam serta striker Argentina Gonzalo dan mengendalikan permainan Osasuna di La Liga dan Rubin Tenerife 10 3 1 6 7 -19 10 derbi melawan Atletico Madrid, Higuain, masing-masing me- sampai Ramos diusir keluar Kazan di Liga Champions. Villarreal 9 2 3 4 12-11 9 meskipun harus tempur dengan nyumbangkan satu gol Los Blan- lapangan,” papar Pellegrini. Guardiola tidak memainkan Valladolid 9 2 3 4 14-17 9 10 pemain sejak menit 66 di cos. Menit 64, pasukan Pellegrini “Pada menit akhir cukup ba- gelandang Spanyol Xavi Hernan- Almeria 9 2 3 4 8 -12 9 Vicente Calderon, Madrid, terpaksa bertarung dengan 10 haya, tapi kami menikmati per- dezdanAndresIniesta,dushanya R Santander 9 1 4 4 10-17 7 Minggu (8/11) pagi WIB. pemain, setelah bek Sergio tarungan ini.Tapi kami tetap bisa berada mencadangkan bomber Atl Madrid 10 1 4 5 12-22 7 “Saya punya firasat positif Ramos terkena kartu merah mendominasi mereka di babak belia Argentina Lionel Messi. Malaga 10 1 2 7 10-15 5 dengan skuad saat ini. Skor akhir karena menjatuhkan striker kedua,” katanya menambahkan. (h01/ant/rtr/ap) Xerez 9 1 2 6 3 -16 5 Gunners Kembali Galak LONDON (Waspada): Arsenal melangkah ke posisi dua klasemen Liga Premier setelah menggasak Wolver- hampton Wanderers 4-1, Sabtu (Minggu WIB). Kapten Cesc Fabregas kembali membuat The Gunners galak dengan mencetak gol kelimanya musim ini. “Ini semua penampilan bagus. Mereka membuat awal yang kuat, tapi sekali kami unggul, kami mengendalikannya,” kata arsitek Arsenal Arsene Wenger. AP “Keyakinan ingin memberi yang terbaik dari kami Penyerang Grenoble Daisuke Matsui (depan) bertarung seimbang dengan pemain AS Monaco pada setiap pertandingan, kami punya potensi besar dan Cedric Mongongu di Ligue 1, Sabtu (Minggu WIB). kami bisa kuat dan semakin kuat,” tambahnya. Wolves yang merosot ke posisi tiga dari bawah, mengawali permainan dengan bagus. Namun gol bunuh diri dari Ronald Zubar dan Jody Craddock meluluhlantakkan harapan mereka meraih kemenangan pertama atas Gunners sejak 1979. Trezeguet Bahagia Fabregas dan Andrei Arshavin memastikan Arsenal unggul 4-0, sebelum Craddock memperkecil kekalahan menjadi 4-1. Di White Hart Lane, Tottenham Hotspur menang 2-0 Samai Rekor Sivori atas Sunderland untuk naik ke posisi empat besar, ROMA (Antara/Reuters): Mauro menggeser Manchester City yang bermain imbang 3-3 Camoranesi mencetak dua gol dalam waktu dua melawan Burnley. menit untuk membawa Juventus menang 5- Robbie Keane membuat Tottenham unggul lebih dulu 2 di Atalanta, Sabtu (Minggu WIB). pada menit ke-12. Namun keunggulan nyaris itu sirna David Trezeguet mencetak gol kelima Juve ketika mantan striker Spurs Darren Bent dijatuhkan oleh sekaligus golnya yang ke-167 sejak gabung di kiper Heurelho Gomes sehingga terjadi penalti. Turin pada 2000. Trezeguet pun bahagia bisa Namun tembakan penalti Bent menit 52 itu mampu menyamai catatan rekor klub yang dicatat Omar diselamatkan kiper asal Brasil tersebut, sehingga Sivori pada era 1950 s/d 60-an. kedudukan tidak berubah. Menit 68 gelandang Tom “Saya sangat bahagia, ini prestasi penting. Huddlestone mencetak gol kedua bagi Tottenham. Saya tidak pernah berfirik bahwa prestasi saya Manajer Sunderland Steve Bruce mengklaim, timnya itu akan menyamai Sivori ketika saya tiba di Juve,” beruntung dalam duel tersebut. “Setiap orang yang papar penyerang veteran Perancis itu. menyaksikan pertandingan hari ini akan tahu bahwa “Suatu yang penting adalah kami bermain kami akan mendapatkan sesuatu,” katanya. bagus dan bisa menunjukkan bahwa kami “Menurut saya Gomes akan dikeluarkan karena dia menikmati permainan ini, sekarang kami punya gagal membuat kesempatan membuat gol, kami konsistensi,” tambahnya. AP kehilangan penalti dan mereka hanya bermain dengan 10 Gelandang Italia Camoranesi menusuk ke Kapten Arsenal Cesc Fabregas (kanan) merayakan golnya ke gawang Wolves dengan rekan-rekannya pemain,” tambahnya. lini belakang lawan untuk memberi keunggulan di Molineux Stadium, Wolverhampton, Sabtu (Minggu WIB). (h01/ant/rtr) awal timnya menit 36. Satu menit kemudian, dia menambahkan gol. Jaime Valdes memperkecil ketertinggalan menit 52. Namun pemain tengah Juve asal Brazil Felipe Melo kembali memperbesar keunggulan timnya dengan mencetak gol ketiga bagi timnya dari luar kotak penalti. Selanjutnya pemain Atalanta Fabio Ceravolo mencetak gol menit 71 untuk kembali memperkecil ketertinggalan. Namun Diego Ribas dan DavidTrezequet memperbesar kemenangan bagi Si Nyonya Tua dengan mencetak gol menit 85 dan 87. Pada pertandingan lainnya, Napoli ditahan AP imbang 0-0 di Catania. Napoli sekarang berada di posisi kelima klasemen bersama Fiorentina, Penyerang Juventus David Trezeguet (17) saat pertandingan melawan Catania tidak mengukir rekor istimewa dari hasil duelnya melawan pemain Atalanta di Bergamo, Sabtu menunjukkan greget. Padahal Napoli mampu mengalahkan (Minggu WIB). Juventus 3-2 pada akhir pekan lalu, dan itu setelah pelatih Mazzarri menggantikan Roberto kemenangan ketiga dalam empat pertandingan Donadoni.
    • *Divisi II Liga Indonesia Grup A PSGL Pukul PS Sergai WASPADA Senin 9 November 2009 Sport 7 Haye Pemenang ‘David Lawan Goliath’ NUREMBERG, Jerman memimpikan ini dan sekarang menang sekali kalah meskipun pertarungan awal tahun ini saya dan perbedaan 40 kilogram lebih (Waspada): Petinju Inggris David menjadi kenyataan,” kata Haye. memiliki selisih kalah tinggi kalah melawan juara IBF, IBO, berat badan merupakan sesuatu Haye meraih gelar kelas berat “Saya memukul kepalanya hampir satu kaki dari lawannya WBO Vladimir Klitschko, tapi yangmulaiandarasakan,”ujarnya dunia versi WBA melalui keme- pada awal pertarungan tapi itu yang memiliki tinggi tujuh kaki kemenangan ini mengobati lagi. nangan satu poin atas pemegang sesuatu yang paling keras yang (2,13 meter) namun dia memiliki semuanya,” katanya menam- Petinju Rusia itu tetap ngotot gelar Nikolai Valuev dari Rusia, pernah saya pukul, ini seperti kelebihan kecepatan bertarung bahkan. bertarung meskipun dia tahu Minggu (8/11) pagi WIB. memukul tembok...saya pikir dan pukulan yang akurat. Petinju asal London berusia gelarnya bakal hilang. “Ini semua Haye yang menjadi juara tangansayapatah,sayamembuat- “Saya tidak mampu berta- 29 tahun ini, bertarung bagus ditentukan oleh ronde terakhir, kelas berat pertama Inggris sejak nya seperti seorang amatir, orang- rung baik pada ronde kedua dan melalui kombinasi pukulan ini semua jelas pada ronde Lennox Lewis mundur enam orang meragukan ketrampilan ketiga dansaya tidak bisa melan- tangan kirinya pada awal-awal terakhir,” ungkap Valuev, yang tahun lalu, dinyatakan menang saya...tapi saya buktikan saya carkan pukulan tangan kanan pertarungan dan justru petinju dengankekalahannyainirekornya dengan nilai 116-112 dari dua juri, menang,” tambahnya. saya dan justru saya bisa memu- Rusia itu dengan tinggi badannya merosot menjadi 50 kali menang dan juri ketiga memberi angka Valuev yang merupakan kuldeengantangankiri,sayaharus kesulitan bisa cepat menghajar dan dua kali kalah. (h01/ant/rtr) imbang 114-114 dalam perta- petinju juara dunia tertinggi dan memainkan kaki saya untuk bisa lawannya. rungan ‘David lawan Goliath’ terberat sepanjang masa ini harus membantu pertarungan saya,” Valuev mengaku kecepatan AP tersebut. berjuang selama 12 ronde mela- jelas Haye. lawannyacukupmenyulitkannya Petinju Inggris David Haye “Ini artinya semuanya untuk wan petinju yang dikenal cepat “Saya punya pertarungan untuk bisa melancarkan pukulan (kanan) mendaratkan pukulan- saya, ketika saya masih kecil saya Haye. besar malam ini, saya disiplin dengan baik. “Kecepatan lawan nya ke raksasa Rusia Nikolai telah ingin menjadi juara kelas Dengan kemenangannya ini selama enam bulan terakhir ini, menjadi masalah bagi saya, saya Valuev di Nuremberg Arena, berat dunia. Ini luar biasa, saya Haye kini memiliki rekor 22 kali saya sempat kecewa ketika tidak bisa bertarung dengan baik Jermany,Minggu (8/11) pagiWIB. Tangisan Bartoli Rezai Berharap Menang Dengan Cara Lain NUSA DUA, Bali (Antara): Juara baru ‘CommonwealthBank Tournament of Champions 2009 (CBTC 2009)’ Aravane Rezai yang berhak atas hadiah 200.000 dolar NUSA DUA, Bali AS, menyatakan simpati atas (Waspada): Final ‘Common- cedera paha Marion Bartoli. “Kamu hebat, Marion. Saya wealth Bank Tournament of menyesal atas yang terjadi pada Champions 2009 (CBTC kamu dan berharap bisa menang dengancaralain,”jelasRezai,yang 2009)’, berakhir di luar menangsecaratragisdiNusaDua, dugaan. Pasalnya, Marion Bali Minggu (8/11) petang. Final itu berakhir tragis dan Bartoli gagal melanjutkan menghebohkan, karena Bartoli gagal melanjutkan set pertama, pertandingan final sesama setelah cedera paha kiri yang petenis putri Perancis, akibat tidak bisa lagi ditahan sakitnya. Drama final sesama petenis cidera otot paha kirinya, putri Perancis itu sempat tegang sehingga Aravane Rezai yang pada posisi angka-angka awal, karena berkali-kali mereka saling berhak atas hadiah pertama tukar pukulan voli datar dari garis 200.000 dolar AS. belakang, menyilang, dan dalam kecepatan tinggi. Tidak kurang kecepatan itu mencapai 184 kilometer per jam, “Saya meminta maaf karena saat servis dilancarkan Bartoli. AP tidak bisa melanjutkan pertan- Dengan kenyataan final ini, skor Aravane Rezai mencium tropi CBTC 2009 yang direbutnya di Nusa dinganlagikarenacederaini.Saya menjadi 2-1 untuk Bartoli, yang Dua, Bali, Minggu (8/11). ucapkan selamat kepada Ara- dua kali menang atas Rezai pada vane, kamu hebat sekali. Di atas Toray Cup di Jepang beberapa Baru sekali ini Bartoli kalah, mempertaruhkan gelar juara semuanya, saya ingin berterima- pekan lalu dan di Korea Selatan namun itu menjadi kekalahan pertama seri penutup seri WTA kasih padamu, Papa,” beber Bar- tahun lalu. yang cukup menyakitkan karena Tour 2009. toli, seusai pertandingan di Nusa Dua, Bali, Minggu (8/11) petang. Diunggulkan pada posisi per- tama, membuat Bartoli difavorit- kansemuaorang.Apalagidiabaru Keramik Lisicki, naik ke posisi 11 WTA, setelah mengalahkan Kimiko Date- Krumm pada pertandingan AP Baju Sharapova Termahal semifinal. Marion Bartoli menangis sambil menutupi wajahnya saat diperiksa tim medis di Nusa Dua, Bali, Minggu (8/11). Posisi terakhir saat Bartoli NUSA DUA, Bali (Waspada): dilukis Sabine Lisicki dan baju Tiga barang lain yang menyatakandiritidakbisamelan- Sebanyak tujuh memorabilia Maria Sharapova. dilelang adalah“produk” peserta jutkan pertandingan final itu ada- dikira meminta waktu jeda, memakai handuk. Tetapi berkali-kali bola servisnya Wasit Cramea kemudian diberi- petenis top dunia dilelang di Pelelangan tersebut dilaku- CBTC 2009. Sebuah keramik lah 6-5 di set pertama dan pada namunkemudiandisadaribahwa Dokter kemudian memben- menyangkut di net, sehingga tahu bahwa Bartoli tidak bisa me- malam menjelang berakhirnya kan pada sesi makan malam di bergambar panorama alam yang angka 15-40 untuk keunggulan- dia mengalami cedera paha kiri. tangkan dua handuk di lantai dan menjadi keuntungan angka bagi lanjutkan final, dan memutuskan Commonwealth Bank Tourna- Karangasem Ballroom, Grand dibuat petenis Jerman Sabine nya. Rezai dalam pertandingan Wasit kemudian memberi- menyuruh Bartoli berbaring. Rezai. Justru pada saat Bartoli tambahan angka bagi Rezai itu ment of Champions (CBTC) Hyatt Nusa Dua, Bali, Sabtu (7/ Lisicki saat sesi di Jenggala terjual kan ijin kepada dokter dan tim Setelah didiagnosis, diputuskan memerlukan kekuatan lebih agar juga berarti kemenangan bagi 2009, termasuk keramik yang 11)malam.Acarainiturutdihadiri senilai 2.000 dolar AS. itu melakukan perlawanan se- bisamenang,saatitupuladiatidak petenis peringkat 40 WTA itu. maksimal dan seagresif mungkin. kesehatan melakukan perawatan bahwa pemberian obat pem- pihak WTA, penyelenggara Harga keramik lukisan Lisicki di tempat. Dia pun diberikan bunuh sakit serta balutan perban bisa melangkah lagi. Bartoli kembali ke kursinya turnamen, sponsor, undangan Sesaat setelah reli pukulan, Setelah Bartoli mengetahui dan mengambil handuk serta itu sama seperti sebuah keramik tiba-tiba Bartoli tertatih-tatih pembunuh rasa sakit dan paha dianggapbisamengatasimasalah. dan semua pemain yang tampil lain bertuliskan nama-nama kirinya dibalut. Bartoli sempat Bartoli pun melangkah dirinya tidak lagi mampu menangis tersedu-sedu. Ayah di turnamen pamungkas WTA menujukursinyadisisikananwasit melanjutkan perlawanan, dia sekaligus pelatihnya, Walther petenis yang mengikuti turna- Kerryline Cramea. Semula menangisatassakityangdiaderita menuju posisinya melakukan Tour 2009 ini. men di Bali dan itu ditulis sendiri kemudian melangkah menuju Bartoli, lantas menghampiri dan Barangyangpertamadilelang langkah Bartoli menuju kursi dan terus mengusap wajahnya servis dari sisi kiri lapangannya. net dan berbicara kepada Rezai. menghibur dia. oleh masing-masing pemain. adalah raket milik petenis putri Sementaraitu,sepatuketsKimiko nomor dua asal Rusia, Dinara Date-Krumm terjual 1.000 dolar Safina. Raket ini terjual seharga Lavinia Juarai Kuching Open 1.000 dolar AS (Rp9,4 juta). Selain Safina, beberapa pemain top dunialainyangmenyumbangkan AS. Total, lelang memorabilia itu menghasilkan 11.200 dolar AS atau lebih dari Rp105 juta dan mana Tedjakusuma juga meraih di ganda. an dengan Ayu Fani Damayanti. memorabilianya untuk dilelang seluruhnya dijadikan dana amal gelarjuaragandadenganmenun- Prestasi puncak yang pernah Di ajang hadiah total 10.000 adalahWilliams Bersaudara (Ve- untuk disumbangkan kepada dukkan unggulan keempat Han diraih di kancah nasional adalah dolar AS berpasangan dengan nus dan Serena) serta Sharapova. Yayasan Senyum Bali (Smile Na Lae/Kang (Korsel) 6-2, 7-5. menjuarai Seri Master Garuda Jessy Rompies tampil juara di Venus dan Serena melepas Foundation of Bali). (m33/rtr) Petenis kelahiran Semarang Indonesia Tennis Master pada ManilaOpenpada2008dantahun sepasang sepatu bermerek Nike 3 November 1987 ini mulai Desember 2008 setelah di final yang sama menjuarai Balikpapan yangmerekapakaisaatmengikuti 7 1 3 2 5 8 6 4 9 bermain tenis sejak usia tujuh menundukkan kompatriotnya OpenberpasangandenganSandy AS Terbuka, September lalu. Jika tahun. Lavinia yang di ITF Ayu Fani Damayanti. Gumulya. sepatu Venus terlelang seharga 8 6 2 1 9 4 3 5 7 menempati peringkat 388 dunia Selain menjadi anggota Pada 2007 saat berpasangan 900 dolar, sepatu Serena dihargai 5 4 9 6 7 3 1 2 8 menjadikan kedua gelar tersebut Timnas Fed Cup Indonesia, dengan Vivien Silfany-Tony ia 1.300 dolar. 1 3 4 8 2 7 9 6 5 sebagai kado teristimewa pada Lavinia pernah menjuarai menjuarai Tarakan Open 10.000 Barang termahal adalah 1 2 8 5 9 4 6 7 3 hari ulang tahunnya. turnamen dengan level 10.000 dolar AS. Sedangkan pada 2006 AP pakaian bertanding Sharapova daylife Pada tahun ini Lavinia sudah dolar AS di Manila Open Filipina iamenjuaraiturnamenkelasyang Pakaian bertanding berwarna yang sering dikenakannya 6 9 7 3 1 5 4 8 2 mencatat kemenangan 28 kali 2008 dan Jakarta Open 2006. sama Muzaffarnagar India saat pink milik Maria Sharapova sepanjang musim ini, yakni baju 9 7 8 5 6 1 2 3 4 JAKARTA (Antara): Petenis pertama sempat mendapat per- dalam karirnya di tunggal, Dalam karir di ganda turna- berpasangan dengan Wei-Ping yang sering dikenakan sepanjang terusan rok berwarna merah 3 2 1 4 8 9 5 7 6 putri Indonesia Lavinia Tananta lawananyangcukupmenyulitkan sedangkan di ganda 29 kali. men internasional ia pernah lima Lee asal China. Selama karirnya musim ini menjadi barang muda. Baju petenis putri terkaya 4 5 6 7 3 2 8 9 1 (foto) menjuaraiTurnamenTenis dari Jessy yang menempati ung- Namun dalam karirnya di level kali juara yakni di Tanjung Selor sejak terjun di tenis pro, Lavinia termahal pada lelang di Nusa di dunia itu laku di angka 3.000 ITF Kuching Open, setelah di final gulan kedua pada turnamen tour baru dua kali menjuarai berhadiah total 25.000 dolar AS sudah mengantongi 28.902 dolar Dua, Bali, Sabtu (7/11) malam. dolar AS atau sekitar (Rp38 juta). menundukkan rekannya Jessy berhadiah total 10.000 dolar AS turnameninternasionaldansekali pada tahun 2009 saat berpasang- AS. Rompies 6-1, 7-5, Minggu (8/11). itu. Lavinia yang dalam turna- Seharai sebelumnya, Lavinia men ini menempati unggulan yang berpasangan dengan Ro- Sudoku Isi kotak kosong dengan angka 1 sampai 9. Tidak boleh ada pengulangan angka mendatar, menurun, maupun di dalam kotak 3x3 bergaris tebal. Tidak ada keterlibatan matematika, hanya membutuhkan pertimbangan dan logika. Tingkat kesulitan hari ini: sedang (***). Jawaban di kolom 8. 5 9 4 8 2 6 5 7 8 2 6 3 5 1 6 9 2 3 3 8 7 6 2 6 4 7 5 8 7 3 5 1 1 9 5 6 7 1 2 3
    • 8 Sport WASPADA Senin 9 November 2009 Celtics Bangun Dari Tidurnya terakhir. EAST RUTHER- “Saya pikir kami hanya FORD, AS (Waspada): berdiri-berdiri saja. Sangat Usai menelan lucu melihat momen terbaik kekalahan pertama kami dalam pertandingan ini adalah pada lima menit ter- musim ini dari Phoenix akhir pertandingan,” ujarnya. Suns, Boston Celtics Mengawali musim ini, Cel- segera bangkit dari tics meraih enam kemena- ngan beruntun sebelum akhir- tidurnya untuk nya kesempurnaan mereka mengalahkan tuan dipatahkan Phoenix Suns 103- 110. Pierce menyebut, periode rumah New Jersey Nets di awal musim ini cukup berat 86-75, Minggu (8/11). namun kemenangan atas Nets membuat mereka kembali Tampil di Izod Center, percaya diri. Paul Pierce dan Rajon Rondo “Saya pikir kesulitannya menjadi bintang bagi Celtics. mulai terasa. Kami tahu bah- Baik Pierce maupun Rondo wa ini akan berat, melakukan sama-sama menyumbang- delapan pertandingan dalam kan 16 poin. Rondo bahkan 12 hari, tetapi kami bisa mela- menambahkan koleksinya luinya dengan rekor 6-1 dengan empat rebound dan (enam kemenangan, sekali tiga assist. kalah),” tambah sang kapten. Melawan Nets, Celtics ba- Atas kemenangannya, Cel- ru panas di kuarter keempat tics kini masih kokoh memim- ketika memasukkan 27 angka pin klasemen Wilayah Timur AP dan membiarkan Nets men- dan Nets berada di urutan 15 dulang 15 poin. Usai pertan- atau terbawah. Nets juga be- Basel Ciptakan Final Ideal dingan, Pelatih Celtics Doc lum pernah meraih satu keme- Rivers mengakui timnya tam- nangan pun sejak musim pil gemilang pada lima menit 2009/2010 dimulai.(m33/rtr) BASEL (Waspada): Dua petenis elit du- tapi di dua set selanjutnya, petenis Serbia Hasil lainnya: nia, Roger Federer (foto) dan Novak Djo- ini mampu bangkit dan akhirnya menang. Atlanta Hawks vs Denver Nuggets 125-100 kovic, akan bertemu di partai puncak Tur- Di Valencia, Andy Murray akhirnya Chicago Bulls vs Charlotte Bobcats 93-90 namen Swiss Indoors, Minggu (8/11). Final maju ke final Turnamen Valencia Terbuka Dallas Mavericks vs Toronto Raptors 129-101 ideal ini tercipta setelah mereka sama-sama setelah mengalahkan favorit tenis rumah Milwaukee Bucks vs New York Knicks 102-87 menyingkirkan lawannya di semifinal. Fernando Verdasco. Unggulan teratas asal Sacramento Kings vs Utah Jazz 104-99 Djokovic, unggulan kedua, lebih dulu Skotlandia ini menang setelah bermain meraih tiket final setelah berjuang ekstra tiga set di babak semifinal. keras melawan petenis Republik Ceko Ra- Murray yang absen bermain di turna- dek Stepanek 6-7, 7-5, 6-2. Sementara itu, men ATP sejak mengalami cidera di Ame- Brawn Tak Sabar Lihat Debut Senna Federer yang sedang memburu gelar ke- rika Serikat Terbuka pada September ke- empat turnamen di negaranya ini menang marin, tampaknya mulai menemukan per- BRACKLEY, Inggris (Was- straight set 9-7, 6-3, atas kompatriotnya, mainan terbaik saat mengatasi Verdasco. pada): Pemilik Brawn GP Ross Marco Chiudinelli. Petenis nomor empat dunia ini berhasil Brawn tidak sabar melihat Federer, unggulan pertama, masih mengalahkan Verdasco 6-3, 2-6, 6-3. Mur- debut Bruno Senna (foto) di terlalu tangguh bagi Chiudinelli. Dalam ray pun mengakui bahwa di awal sangat lintasan Formula One (F1) pertarungan di St Jakobshalle, pemain no- sulit namun selanjutnya dia dapat me- pada seri pertama GP Bah- mor satu dunia tersebut hanya mendapat nguasai pertandingan. rain, Maret 2010. perlawanan sengit di set pertama, karena “Ini sangat sulit untuk set pertama tapi Senna adalah pembalap harus diselesaikan dengan tiebreak. saya bisa melakukannya untuk tetap kuat. Brasil yang memiliki predikat Chiudinelli, mitra Federer di nomor Saya mengawalinya dengan rasa nyaman formula1.com sebagai runner-up GP2 dan ganda turnamen ini namun tersingkir di ba- dan saya bisa membaca permainnya dan merupakan keponakan le- bak pertama, berhasil mengamankan poin ini sedikit lebih baik,” ungkap Murray. genda F1 yang telah mangkat, Ayrton Senna. Pengalaman Senna saat memegang servis. Bahkan ketika tie- Di final, Murray bersiap menghadapi di balapan mobil formula sebenarnya telah dimulai sejak tahun break, dia unggul 4-1 sebelum ketenangan Mikhail Youzhny. Petenis Rusia ini lebih 2008, namun ketika itu hanya menjadi test driver bagi tim Honda. dan mental juara Federer membawanya dulu lolos ke final setelah mengalahkan Mundurnya pabrikan Jepang itu dari kompetisi F1 me- mengejar skor dan menang. Di set kedua, unggulan kedua dan juga rekan senega- mupuskan harapan Senna untuk berlaga di musim balap 2009. AP Federer dengan mudah meraih poin. Sete- ranya Nikolay Davydenko 3-6, 6-4, 6-3. Ketika Brawn GP memutuskan memilih Rubens Barrichello Forward Boston Celtics, Rasheed Wallace (kanan), bertarung dengan Trenton Hasell asal New lah unggul di game pertama, peraih 15 gelar Murray dan Youzhny hanya sekali sebagai pendamping Jenson Button, Senna mempertajam skill Jersey Nets dalam lanjutan kompetisi NBA di East Rutherford, New Jersey, Minggu (8/11). grand slam seolah tidak tertahankan lagi. bertemu yang dimenangkan petenis Skot- dengan turun di balapan Le Mans Series. Di semifinal sebelumnya, Djokovic landia ini di semifinal St. Petersburg, 2007. “Saya selalu terkesan dengan Bruno. Dia tampil cukup baik sempat kesulitan menghadapi Stepanek. Di “Dia bermain sangat baik dalam beberapa bersama kami dan kandidat terbaik yang kami miliki,” ujar set pertama, dia menyerah dalam pertaru- bulan ini jadi akan sangat sulit tapi saya Brawn.(m33/ini) ngan yang diselesaikan lewat tiebreak. Te- sudah tak sabar,” ujarnya.(m33/ap) KOMISI PEMILIHAN UMUM BADAN PERTANAHAN NASIONAL REPUBLIK INDONESIA KOTA MEDAN KANTOR PERTANAHAN KABUPATEN DELI SERDANG Jl. Kejaksaan No. 37 Medan Telp. (061) 4513031 Fax. (061) 4525036 Jl. Karya Utama, Lubuk Pakam (Kode Pos: 20154), Telp/Fax. (061) 7952197 website : www.bpn-deliserdang.web.id email: mail@bpn-deliserdang.web.id PENGUMUMAN PENDAFTARAN CALON ANGGOTA PANWAS PEMILU KOTA MEDAN PENGUMUMAN DAN PANWAS PEMILU KECAMATAN (Tentang Sertipikat Hilang) PADA PEMILU WALIKOTA DAN WAKIL WALIKOTA MEDAN TAHUN 2010 Nomor : 62/10//2009 NOMOR : 270/2637/KPU-MDN/2009 Untuk mendapatkan Sertipikat baru sebagai pengganti Sertipikat yang hilang, berdasarkan Dalam rangka melaksanakan Undang-Undang Nomor 22 Tahun 2007 tentang Penyelenggaraan Pemilu, Komisi Pemilihan Umum Kota Medan ketentuan pasal 59 ayat (2) Peraturan Pemerintah Nomor 24 Tahun 1997 tentang Pendaftaran membuka pendaftaran untuk menjadi Calon Panwaslu Kota dan Panwaslu Kecamatan pada Pemilu Walikota dan Wakil Walikota Medan Tahun 2010 Tanah, dengan ini diumumkan bahwa: dengan persyaratan sebagai berikut : a. Warga Negara Indonesia; Hak Atas Letak Tanah b. Berusia paling rendah 35 (tiga puluh lima) tahun; No. Nama/Alamat Tanah NIB Terdaftar Tanggal a. Jalan Kete- c. Mempunyai integritas, pribadi yang kuat, jujur dan adil Pemohon Jenis dan Atas Pembukuan b. Desa/Kel. rangan d. Memiliki pengetahuan dan keahlian di bidang yang berkaitan dengan pengawasan Pemilu; Nomor Hak Nama c. Kec. (Luas) e. Berpendidikan paling rendah : 1 2 3 4 5 6 7 8 1) Stara I (S-1) untuk calon Anggota Panwas Kota. 2) SLTA atau sederajat untuk calon anggota Panwaslu Kecamatan 1. JURAINI HM - RUMAHI 21-09-1983 a. - 409-M2 f. Berdomisili di wilayah Kota Medan untuk calon anggota Panwas Kota dan Panwas Kecamatan berdomisi di Kecamatan yang bersangkutan No. 83 GINTING b. L. PAKAM III dibuktikan dengan kartu tanda penduduk; c. LUBUK g. Mengajukan surat lamaran yang ditujukan kepada Ketua KPU Kota Medan dengan dilampiri : PAKAM 1) Fotocopy Kartu Tanda Penduduk (KTP); 2) Paspoto berwarna terbaru ukuran 4 x 6 sebanyak 5 (lima) lembar; Dalam waktu 30 (tiga puluh) hari sejak tanggal pengumuman ini, bagi mereka yang merasa berkeberatan 3) Daftar Riwayat Hidup (DRH); dapat mengajukan keberatan-keberatan kepada kami dengan disertai alasan dan bukti yang kuat. 4) Fotokopy surat kenal lahir/akte kelahiran; 5) Fotocopy ijazah yang dilegalisir oleh pejabat yang berwenang atau notaris; Jika setelah 30 (tiga puluh) hari tidak ada keberatan terhadap permohonan penggantian Sertipikat 6) Surat keterangan hasil pemeriksaan kesehatan jasmani dan rohani dari rumah sakit; tersebut diatas, maka Sertipikat pengganti akan diterbitkan dan berlaku sah menurut hukum dan Sertipikat 7) Surat pernyataan yang masing-masing ditandatangani diatas materai Rp. 6.000,- tentang: yang dinyatakan hilang tidak berlaku lagi. ✓ Setia kepada Pancasila sebagai Dasar Negara, Undang-Undang Dasar Negara Republik Indonesia tahun 1945, dan cita-cita Proklamasi Lubuk Pakam 29-10-2009 17 Agustus 1945; ✓ Surat pernyataan tidak pernah menjadi anggota Partai Politik bagi yang tidak pernah menjadi anggota Partai Politik atau surat keterangan KEPALA KANTOR PERTANAHAN KABUPATEN DELI SERDANG dari pengurus partai politik bahwa yang bersangkutan tidak lagi menjadi anggota partai politik dalam jangka waktu 5 (lima) tahun terakhir, bagi yang pernah menjadi anggota partai politik; ✓ Surat pernyataan tidak pernah dipidana penjara berdasarkan putusan pengadilan yang telah mempunyai kekuatan hukum tetap karena AFNANSYAH, SH, MKn melakukan tindak pidana yang diancam dengan pidana penjara 5 (lima) tahun atau lebih tidak termasuk tindak pidana politik dan/atau NIP. 19600202 198203 1 004 tindak pidana karena kealpaan; ✓ Surat pernyataan tidak sedang menduduki jabatan politik, jabatan struktural dan jabatan fungsional dalam jabatan negeri; ✓ Surat pernyataan bersedia bekerja sepenuh waktu; ✓ Surat pernyataan bersedia tidak menduduki jabatan di pemerintahan dan badan usaha milik negera (BUMN)/badan usaha milik Daerah (BUMD) selama masa keanggotaan. h. Pelamar dapat melampirkan keterangan atau bukti lain yang mendukung kompetensi calon; Pasang Iklan i. Lamaran dibuat masing-masing rangkap 3 (tiga) terdiri dari 1 (satu) asli dan 2 (dua) fotocopy dalam amplop kuning dan diberi tanda untuk Panwas Kota atau Panwas Kecamatan ; Hub. ☎ 4528431 j. Waktu penerimaan pendaftaran mulai tanggal 10 s/d 14 Nopember 2009. Medan, 9 Nopember 2009 HP. 081370328259 Komisi Pemilihan Umum Kota Medan Ketua Email dto iklan_waspada@yahoo.co.id Dra. EVI NOVIDA GINTING, MSP PELABUHAN INDONESIA I PENGUMUMAN PELELANGAN UMUM PENGUMUMAN PELELANGAN Nomor : 010/PL-Bank Sumut/PMA/XI/2009 Nomor : UM-58/29/25/PI-09 Panitia Pengadaan Barang/Jasa PT. Bank Sumut akan melaksanakan pelelangan dengan metode Prakualifikasi, maka dengan ini kami mengun- PT Pelabuhan Indonesia I (Persero) akan melaksanakan Seleksi Umum dang calon penyedia Barang/Jasa untuk mengikuti prakualifikasi : dengan Prakualifikasi menggunakan dana internal PT Pelabuhan Indonesia I (Persero) sebagai berikut: I. Sumber Dana : Anggaran PT. Bank Sumut Tahun 2009 II. Lingkup Pekerjaan : No. Uraian Perkiraan nilai Keterangan pekerjaan No Nama Nilai Bidang Sub Kuali- Pekerjaan Proyek Bidang fikasi 1 Pengawasan/Supervisi Rp. 302.280.000,- Prakualifikasi Perbaikan kerusakan Struktur 1. Pengadaan Rp. 18.771.147.450,- Pemasok 3.00.11 Non Dermaga Internasional Belawan Mesin ATM Barang (Alat/ Kecil International Container Terminal PT. Bank Peralatan Sumut Suku 1. Persyaratan Peserta: Tahun 2009 Cadang a. Perusahaan jasa konsultansi layanan jasa inspeksi teknis dengan sub Jl. Imam Komputer) layanan jasa engineering fase konstruksi dan instalasi pekerjaan Teknik Bonjol No. 18 sipil keairan (kode 31003) kualifikasi menengah; Medan b. Berpengalaman dengan nilai pekerjaan tertinggi Rp. 100.760.000 dalam waktu 7 (tujuh) tahun terakhir. III. Pendaftaran dan Pengambilan Dokumen Prakualifikasi dilaksanakan 2. Persyaratan Pendaftaran: pada : a. Pendaftaran harus dilakukan sendiri oleh pimpinan perusahaan yang ● Hari/Tanggal : Senin s/d. Kamis / 09 s/d. 12 Nopember 2009 namanya tercantum dalam akte pendirian perusahaan/daftar susunan ● Waktu : Pukul 09.00 s/d 12.00 Wib, dan pukul 14.00 s/d. 16.00 Wib. pengurus perusahaan atau dikuasakan dengan menunjukkan KTP asli ● Tempat : Sekretariat Panitia Lelang, Gedung Kantor yang masih berlaku; PT. Bank Sumut Lt. III Jl. Imam Bonjol No. 18 Medan b. Pada saat mendaftar menanda tangani pakta integritas. c. Pada saat mendaftar Menyerahkan foto copy Surat Izin Usaha (SIUJK) IV. Syarat Pendaftaran harus menyerahkan 1 (satu) set fotocopy sbb : yang masih berlaku, Akta Pendirian Perusahaan yang telah disahkan ● Akta Perusahaan/Kantor Perwakilan/Cabang dan Akta Perubahan oleh Menteri Kehakiman (berbentuk PT) dan oleh pengadilan (Badan (bila ada); usaha yang lain), KTP pendaftar, pengalaman perusahaan (seluruhnya ● Surat Izin Usaha Perdagangan (SIUP); memperlihatkan aslinya). ● Sertifikat Badan Usaha (SBU) yang masih berlaku; 3. Pendaftaran dan pengambilan Formulir Isian Prakualifikasi pada: ● NPWP dan SKPPKP; a. Hari : Senin s.d Rabu (pada hari kerja) Pendaftaran prakualifikasi dilakukan oleh Pimpinan/Direktur Perusahaan b. Tanggal : 9 s.d 11 Nopember 2009 dengan menunjukkan identitas diri asli (KTP/SIM/Pasport) dengan c. Jam : 08.00 s.d 16.00 WIB menyerahkan fotocopynya, apabila yang bersangkutan berhalangan maka d. Tempat : Kantor Pusat PT Pelabuhan Indonesia I (Persero), pendaftaran dapat dikuasakan kepada salah seorang staf/pegawai yang Biro Logistik Lantai III, tercantum dalam susunan personalia perusahaan dengan menyerahkan Jln. Krakatau Ujung No. 100 Medan. surat kuasa bermaterai Rp. 6000,- dengan Kop Surat Perusahaan, 4. Pemasukan Formulir Isian Prakualifikasi: Berstempel dan ditandatangani pimpinan/direktur. a. Hari : Senin s.d. Kamis (pada hari kerja) b. Tanggal : 9 s.d 12 Nopember 2009 Proses Pelelangan Barang/Jasa mengacu pada Peraturan Direksi PT. Bank c. Jam : 08.00 s.d 16.00 WIB Sumut No. 003/DIR/DUM-RT/PBS/2004 tanggal 22 Nopember 2004. d. Tempat : Kantor Pusat PT (Persero) Pelabuhan Indonesia I, Diluar waktu dan persyaratan yang ditentukan diatas, tidak dapat kami Biro Logistik Lantai III, layani/terima Jln. Krakatau Ujung No. 100 Medan. Medan, 09 Nopember 2009 Medan, 6 Nopember 2009 dto, PT PELABUHAN INDONESIA I (PERSERO) Panitia Lelang BIRO LOGISTIK
    • WASPADA Senin 9 November 2009 Medan Metropolitan 9 Gejala Saling Buka Aib Memprihatinkan ICMI Sumut Dilantik MEDAN (Waspada): Gubsu H Syamsul Arifin, Nasution sebelumnya juga me- mis, saat ini jumlah sarjana Guru Besar USU ini menge- SE mengaku prihatin semakin merebaknya gejala maparkan pentingnya di- strata satu (S1) se Indonesia mukakan, ICMI Sumut akan bangun ketahanan bangsa yang hanya sekitar 5 persen dari total memboboti secara intelektua- saling buka aib dalam kehidupan sebagian anak berintelektual, bermoral dan jumlah penduduk. Jumlah ini litas program Pemprovsu rakyat bangsa dewasa ini tanpa lagi mempedulikan adab beradab yang secara garis besar sangat sedikit, apalagi yang bertakwa kepada Tuhan Yang dan etika. Indikasi itu merebak dalam berbagai terangkum dalam gerak ICMI berstrata S2 dan S3 masih sangat Maha Esa, rakyat jangan lapar, pranata sosial, politik dan kemasyarakatan. yang seimbang antara berfikir sedikit dibanding jumlah rakyat jangan bodoh, rakyat dan berzikir dilandasi 3 dimensi penduduk. jangan sakit dan rakyat punya ICMI yaitu ke-Islaman, ke-Indo- Namun intelektualitas dan masa depan. “Ini sangat mengkhawatir- rapuh. nesiaan dan kecendekiawanan. kecendekiawanan dalam arti “Guna mendukung komit- kan bagi ketahanan bangsa kita “Ini salah satu tugas berat Ketua MPW ICMI Sumut luas potensinya sangat besar men dan tekad itu ICMI akan ke depan,” ujarnya pada pelanti- kaum intelektual. Masyarakat Prof DR H M Arif Nasution me- dan semuanya harus diberdaya- mengembangkan potensi hing- kan Majelis Pengurus Wilayah harus diberi penguatan secara Waspada/Ist ngemukakan, kecendekiawa- kan yang salah satu penggerak- ga lebih dekat kepada masyara- HADIRI PELANTIKAN: Gubsu H Syamsul Arifin, SE danWagub H Gatot Pujonugroho, ST menghadiri (MPW) Ikatan Cendekiawan seimbang antara adab dan ke- nan memang harus diberdaya- nya adalah organisasi cende- kat di antaranya dalam 2 bulan Muslim Indonesia (ICMI) Su- cerdasan. Dewasa ini cendekia- pelantikan Majelis Pengurus Wilayah (MPW) Ikatan Cendekiawan Muslim Indonesia (ICMI) Sumut kan di tengah-tengah masya- kiawan formal seperti ICMI. ini bertekad pada 70 persen masa bakti 2009-2014 diketuai Prof DR H M Arif Nasution, MA di Aula Martabe Kantor Gubsu, mut masa bakti 2009 – 2014 di wan semakin banyak, profesor rakat secara bijaksana dan Karena itu, tegasnya, pihak- kabupaten dan kota di Sumut Aula Martabe Kantor Gubsu di sudah ada di mana-mana. Jadi Sabtu (7/11) malam. proporsional. nya komit dan bertekad meng- sudah terimplementasi ICMI Medan, Sabtu (7/11) malam. seyogyanyalah kehidupan Dikemukakannya, hakekat gerakkan potensi intelektualitas kabupaten dan kota guna mem- Kepengurusan Sumut yang kemasyarakatan harus lebih arif dilantik Ketua Dewan Presidium Pusat ICMI DR Ir H Muslimin dan cerdas dalam melakukan perubahan dengan suatu pola kecendekiawanan hendaklah dimaknai dalam arti luas dan tidak sekedar gelar akademis masyarakat secara seimbang antara kecerdasan intelektual, emosional dan spiritual dalam bantu pemerintah meningkat- kan kualitas sumberdaya ma- nusia, pembangunan sosial dan Seleksi Panwas Pilkada Nasution tersebut diketuai Prof DR H M Arif Nasution, MA yang juga Dekan Fisip USU didam- atau rule of games beretika dan beradab,” ujarnya. Gubsu menaruh harapan atau pendidikan formal semata. Sebab, kalau hanya dari panda- memberhasilkan program pemerintah termasuk visi dan ekonomi demi keberhasilan pembangunan Sumut ke Diwarnai Isu Balas Dendam ngan formal dan gelar akade- misi Pemprovsu. depan,” ujarnya. (m19/m23) pingi 11 Wakil Ketua di antara- besar kepada seluruh keluarga MEDAN (Waspada): Seleksi No.22/2007 tentang penyeleng- kas dan ujian tertulis. Komisio- nya H Fadli Nurzal, SAg, Sekre- besar ICMI Sumut dapat mela- anggota Panitia Pengawas Pe- gara Pemilu, rekrutmen anggota ner tidak melakukan interview taris Drs H Nuzirwan B Lubis, MSP dibantu 11Wakil Ketua dan Bendahara Hj Syafrida Fitrie, SP, kukan gerakan strategis dalam memperbaiki ketahanan etika dan adab di tengah-tengah ma- KPU Rekrut Panwas Pilkada milihan Kepala Daerah (Panwas Pilkada) di sejumlah kabupa- ten/ kota di Sumut, diwarnai isu Panwas Pilkada dilakukan oleh KPUD. Namun Irham menolak (wawancara) langsung. Jadi pe- nilaiannya murni dari hasil ujian. Karena itu akan sangat MSP dibantu 2 wakil bendahara syarakat sehingga kehidupan balas dendam anggota KPUD merinci seleksi anggota Panwas objektif dan terukur. MEDAN (Waspada): Komisi Panwas kecamatan, tidak ang- selanjutnya memilih tiga Sebab, tambahnya, indikasi yang juga dilengkapi 10 divisi. seimbang antara berfikir dan (Komisi Pemilihan Umum Dae- Pilkada di kabupaten/kota Pemilihan Umum (KPU) Kota gota parpol, tidak pernah dipi- orang untuk Panwas kecama- rah) terhadap mantan anggota mana saja yang kecenderungan kecurangan ataupun sentimen Sedangkan Dewan Penasi- berzikir semakin kokoh di te- Medan merekrut Panitia Penga- dana penjara dengan ancaman tan,” ucap Tamba. hat Wilayah ICMI Sumut dike- ngah-tengah umat, kehidupan Panwaslu yang sering mengkri- balas dendam tersebut sangat akan sangat mudah diketahui, was (Panwas) Pemilu Kepala hukuman 5 tahun, sehat jas- Dijelaskannya, rekrutmen tisi kinerja mereka pada Pemilu terasa. “Tak perlu disebutkan ini karena penilaian dilakukan ber- tuai H Syamsul Arifin, SE deng- yang saling introspeksi dan sa- Daerah dan Wakil Kepala Dae- mani dan rohani dibuktikan Panwas diperkuat oleh KPU Legislatif dan Pilpres 2009 lalu. masih info simpangsiur. Tapi dasarkan dokumen yang ter- an 18 anggota di antaranya H ling memperbaiki, bukan saling rah Kota Medan Tahun 2010. dari rumah sakit pemerintah. Pusat sesuai hasil rekomen- Karena itu, Ketua KPUD Su- kita tetap ingatkan jangan lampir dari kelengkapan admi- Gatot Pujonugroho, ST yang buka aib dan saling menya- “KPU Medan melakukan Menurut Tamba, rekrutmen dasi rapat kerja secara nasional mut, Irham Buana Nasution sampai ada tangan-tangan jahil nistrasi dan nilai ujian tertulis. juga Wagubsu dan Prof DR H lahkan tanpa lagi memperha- seleksi Panwas sesuai perintah Panwas sesuai tahapan dan di Pekan Baru yang dihadiri KPU mengingatkan seluruh KPUD bermain,” katanya. “Kalau memang ada indikasi itu Abdullahsyah, MA yang Ketua tikan etika dan adab. UU No 22 tahun 2007 yakni da- jadwal Pemilu Kota Medan 2010. Pusat, KPU Provinsi dan KPU kabupaten/kota di Sumut agar Bahkan menurut Irham, silahkan laporkan ke kami. Akan Majelis Ulama Indonesia (MUI) Gubsu juga memaparkan lam pelaksanaan Pemilu kepala Dimana pasal 109 PP 49 tahun Kabupaten/Kota se-Sumatra melakukan seleksi Panwas Pil- KPUD kabupaten/kota sebaik- kita usut karena sangat gam- Provinsi Sumut. harapan-harapannya kepada daerah, KPU melakukan seleksi 2008 tentang perubahan ke-3 Utara. Oleh karenanya peratu- kada dengan transparan. “Ja- nya memprioritaskan mantan pang untuk mengetahuinya,” Gubsu mengemukakan, sa- kaum intelektual termasuk Panwas untuk selanjutnya diuji PP No 6 tahun 2005 tentang pe- ran Bawaslu No 15 tahun 2009 ngan jadikan seleksi dan rekrut- anggota Panwaslu Pemilu 2009 kata Irham. ling introspeksi dan meluruskan keluarga besar ICMI Sumut agar oleh Bawaslu di Jakarta,” kata milihan kepala daerah, Panwas yang menetapkan Panwaslu men Panwas Pilkada ini sebagai yang memiliki kinerja baik un- Secara terpisah, Pandapo- anggota KPU Kota Medan Divisi sudah terbentuk 30 hari sebe- Pileg dan Panwas Pilpres men- ajang balas dendam akibat kon- tuk masuk dalam daftar enam tan Tamba yang juga Ketua Ke- berbagai permasalahan me- membantu pemerintah lebih trol Panwaslu yang baik selama nama yang direkomendasikan lompok Kerja (Pokja) Seleksi mang diperlukan dan harus mencerdaskan kehidupan ma- Hukum dan Humas, Panda- lum tahapan dimulai. Sehingga jadi Panwas Pilkada tidak dapat potan Tamba kepada Waspada, jadwal pelantikan Panwas ditanggapi KPU Medan karena Pemilu lalu. Sehingga jangan ke Badan Pengawas Pemilu Panwas Pilkada Medan menja- dilakukan secara terus menerus syarakat demi ketahanan bang- ada upaya menggugurkan ang- (Bawaslu) sebagai calon Panwas min akan melakukan proses Sabtu (7/11), di ruang kerjanya direncanakan 12 Desember, tidak sesuai UU No 22/2007 demi perbaikan dan perubahan sa ke depan yang intinya mema- gota Panwaslu lama yang ikut Pilkada. “Secara objektif tentu seleksi secara transparan. Serta Jalan Kejaksaan Medan. karena 12 Januari 2010 meru- karena Panwas bersifat ad hock. keadaan bangsa dari hari ke dukan kecerdasan intelektual, kembali mendaftar,” kata Irham Panwas lama lebih paham tetap akan memberikan kesem- Syarat-syarat menjadi Pan- pakan tahapan pelaksanaan “Waktu pendaftaran Pan- patan bagi anggota Panwas hari. Namun semua itu hendak- kecerdasan emosional dan ke- kepada wartawan, Sabtu (7/11). undang-undang dan tata cara was Kota dan Panwas Kecama- Pilkada yakni pemutakhiran was kota dan Panwas kecama- Irham mengakui telah men- pelaksanaan Pilkada,” katanya. yang telah berpengalaman. lah tetap pada koridor saluran cerdasan spiritual, sebagaimana tan, ujar Tamba, sesuai UU No data pemilih. tan dapat dilihat di kantor KPU dan tatanan yang baik secara visi pertama Pemprovsu rakyat dengar adanya kecenderungan Irham menjelaskan, dalam “Kita berharap anggota 22 tahun 2007 yakni warga “Nantinya KPU Medan Medan Jalan Kejaksaan No 37 aksi ‘balas dendam’ KPUD ka- proses pendaftaran dan seleksi Panwas yang sebelumnya turut beretika dan beradab, bukan sa- bertakwa kepada Tuhan Yang negara Indonesia (WNI), usia mengambil 6 besar untuk calon Medan. Waktu pendaftaran bupaten/kota kepada mantan Panwas Pilkada, akan lebih mendaftar. Karena mereka pu- ling membuka dan memper- Maha Esa. minimal 35 tahun, mempunyai Panwas kota yang diajukan ke dibuka mulai 10-14 Nopember anggota Panwaslu Pemilu 2009 banyak ditangani oleh pihak nya pengalaman,” kata anggota tontonkan aib sehingga keta- Ketua Dewan Presidium integritas, pendidikan S1 untuk Bawaslu untuk dipilih 3 orang. 2010 pada jam kerja,” demikian dalam proses seleksi Panwas sekretariat KPUD, bukan komi- KPUD Medan Divisi Hukum hanan anak bangsa semakin Pusat ICMI DR Ir H Muslimin Panwas kota dan SLTA untuk Setelah Panwas kota terbentuk Tamba. (h10) Pilkada. Sebab menurut UU sioner. Seperti pendaftaran ber- dan Humas itu. (h11)
    • 10 Medan Metropolitan WASPADA Senin 9 November 2009 Penertiban PKL Harus Didukung Sarana MEDAN (Waspada): Ang- akan menciptakan kota yang (PBJ), juga membuat kota men- gota DPRD Medan mengaku rapi dan bersih, tapi juga meng- jadi rapi dan bersih. Tidak itu telah menduga kalau kebijakan gairahkan sektor ekonomi. saja, dengan kehidupan pasar Walikota menertibkan peda- Katanya, Perda No 8 tahun tradisional yang baik sangat gang kaki lima (PKL) bakal men- 2009, tentang Rencana Pemba- mungkin untuk peningkatan dapat protes. Karena kebijakan ngunan Jangka Panjang (RPJP), PAD. itu belum didukung sarana yang telah jelas disebutkan bahwa Sementara itu, anggota Ko- memadai. salah satu misi kota Medan ada- misi C, Hasyim menyarankan Ketua dan anggota Komisi lah mewujudkan perekono- kepada Pemko untuk membina C DPRD Medan Aripay Tambu- mian yang tangguh dan dina- para PKL dengan memberikan nan dan Hasyim, mengatakan mis. Pasar tradisional salah satu pelatihan dan permodalan. itu kepada Waspada, Jumat (6/ instrumen penting untuk Tujuannya, selain untuk men- 11). Kepada mereka ditanyakan meningkatkan pertumbuhan ciptakan lebih banyak lagi tentang rencana Lembaga Ban- ekonomi. pengusaha kecil mikro, juga tuan Hukum (LBH) menuntut Geliat pasar tradisional, kata untuk mengurangi PKL. Pemko Medan dan Pemkab Tambunan, merupakan cermi- Kata Hasyim, bila para PKL Deliserdang. nan nadi kehidupan kota Me- diberikan pelatihan manfaat- Aripay Tambunan, menga- dan. Karenanya yang harus nya akan sangat banyak untuk ku sangat mendukung program dilakukan adalah penataan, peningkatan perekonomian Pemko menertibkan pedagang bukan penggusuran. Dengan kota Medan. Permasalahannya, kaki lima. Tapi sebelum itu dila- begitu, selain menyelesaikan pengetahuan dan permodalan kukan, Pemko seharusnya sudah masalah Pedagang Badan Jalan mereka sangat terbatas. (m17) menyediakan sarana bagi PKL. Katanya, sekarang ini bukan hanya jumlah pasar tradisional Pedagang Pusat Pasar kita yang kurang. Pasar yang ada juga tidak layak sebagai tempat Siapkan Gugatan berjualan. MEDAN (Waspada): Pedagang Pusat Pasar mengultimatum Idealnya, menurut Tambu- PD Pasar Medan akan mendaftarkan gugatan ke Pengadilan Negeri nan, satu pasar berbanding Medan , jika selama dua bulan tidak merenovasi pasar dan 10.000 penduduk. Kalau pendu- menanggapi keluhan mereka. duk Medan 2 juta jiwa, berarti Menurut Sekretaris I P3TM Pusat Pasar, Krisman Marpaung, harus ada 200 pasar tradisional. Sabtu (7/11), gabungan tim advokasi P3TM dan LSM PH&P telah Sedangkan yang dikelola PD menyiapkan draf gugatan itu. “PD Pasar diberi waktu dua bulan Pasar sekarang hanya 52 pasar. untuk melakukan pembenahan, jika tidak ada perubahan positif Waspada/Surya Efendi Dengan kondisi demikian, pihaknya bersama 2000 lebih pedagang Pusat Pasar akan mendaf- PERLUASAN GEDUNG DPRDSU: Pekerja menggunakan alat berat membangun pondasi di antara gedung DPRD Medan dan gedung DPRDSU Jl. Imam Bonjol kata Tambunan, pasti terjadi tarkan gugatan ke Pengadilan Negeri,” katanya. Medan, Selasa (3/11). Pengerjaan pondasi ini untuk perluasan gedung DPRDSU yang nantinya akan dibangun lebih megah dan bertingkat. penumpukan pedagang di tiap- Selama ini, lanjutnya, para pedagang telah sering kecewa tiap pasar. Karena di Kecamatan dengan kondisi gedung pusat pasar yang mengalami kerusakan, Medan Helvetia, misalnya namun para pedagang masih tetap sabar. “Kami berharap agar hanya ada Pasar Sei Sikambing. kesabaran para pedagang tidak disalahartikan, bukan karena diam Masyarakat Patut Dukung Di Kecamatan Medan Area hanya ada Pasar Sukaramai, dan seterusnya. ‘’Makanya, kesan yang dilihat dari program Pemko bukan penertiban, tapi saja lantas boleh diperlakukan seenaknya,” katanya. Dalam kesempatan itu para tokoh pedagang, LSM Perjuangan Hukum & Pembangunan (PH&P) dan Persatuan Pedagang Pasar Tradisional Medan (P3TM) Pusat Pasar meminta Walikota Medan Cq Badan Pengawas Perusahaan Daerah Kota Medan menanggapi Pengganyangan Markus penggusuran,’’ katanya. Komisi C, kata Tambunan, mendukung Pemko menertib- kan PKL dengan artian penata- an. Karena hal itu bukan saja keluhan para pedagang. Permintaan ini disampaikan para tokoh pedagang secara terlulis kepada Walikota Medan. “Namun hingga saat ini belum ada realisasi dari tuntutan peda- gang,” ujar Ketua PH & P Tonni Hutauruk, SH didampingi Sekretaris I Guntur Hutauruk, SE di Pusat Pasar. (m40) MEDAN (Waspada): Pernyataan Presiden SBY terkait pengganyangan terhadap makelar kasus cukup lama masyar akat mengenal yang namanya ‘mafia peradilan. hari yang sama berpendapat pengganyangan terhadap makelar kasus tersebut sangat institusi yang mengatasnama- kan penegakan hukum,’’ tegasnya. DPRDSU Dukung Pembangunan (markus) hukum, juga membuat kalangan advokat di Kota Medan memberikan tanggapan maupun komentarnya, Jumat (6/11). ‘’Justru wajar jika presiden mengemukakan program tersebut dan patut mendapat mendesak. Artinya, kata dia, perlu secepatnya direalisasikan. ‘’Hal itu perlu disegerakan Dia juga menyebutkan, bu- kan sedikit advokat yang gerah dan geram terhadap mafia hu- Bendungan Sibirubiru dukungan segenap elemen di jajaran penegak hukum sam- kum, akibatnya advokat stigma MEDAN (Waspada): Komisi “Untuk mewujudkan ren- Tirtanadi dalam memenuhi Seperti dikemukakan Has- Menurut Benny, mafia su- masyarakat Indonesia, terma- pai pada advokat atau tidak sebagai pilar kokoh mafia hu- D DPRD Sumut mendukung cana pembangunan bendung- kebutuhan air penduduk kota rul Benny Harahap, SH selaku dah tersohor sejak dulu karena suk para pencari keadilan,’’ cuma terhadap Catur Wangsa kum itu. ‘’Cuma saja, dalam proyek Bendungan Lau Sime- an dan areal genangannya, Medan tahun 2030. Menyedia- praktisi hukum sangat mendu- sangat berpengaruh dan dekat ujarnya. (polisi, jaksa, hakim) saja, tetapi pengganyangan mafia atau ma- me di Sungai Percut Kecamatan maka diperlukan pembebasan kan air baku untuk memenuhi kung program 100 hari SBY dengan para pejabat pengambil Harus segera juga sampingnya seperti Lem- kelar kasus itu ada hambatan Sibirubiru, Deliserdang. Proyek lahan seluas 200 hektare dan pe- air kebutuhan air irigasi pada untuk memberantas makelar kebijakan dan keputusan. Jus- Sementara itu, praktisi baga Perlidungan Saksi Korban, berupa sulitnya pembuktian, multi fungsi itu dalam upaya pe- mindahan penduduk sebanyak daerah irigasi Bandar Sidoras kasus hukum yang notabene tru, dewasa ini semakin men- hukum Junaidi Matondang, SH, Badan Penyelesaian Sengketa kecuali tertangkap tangan,’’ ngendalian banjir dan pemenu- 22 KK,” tambah anggota Komisi (luas 3.017) dan daerah irigasi adalah mafia hukum. cuat. Apalagi sudah terbilang secara terpisah namun pada Konsumen, KPPU dan semua katanya. (m34) han kebutuhan air minum D DPRD Sumut Analisman Lantasan baru (luas 185 ha), me- masyarakat di daerah ini. Zalukhu. nyediakan area pariwisata, juga “Kita dari Komisi D siap Saat meninjau proyek itu, dapat menghasilkan 2,80 MW KNPI Harus Terus Berbenah MEDAN (Waspada): Pengurus DPD Komite Nasional Pemuda Perlu Gerakan Organisir membantu demi percepatan terlaksananya pembangunan lanjutnya, selain dihadiri semua anggota Komisi D DPRD Sumut listrik. Karena itu, Ajib Shah men- proyek strategis itu,” kata Ketua juga dihadiri Kepala Bappedasu desak Pemprovsu agar proyek Indonesia (KNPI) Kota Medan untuk masa bakti 2009-2011 dilantik oleh Ketua KNPI Sumut Yasir Ridho Lubis di Aula Wisma Benteng Medan, Jumat (6/11) malam. Politik Perempuan Komisi D Ajib Shah kepada wartawan di gedung dewan, Riadil Akhir Lubis dan Kepala Balai Besar Sungai Wilayah Su- itu bisa segera dilaksanakan pa- ling lambat tahun 2010, karena Jumat (4/11). mut. Sedangkan Kepala Dinas dana loan untuk membiayai Acara pelantikan dihadiri Pj. Walikota Medan Rahudman MEDAN (Waspada): Perlu Menurut Darmayanti, upa- ningkatkan posisi politik pe- Menurut Ajib, saat ini proses Pengelolaan Sumber Daya Air proyek itu sudah standby. Harahap, Ketua MABMI Syafwan Khayat, tokoh pemuda Ajib Shah, dikembangkan iklim sosial ya peningkatan posisi politik rempuan. Kemudian, ujar ang- pembangunan proyek Departe- (PSDA) Sumut Ruslan Efendy Ajib Shah juga mengung- ketua DPRD Medan Denny Ilham Panggabean dan para undangan budaya yang lebih kondusif perempuan harus mengambil gota DPD RI asal Sumut itu, per- men Pekerjaan Umum senilai tidak berkenan ikut meninjau kapkan kekecewaan Komisi D lainnya. untuk meningkatkan peran dan beberapa strategi yang bersifat lu ada perubahan sistem politik Rp1,9 triliun itu proses mema- tanpa alasan yang jelas. DPRD Sumut yang tidak di- Dalam kesempatan itu, Rahudman mengajak meningkatkan kedudukan perempuan yang jangka panjang dan berkelanju- yang adil untuk perempuan. suki tahap sertifikasi desain Disebutkan, bila telah ber- dampingi pihak Dinas PSDA persatuan dan kesatuan pemuda. Tantangan yang akan dihadapi strategis, sebagai pengambil tan, antara lain, meningkatkan Dalam idiologi politik patriarkhi bangunan dan proses ganti rugi fungsi secara penuh, bendung- Sumut, ketika meninjau lokasi pemuda hari ini dan mendatang dirasakan semakin berat seperti keputusan maupun perumus pemahaman politik perempu- banyak pria dan tidak sedikit lahan. an Simeme ini dapat menaik- proyek yang masih tertunda persoalan terkikisnya rasa nasionalisme, untuk itu diharapkan kebijakan, di lembaga eksekutif, an dengan mengubah paradig- politisi perempuan yang meng- Terkait itu Komisi D DPRD kan sistem pengendalian banjir tersebut. dengan berbagai kegiatan KNPI bisa menyatukan pemuda dan yudikatif maupun legislatif. ma yang selama ini terbangun. ambil keuntungan di tengah- Sumut mendesak Pemprovsu Kota Medan, dari yang saat ini “Dengan ketidakhadiran bersinergi untuk menciptakan Kota Medan yang kondusif. Ketua Kaukus Perempuan Pemahaman dan politik perem- tengah ketertindasan dan ke- dan Pemkab Deliserdang segera masih pada debit skala priode Kepala PSDA Sumut, timbul Ketua KNPI Sumut Yasir Ridho Lubis mengatakan, pengurus Sumatera Utara (KPSU) Darma- puan yang selama ini dibangun miskinan perempuan maupun merespon proyek itu dengan ulang 25 tahunan menjadi skala kesan pejabat lembaga itu tidak yang baru dilantik agar dapat mengemban tugas dengan baik, yanti Lubis mengatakan hal itu dengan idiologi patriarkhi harus jutaan kaum miskin lainnya. menyiapkan dana pendamping priode ulang 40 tahunan. mendukung program pemba- terbuka dan transparan. dalam Workshop Capacity dikikis. Berdasarkan itulah, lanjut guna membebaskan lahan. Ka- Bendungan ini juga bisa ngunan Sumut. Atau memang Sementara itu, Ketua DPD KNPI Medan terpilih, Zulham Effendi Building di Hotel Madani, Selasa Selain itu, lanjutnya, perlu Darmayanti, KPPSU membuat rena masalah gantirugi pembe- menyediakan air baku sebesar sudah bosan jadi pejabat di lem- Siregar, mengatakan, KNPI harus terus berbenah diri untuk terus (3/11), bagi anggota parlemen adanya gerakan untuk mengor- workshop dengan materi yakni, basan lahan menjadi tanggung- 3000 liter/detik , yang nantinya baga itu. Biar kita sampaikan memperjuangkan hak masyarakat. Dia juga meminta kepada perempuan di Sumut, didam- ganisir politik perempuan. Tan- analisis gender, kepemimpinan jawab Pemprovsu dan Pemkab. dapat digunakan oleh PDAM ke Gubsu,” ujarnya.(h11) seluruh pemuda untuk menyukseskan pesta demokrasi. “KNPI pingi koordinator pelaksana pa adanya gerakan yang teror- perempuan, peran dan fungsi berpihak pada Pilkada yang berkualitas.” Pada acara tersebut Nelly Armayanti dan Varia ganisir tidak mungkin perlawa- anggota DPRD Sumut dan KNPI Medan juga meluncurkan website KNPI Medan. (cmai) Winansih. nan akan terbangun demi me- Women Budgeting. (m14) Pokja Pertanahan Bakal Dibentuk MEDAN (Waspada): Komisi saikan secara tuntas. Jumlah yang sudah dilakukan eksekusi A DPRD Sumut bersama Pem- terbesar persoalan tanah itu secara administrasi. Menurut- Berharap Lulus CPNS Dari Pinggir Jalan provsu dan Badan Pertanahan Nasional (BPN) Sumut akan membentuk ke-lompok kerja terjadi antara rakyat dengan pi- hak PTPN dan sejumlah peru- sahaan swasta lainnya. nya, pemerintah dalam hal ini perlu melakukan kajian atas klaim masyarakat yang menga- (Pokja) untuk menuntaskan “Kasus tanah itu banyak ku telah memiliki sertifikat atas “LUMAYANLAH dapat kreatif membuat tulisan di dia meraih kuntungan tidak memperoleh sumber kopian- 80 persen kelulusan dengan segala persoalan per-tanahan yang dimediasi DPRD Sumut. tanah dimaksud. beras 1 kilo dan emas 5 kilo kotak “Di Sini Dijual Pengumu- lebih dari Rp600 ribu dengan nya,” ujar Rustam, penjual membeli sejumlah bundelan di Sumut. Hanya saja kasusnya selalu men- “Secara hirarki 8000 ser- dari sini,” kata seorang pen- man Dan Soal CPNS”. modal memperbanyak kopian kopian informasi CPNS di Jalan foto kopi soal lama yang “Sampai hari ini, persoalan tok diakibatkan ketidakber- tifikat atas tanah tersebut seba- jual berbagai lembaran foto Ibu rumah tangga, Eva, juga dan soal-soal ujian Rp800 ribu. Gedung Arca yang tahun lalu dijual di kawasan Stadion pertanahan yang masuk ke pihakan pejabat pemerintahan gaimanana yang diklaim mas- kopi formasi CPNS 2009 dan turut meramaikan komunitas Pengalamannya tahun lalu ini mengantongi keuntungan Teladan. DPRD Sumut penyelesaian-nya seperti BPN, pemkab/pemko yarakat, sebenarnya sudah me- soal-soal ujian yang lalu. penjual fotokopian ini. Pekerja- hampir sama dengan penjual Rp400 ribu tetapi berjualan “Jangan menganggap masih mengambang. Itu sebab- kepada rakyat,” katanya. rupakan hak dari masyarakat Penjual itu, Andi, 45, an itu sudah digelutinya 7 tahun yang lain. Mereka paling besar tidak sampai satu bulan. remeh dengan foto kopi soal nya Komisi A bersama Pem- Kendati Gubsu Rizal Nur- menguasai tanah tersebut, apa- kemarin, rupanya berseloro lamanya. Meski berjualan dari meraih keuntungan tidak lebih Diakuinya, musim pene- yang dijual seperti menja- provsu dan BPN Sumut dalam din dahulu sempat membentuk lagi menurut data yang dipe- kepada calon pembeli ketika siang sampai malam, dia mera- dari Rp700 ribu selama hampir rimaan CPNS ini pasti mengan- jakan kacang rebus ini. waktu dekat akan segera mem- Tim B Plus pada 1998 guna roleh, tanah tersebut merupa- disinggung ke ranah omset sa puas.Selain bisa lepas makan, satu bulan setengah berjualan tongi keuntungan. Bagi penjual, Banyak juga yang sukses bentuk Pokja khusus me- menginvestigasi kasus-kasus kan tanah adat ulayat yang telah yang bisa dikantongi pen- juga senang sudah banyak kopian. Mereka mendapatkan kata Rusam yang juga buruh setelah membeli foto kopi, nangani persoalan pertanahan tanah di Sumut, namun menu- dikuasai masyarakat sejak jual pada musim penerima- pembelinya diterima menjadi sumber kopian itu dari Kantor kasar ini, tidak mengharapkan seperti teman saya,” katanya. di daerah ini,” kata anggota rut Syamsul sifatnya hanya pen- jaman belanda “, katanya. an Pegawai Abdi Negara PNS di masing-masing Pemda. Gubernur dan Dinas Tenaga untung yang besar asalkan bisa Begitu pun, ujar tama- Komisi A DPRDSU Syamsul dataan saja tanpa ada penyele- Syamsul meminta peme- yang secara serentak dibuka “Tidak rugi membelinya Kerja. Lembaga itu menyedia- berkelanjutan dan modal balik. tan Unimed ini, mengupas Hilal didampingi Sonny Firdaus saiannya hingga kini, karena rintah untuk lebih arif melihat di berbagai daerah di Suma- foto kopian ini. Terbukti, mereka kan seluruh sumber kopian Rudi, 34, pelamar dua kali CPNS soal ujian yang lama tanpa di gedung dewan, Jumat (6/11). terbelit peraturan yang mem- permasalahan ini. Kalau me- tera Utara ini. Bagaimana yang membeli buletin soal yang informasi penerimaan CPNS di Pemko Medan yang belum membuka-buka buku yang Syamsul Hilal mengatakan, buat Gubsu tidak memiliki mangituhaknyamasyarakatber- saat ini ada ratusan persoalan terobosan politik. dasarkan sertifikat yang mereka tidak, keusilan pembeli itu lama dari saya, banyak yang dari 15 kabupaten/kota yang beruntung tahun ini berharap cocok dengan materi ujian tanah yang masuk ke Komisi A Dalam kesempatan itu, miliki. Berikan saja kepada me- melihat penjual sudah tan- berhasil,” ujar warga Jalan Turi serentak membuka penerimaan besar lulus seleks dengan mem- nanti, tidak pas juga. Kedua- DPRD Sumut perio-de 2004- Syamsul juga menyinggung reka, sehingga rasa keadilan itu cap gas berjualan setengah itu. saat ini. Harus diingat menda- bolak-balik foto kopi soal yang duanya harus saling me- 2009 dan belum dapat disele- tentang kasus tanah Register 40 benar-benar terwujud. (h11) bulan lalu sampai sehari se- Menurut Eva, menjadi patkannya tidak gratis. lama ini.Dia salah satu pelamar nopang. belum 25 November, dimana rahasia umum, banyak soal- “Kami membayar untuk CPNS yang menggantungkan *M.Thariq dimulai ujian seleksi CPNS Pemko Medan. Padahal, soal yang lama diujikan kem- bali tahun berikutnya seperti LPMP Prioritaskan Program pengumuman penerimaan yang ada dalam kumpulan foto CPNS belum keluar seluruh- nya dari setiap daerah pada kopi ini. Untuk memperolehnya tidak mahal, hanya Rp30.000. Kurangi Diskriminasi Pendidikan tanggal mulai menjajakan “Bisa ditawar.” fotokopian tersebut. Penjual- Dia mencontohkan, adik MEDAN (Waspada): Lem- (5/11). terhadap guru maka diharap- penjual itu berjejer dengan kandungnya lulus seleksi CPNS baga Penjamin Mutu Pendidi- Program lain yang juga me- kan adanya sharing dana de- meja seadanya di pinggir formasi guru di Sibolga tahun kan (LPMP) Sumut sebagai UPT rupakan prioritas, kata Mahdi, ngan pemerintah kabupaten/ jalan arah menuju Stadion lalu. Liana, nama adiknya, se- dibawah Ditjen Peningkatan adalah Program Revitalisasi kota,” ujar Mahdi Ibrahim. Mutu Pendidik dan Tenaga Ke- Diklat melalui aktivitas kelom- Lebih lanjut dikatakannya, Teladan. Keberadaan mere- belum ujian hanya membolak- pendidikan (PMPTK) Depdik- pok guru yang tergabung dalam dalam tahun ini, LPMP Sumut ka bisa dilihat ramai. Misal- balik kumpulan foto kopi soal nas, akan melakukan berbagai Kelompok Kerja Guru (KKG) sudah menfasilitasi sekitar 700 nya, di pertigaan Jalan HM yang dijualnya kepada para program untuk mengurangi dan Musyawarah Guru Mata orang guru di daerah terpencil Joni-Jalan Gedung Arca pelamar. Setiap hari menjelang disparitas mutu pendidik dan Pelajaran (MGMP) dengan pola melalui Diklat Information sampai Jalan Stadion. seleksi CPNS, kata Eva, ada saja tenaga kependidikan antar dae- pengembangan guru berke- Communication Tegnology Kopian dan model soal-soal pengunjung yang membeli. rah, serta mengatasi ketim- lanjutan. (ICT). Hal ini dimaksudkan se- CPNS dibentangkan di atas Asalkan tidak hujan. Semuanya pangan akses pendidikan antar Beberapa program yang lain untuk mengurangi dispa- meja diteduhi payung. lancar. Semakin ramai pelamar daerah. merupakan upaya untuk ritas mutu pendidik dan tenaga “Dari sepeda motor dan yang datang semakin besar “Kita sangat responsif terha- mengurangi diskriminasi ini kependidikan antar daerah, pejalan kaki, pembeli tinggal harapan kopian laris manis. dap program yang telah dibica- akan dilaksanakan oleh LPMP juga untuk mengatasi ketim- pilih, baca dan jika berminat Banyak pelamar yang datang rakan oleh Mendiknas yang Sumut melalui pelibatan guru pangan akses pendidikan langsung bayar hanya hanya membolak-balik fotoko- mengharapkan agar tidak terja- dari negeri dan swasta, sekolah antara daerah. Rp4.000 per eksemplar pe- pian soal ujian yang lama. Bagi- di lagi diskriminasi pendidikan umum dan sekolah agama, dae- Saat ini LPMP Sumut me- ngumuman CPNS,” kata nya tidak masalah fotokopian- antara sekolah negeri dan swas- rah maju dan daerah terpencil miliki delapan orang tenaga ahli Andi, 45, penjual kopian di nya hanya dibaca calon pem- ta, sekolah umum dan sekolah dalam berbagai kegiatan pela- bidang ICT tamatan S2 ITB Jalan HM Joni. beli. Dengan dibaca terlebih agama, daerah maju dan daerah tihan yang dipusatkan pada Bandung dan 24 Widyaiswara Posisi mereka tampak dulu akan bisa menarik minat Waspada/ME Ginting terpencil. Isu ini menjadi prio- KKG dan MGMP yang tersebar berkualifikasi S2 dari berbagai berjejer dari kejauhan. Apa- calon pembeli untuk memiliki Pelamar CPNS membaca kumpulan foto kopi soal yang dijajakan di kawasan Stadion Teladan ritas kami pada tahun 2010,” di kabupatan/kota se-Sumatera mata pelajaran yang setiap saat Medan, Jumat (6/11). ujar Kepala LPMP Sumut, Drs. Utara. siap untuk menfasilitasi guru lagi komunitas penjual lebih soal-soal tersebut. Tahun lalu H. Mahdi Ibrahim, MM, Kamis “Untuk memperluas akses di daerah. (m41)
    • WASPADA Senin 9 November 2009 Medan Metropolitan 11 Judi Dan Mesum Di Pantai Bokek Digerebek MEDAN (Waspada): Polsekta Medan Sunggal menggerebek Polisi Amankan lokasi judi domino dan mesum di lokasi Pantai Bokek Jalan Flam- boyan Raya, Kel. Tanjung Selamat Medan-Deliserdang, Sabtu (8/11) sore. Dalam penggerebekan itu, polisi menangkap 4 tersangka pemain judi, 14 wanita diduga pekerja seks komersial (PSK), lima 60 Sepeda Motor pria dan tiga pasang orang Berpacaran. Berikut menyita barang bukti, tujuh set kartu domino, uang Rp308.500 dan lainnya. MEDAN (Waspada): Polsekta Medan Baru Polsekta, dibantu petugas Sat- Pantauan Waspada, penggerebekan itu dipimpin Kapolsekta lantas dan Samapta Poltabes Medan Sunggal AKP Faisal F Napitupulu bersama Kanit Reskrim bekerjasama dengan Satlantas Poltabes menindak Medan. Iptu Anthoni Simamora SH dengan menurunkan 35 personel 101 sepeda motor dalam razia di Jalan Letjen Menurutnya, petugas me- Reskrim, Intelkam, Patroli dan Tim Pemburu Preman (TPP). Jamin Gintings, Minggu (8/11) dini hari. nindak 101 sepeda motor ka- Puluhan personel yang turun di TKP langsung memblokir lokasi rena tidak bisa memperlihatkan dan langsung melakukan penyergapan. Tiga pria pemain judi Pemilik kendaraan itu tidak menggeledah angkot. surat-surat dan perlengkapan terjun ke sungai. Satu diantaranya berhasil diamankan petugas. bisa memperlihatkan surat- Kendaraan yang terjaring kendaraan. 101 sepeda motor Kapolsekta Medan Sunggal AKP Faisal F Napitupulu surat kendaraan yang lengkap. razia langsung dilakukan peni- yang ditindak yakni, 20 unit mengatakan, penggerebekan itu dilakukan atas informasi sepeda motor tidak ditahan masyarakat melibatkan petugas dari Polsekta Delitua. Para PSK Bahkan ada yang mengguna- langan oleh petugas. Kendaraan yang ditangkap dibawa ke Mapolsekta Delitua. Sedangkan empat kan plat polisi palsu. 60 Kenda- yang diamankan diberikan su- tetapi terkena penilangan (8 tersangka pemain judi ditahan di Mapolsekta Medan Sunggal. raan yang ditilang, diamankan rat tanda penahanan di Mapol- lembar SIM-C dan 12 lembar Sepasang pria dan wanita bukan suami istri, Y, 27, penduduk Polsekta tersebut. sekta Medan Baru untuk dalam STNK). Jalan Kamboja VIII dan Irm, 25, penduduk Jalan Nusa Indah Raya Pantauan Waspada, kema- penyelidikan. Sedangkan kendaraan Perumnas Helvetia mengatakan, pihaknya ditangkap polisi ketika rin, razia itu dipimpin Kapol- Kapolsekta Medan Baru lainnya, 60 sepeda motor, di- sedang duduk-duduk santai di Pantai Bokek. sekta Medan Baru AKP M Ade- AKP M Adenan AS, SH, SIK ke- amankan di Mapolsekta Medan “Kami tidak ada melakukan macam-macam. Jadi tidak takut nan AS dibantu Waka Polsekta pada Waspada di lokasi me- Baru karena pengendara tidak dibawa ke kantor polisi,” kata Irm. (m31) Iptu Gunawan, Kanit Patroli ngatakan, pihaknya menurun- bisa memperlihatkan SIM, Iptu B Lumbanraja, Kanit Res- kan 40 personel terdiri dari STNK dan tidak memakai plat Maling Di Gg Langgar krim Iptu M Faruk Rozi. Dalam razia itu, petugas juga sempat Reskrim, Intelkam, Patroli dan Tim Pemburu Preman (TPP) polisi bahkan ada yang mema- kai plat palsu. (m31) Tertangkap MEDAN (Waspada): Reskrim Unit Jahtanras Poltabes Medan menangkap seorang pelaku pembongkar rumah yang mengambil dompet berisikan uang, handphone korbannya dalam Oknum Wartawan penyergapan di kediamannyanya, Sabtu (7/11) malam. Tersangka Kesot, 22, warga Jalan Pancasila Gang Usaha, Kecamatan Medan Denai itu, yang telah diburon selama 4 bulan Curi Uang Calhaj ini kemudian diboyong ke Poltabes dan dijebloskan dalam sel tahanan. MEDAN (Waspada): Ind, 44, Selanjutnya, Norma pergi ke tersebut saat korban masuk ke Menurut Kanit Jahtanras Poltabes AKP Faidir Chan kepada warga Jalan Amal Gg Saudara, satu ruangan dan meminta salah satu ruangan dan tas wartawan Minggu (8/11), peristiwa pencurian itu dilakukan Pulobrayan Darat Kec Medan tersangka menjaga tas gantung gantung korban dititipkan tersangka pada 27 Agustus 2009 di rumah korban Masrial di Jalan Timur, mencuri uang milik miliknya. kepadanya. Tersangka pun Denai Gang Langgar/Sepakat. Modusnya, kata Faidir, tersangka masuk ke rumah korban jemaah calon haji, Sabtu (8/11) “Namun, saat korban kem- buru-buru membuka tas kor- malam hari dengan cara memanjat tembok dan merusak pintu sore. Perbuatan itu dilakukan- bali dari ruangan/aula I Madi- ban dan mengambil 1.500 uang depan. Setelah diburon empat bulan, tersangka ditangkap di nya tersangka di tengah kesi- natul Hujjaz, tersangka tak terli- rial. Usai mencuri, In pergi ke kediamanya. (m39) bukannya meliput keberang- hat lagi sedangkan tas korban tempat penukaran uang di Jalan katan calhaj dari Asrama Haji masih ada. Merasa curiga, kor- Raden Saleh untuk menukar- Jalan Pangkalan Masyhur me- ban memeriksa isi tasnya, ter- kan uang tersebut. Setelah ditu- WN Malaysia Pemilik nuju Bandara Polonia Medan. nyata uang 1.500 rial telah hi- kar menjadi Rp4.600.00, ter- Oknum wartawan harian terbi- lang.Karenabusyangakanmem- sangka kembali ke Asrama Haji Paspor Afkir Diamankan tan Medan ini akhirnya mering- bawanya datang dan segera meliput kegiatan pemberang- MEDAN (Waspada): Seorang WN Malaysia pemilik paspor kuk dalam sel Polsekta Delitua. berangkat, nek Norma pun naik katan calon jemaah haji hingga Waspada/Ismanto Ismail yang sudah afkir, diamankan polisi di Jalan Karya I Helvetia, Jumat Dari tersangka In polisi menyita ke bus,” sebut AKP Yoris. akhirnya diketahui oleh korban. DIAMANKAN: Petugas Reskrim Polsekta Medan Baru menulis surat tanda bukti kendaraan (6/11). uang tunai Rp 3.650.000 sebagai Begitu bus berangkat, di “Saya silap pak, saya butuh untuk diserahkan kepada pengendara yang sepeda motornya diamankan di Mapolsekta Medan Selain mengamankan A bin MS, 49, penduduk Jalan Dawai barang bukti. tengah perjalanan menuju Ban- uang karena buat keluarga,” Baru, Minggu (8/11) dinihari. Blok 1554 Malaysia, polisi juga mengambil keterangan Smn, 29, Kapolsekta Delitua AKP M dara Polonia, nek Norma meli- tutur In kepada polisi. Meskipun penduduk Jalan Karya I Helvetia, istri kedua WN Malaysia itu. Yoris Marzuki menyebutkan, hat tersangka In yang berada menyesal dengan perbuatan- Dari pasangan suami istri itu, disita barang bukti paspor A bin MS yang sudah afkir (berlaku sampai 11 Juni 2008), sepasang surat nikah yang dikeluarkan dari Padang Tualang, Kab. Langkat, KTP sekira pk 12:30, korban Norma binti Pulih ,70, warga Desa Pan- tai Cermin bergegas hendak dalam satu bus dengannya se- kaligus meneriakinya maling. Petugas keamanan yang me- nya itu, tersangka harus mende- kam dalam sel polisi. Kapolsekta Delitua AKP M Ormas Dukung Polri Malaysia. Kapolsekta Medan Helvetia, AKP JC Simanjuntak SIK melalui Kanit Reskrim Iptu Zulkifli Harahap, SH kepada Waspada berangkat ke dalam bus yang akan membawa calon jemaah nyaksikan teriakan Norma spontan mengamankan ter- Yoris Marzuki menjelaskan, aki- bat perbuatannya itu, tersangka Berantas Korupsi mengatakan, sebelumnya pihaknya menerima informasi dari haji kloter XIII ke Bandara Po- sangka sekaligus menyerah- dijerat Pasal 363 KUHP dengan masyarakat bahwa ada warga negara asing (Malasyia) tinggal di lonia. Karena barang yang akan kannya kepada petugas Polsek- ancaman 7 tahun penjara. MEDAN (Waspada): Sejum- Jaringan Sehat Indonesia (JSI) Berkaitan dengan hal terse- Medan dan menikahi seorang wanita, warga Jalan Karya I Helvetia. dibawa korban terlalu banyak, ta Delitua. “Tersangka mengakui per- lah pimpinan organisasi kema- Sumut Mardhan Hidayat but, mereka meminta Kapolri Dalam kasus ini, A bin MS dikenakan UU No.9 tahun 1992 korban meminta bantuan ter- Kepada polisi, In mengaku buatannya dan masih diperik- syarakat (ormas) mengeluarkan Siregar dan Wakil Sekretaris untuk tidak pandang bulu me- pasal 50 tentang keimigrasian dengan ancaman hukuman 5 tahun sangka untuk membawanya. telah mencuri uang milik calhaj sa,” jelas Yoris. (cat) pernyataan mendukung Polri. DPW BM-PAN Sumut Suartono. meriksa seluruh pihak yang penjara. Selesai menjalani pemeriksaan, A bin MS kepada Waspada Mereka mengajak masyarakat Hadir juga di sana, Sekre- terlibat melakukan korupsi. mendukung Polri dan institusi taris BM-PAN Sumut Isa Ansari, Para pimpinan ormas itu yakin, mengatakan, menikahi Smn resmi. Hal itu dibuktikannya dengan memperlihatkan surat tanda bukti menikah. “Istri pertama saya ada di Malasyia dan sudah dikaruniai empat Pelamar CPNS Dijambret penegak hukum lainnya mem- berantas korupsi. A l u m n i I M M Su m u t Ed i Saputra, dan Wakil Sekretaris Kapolri dan jajaran institusi pe- negak hukum lainnya mampu orang anak. Istri pertama dan kedua saling kenal, bahkan saya Waspada menerima siaran PW Pemuda Muhammadiyah bersikap tegas dalam menindak menikah mendapat restu dari istri pertama,” ungkap A bin MS MEDAN (Waspada): Baru peristiwa tersebut ke Poltabes Karena terkejut, wanita itu tak pers yang dibuat sejumlah Sumut Adrizal. koruptor. dan menurutnya tak satu suratpun dipalsukannya, tetapi kesalahan tiga hari berada di Kota Medan, Medan. sempat membuntuti kedua pria pimpinan ormas tersebut usai Hasil pertemuan itu mereka Kepada masyarakat, mere- hanya izin tinggal di Medan sudah habis. (m31) seorang wanita asal Jawa Te- Kepada polisi, Cici menga- tersebut. Setelah sadar dia lalu pertemuan mereka di Madani mendukung penyelidikan dan ka mengimbau untuk membe- ngah menjadi korban jambret. takan sekira pk 14:00 WIB diri- berteriak minta tolong, namun Hotel, Minggu (8/11). Sejumlah penyidikan yang dilakukan rikan kesempatan yang seluas- Padahal, Sri Baroqah alias Cici nya hendak membeli nasi ke kedua pria itu telah menghilang. pengurus ormas hadir, antara mabes polri, dan perlu diterus- luasnya kepada Polri menun- ,21, warga Jawa Tengah yang in- warung di kawasan Jalan Pem- Padahal, kata Cici, Senin (9/ lain Ketua DPD Ikatan Mahasis- kan sampai kepada kelengka- taskan kelengkapan berkas du- dekos di Jalan Ampera XI Medan bangunan III yang tak jauh dari 11) dia akan mendaftar sebagai wa Muhammadiyah (MM) pan berkas dan alat bukti. De- gaan korupsi tanpa tendensius itu bermaksud akan mendaf- kampus UMSU mengendarai peserta seleksi CPNS. Namun Sumut Zulfi Amri dan Ketua ngan begitu proses hukum ter- pribadi, diskriminasi dan inter- tarkan diri menjadi Calon Pega- sepeda motor Mio dengan niatnya itu nampaknya akan PKC Pergerakan Mahasiswa kait dengan dugaan kasus ko- vensi hukum dari manapun. wai negeri Sipil (CPNS) di Me- nomor polisi AD 6792 LN yang terkendala, sebab uangnya Islam Indonesia (PMII) Sumut rupsi tersebut dapat dituntas- Pimpinan ormas yang ber- dan.Wanita muda itu mengaku dibawanya dari Jawa Tengah. telah ludes dibawa kabur Ahmad Jabidi Ritonga kan dalam sidang pengadilan. kumpul hari itu juga mendu- trauma berada di kota ini. Saat melihat-lihat warung jambret tersebut. “Tengok Ada juga Ketua dan Sekre- Disebutkan Ketua MM Su- kung Kejaksaan dan KPK dalam Minggu (8/11) siang, wa- yang akan disinggahinya, dari besoklah, kalau dapat kiriman taris PW Himpunan Mahasiswa mut Zulfi Amri, dalam mem- penuntasan kasus hukum, nita jebolan Fakultas Akuntansi arah belakang muncul dua pria aku mendaftar,” katanya pelan Alwashliyah Sumut Alim Nur berantas korupsi, gerakan dan terutama penyelesaian berkas Universitas Gajah Mada (UGM) naik sepeda motor Yamaha saat ditemui wartawan usai Nasution dan Yasir Al Harisyah semangat Polri patut dipuji. kasus korupsi. Sehingga ketiga itu dijambret di Jalan Muktar Jupiter Z mendekati sepeda membuat laporan pengaduan. Sagala, Ketua Umum PW Ikatan Apresiasi yang sama juga disam- institusi ini dapat sinergi dalam Basri simpang Jalan Pembangu- motor yang ditungganginya. Kanit Jahtanras Poltabes Remaja Muhammadiyah paikan kepada kejaksaan dan menindak para koruptor. Ma- nan III. Meski tak mengalami Karena tak curiga, dia hanya AKP Faidir Chan yang dikon- Sumut Faizal Azmi, Sekretaris Komisi Pemberantasan Korupsi syarakat sangat berbarap, pe- luka. Namun uang Rp350 ribu, cuek saja dengan kehadiran dua firmasi mengatakan, pihaknya DPD IMM Sumut Amirullah (KPK) yang masih terus mem- negakan hukum berjalan SIM C, STNK, ATM BRI dan pria yang tak dikenalnya itu. Se- telah menerima laporan terse- Hidayat, Direktur Lembaga buru para koruptor. dengan baik dan adil. (m17) buku tabungan yang disimpan mentara tasnya masih terus di- but dan sudah mengetahui ke- Waspada/Ismanto Ismail dalam tas sakunya raib dibawa tentengnya di tangan sebelah kiri. jadiannya sekaligus melakukan INTEROGASI: Kanit Reskrim Polsekta Medan Helvetia Iptu Zulkifli Harahap SH sedang menginsterogasi WN Malaysia kabur dua orang kawanan jambret. Saat lengah, tiba-tiba se- orang dari pria tersebut meram- pengecekan ke TKP dan me- ngembangkan pengaduan ter- Keluarga Korban Minta Reka Ulang didampingi istri kedua seputar parport afkir dan tidak memiliki Sadar dirinya jadi korban pas tasnya dan langsung kabur sebut. “Polisi masih memburu izin tinggal di Indonesia, Jumat (6/11). penjembretan, Cici melaporkan menuju Jalan Mukhtar Basri. pelakunya,” jelas Faidir. (cat) Khawatir Rekayasa 340 Jadi 351 KUHP MEDAN (Waspada): Ke- saya yang sudah kritis pun mau dijerat pasal 351 ayat 3 jo 338. luarga korban kasus pembunu- mereka matikan, namun saya Di KUHP itu jauh kali beda anca- Setahun Pasca Kebakaran Mangkubumi han Elyas Nadeak dan penga- niayaan Paiman Hutabarat, meminta Poltabes Medan terus berusaha menghalangi sambil mengiba-iba kepada mereka. Sadis, mereka sungguh man hukumannya,” ujarnya. Didampingi kerabatnya Esra Br Nainggolan, Fransisca 20 NOVEMBER nanti, Munimah menuturkan, tunya sudah lama meninggal. ada enam, jadi untuk meme- Mereka menyampaikan menggelar rekonstruksi ulang sadis,” kenang Fransisca sambil pun menceritakan kronologis genap sudah satu tahun sebelum terjadi kebakaran tem- Kini anaknya, Seppay hanya nuhi kebutuhan keenam keluh kesah untuk disam- kasus tersebut. meneteskan air mati. singkat peristiwa yang terjadi pasca kebakaran rumah pat yang dihuninya sekarang sebatang kara yang harus ber- anaknya ini saja mungkin paikan kepada Pemko “Dari rekonstruksi yang Kejanggalan lain, tambah- pada 24 Juli 2009 tersebut. penduduk di Jalan Mangku- ini hanyalah dapur. “Ini dulu juang keras untuk memenuhi pendapatannya sebulan masih Medan. sudah dilakukan Jumat (6/11) nya, soal lokasi kejadian. Pem- Tersangka Nampunak, bumi, Kelurahan Aur, Keca- dapur karena tidak ada biaya kebutuhan anak-anaknya yang kurang,” jelasnya dengan wajah Sudah setahun kebaka- lalu, kami mendapati banyak bunuhan sebenarnya terjadi di menurutnya, sekira jam 6 sore matan Medan Maimun. untuk tukang kami hanya masih usia belia. sedih. Saat Waspada menyam- ran berlalu, tapi kisah sedih kejanggalan. Keluarga kami halaman Ruko (rumah toko) mendatangi Paiman dan Elyas Kebakaran yang terjadi pa- bangun ini saja, di sinilah kami “Cucu saya (anak Sepay-red) bangi pemukiman warga, masih saja mewarnai kehi- khawatir kasus ini direkayasa Jalan T Amir Hamzah yang dija- untuk meminta uang ‘setoran da sore hari itu mengha- berhimpit-himpitan tidur. paling besar kelas 2 SMP Paling . masih banyak rumah-rumah dupan warga ini. dari pasal 340 KUHP (pembu- ga Elyas dan Paiman. Namun preman’ sebesar Rp700 ribu. nguskan ratusan rumah Sekarang saja untuk buang air kecil belum sekolah, anaknya warga yang belum terbangun. *Mursal AI nuhan berencana) menjadi 351 dalam rekonstruksi, lokasinya Kedua korban menolak, sehing- penduduk multi etnis di kecil kami harus keluar dari KUHP (penganiayaan menye- justru dibuat di lantai dua ba- ga terjadi pertengkaran. sana. Meski sudah hampir rumah atau ke sungai,” katanya babkan kematian),” kata Fran- ngunan itu. Nampunak lantas pergi satu tahun, tetapi dampak- kepada Waspada, Jumat (6/11), sisca Br Sinaga di Medan, Peristiwanya di dalam menemui Edison dan Syamsul nya masih saja dirasakan sembari menunjukkan kamar Minggu (8/11). rekonstruksi, ujar ibu rumah- di kedai tuak dekat lokasi keja- oleh sebagian warga. Sebab mandi yang tanpa pintu tempat Istri korban Paiman yang tangga berusia 35 tahun itu, juga dian. Beberapa jam kemudian, sampai sekarang banyak mereka mandi. juga menjadi saksi kunci dalam dibuat seperti perkelahian biasa ketiganya pun menyerang dan warga yang belum bisa Menurutnya, bantuan be- kasus pembunuhan warga Jalan saja. “Ini yang paling kami menyandera kedua korban di membangun rumahnya rupa bahan-bahan bangunan T Amir Hamzah, Lr Dairi Medan khawatirkan. Kami takut ada halaman ruko yang mereka jaga. kembali dengan alasan bukannya tidak ada, tapi biaya itu, mensinyalir ada beberapa rekayasa kasus ini dialihkan dari “Sekira jam 12 malam lewat, ketiadaan biaya. tukangnya yang belum ada. Seperti Nek Munimah, Makanya bahan-bahan ba- kejanggalan dalam rekonstruksi pembunuhan berencana men- sayadiberitahukawansuamisaya 60, warga Mangkubumi Gg ngunan itu masih tersusun rapi yang telah digelar pihak penyidik. jadi penganiayaan yang me- bahwa kedua korban disandera Kelinci Medan. Kondisi di depan rumahnya. Hanya saja Dalam rekonstruksi, menu- nyebabkan kematian.” dan disiksa tersangka. Saya rumahnya sungguh mem- papan-papan itu sepertinya rut Fransisca, tersangka Nam- Beli KUHP langsung lari ke lokasi kejadian prihatinkan. Dengan ru- sudah kusam dan mulai lapuk punak Simorangkir bersama Fransisca yang mengaku dan mendapati Elyas sudah mah yang hanya berukuran akibat kena hujan dan terik Edison Sianipar dan Syamsul terpaksa membeli buku KUHP meninggal, sedangkan suami 3 x 3 meter dia tinggal ber- matahari. Bahri Lubis, diadegankan ber- (Kitab Undang Undang Hukum saya sekarat,” jelas Fransisca. sama keenam orang cucu- Niatnya untuk memba- gumul dan hanya pakai tangan Pidana) di Titi Gantung Medan Tapi ketiga tersangka, kata- nya dan satu orang anak- ngun rumahnya kembali memukuli mendiang Elyas dan untuk memahami kasus yang nya, masih terus memukuli nya, Serron alias Sepay, 35. terhambat biaya tukang. Untuk korban Paiman. melanda keluarganya, merasa kedua korban pakai balok dan Rumah tidak layak huni itu kebutuhan sehari-hari saja, Padahal kejadiannya bukan hasil rekonstruksi itu juga tak batu. “Saya dan suami trauma hanya berdindingkan keluarga keturunan India Mu- begitu. Ketiga tersangka lebih sesuai maksud Surat Panggilan jika mengingat kejadian terse- triplek dan seng. slim ini saja sulit memenuhinya. dahulu menyandera Elyas dan Polisi kepada mereka untuk but. Kami juga takut tersangka Di dalam rumah kecil “Gimana mau bayar tukang. Paiman, lantas memukuli mere- memberikan kesaksian. bakal mengulangi perbuatan- itu terlihat kumuh. Karena Saya tak kerja, anak saya Sepay ka dengan batu dan balok. Sua- “Di Surat Panggilan Polisi nya jika hanya dijerat dengan tak ada tempat lagi menym- hanya nantu-bantu member- mi saya juga sudah protes saat buat saya dan suami saya, selalu pasal penganiayaan yang hu- pan barang- barang, sung- sihkan pekong. Yang hanya rekonstruksi, tapi adegannya disebutkan pasalnya 340 jo 338 kumannya sangat ringan,” guh jelas kelihatan rumah bergaji Rp400 ribu per bulan,” jalan terus. jo 170 jo 351 ayat 3. Tapi setelah katanya menambahkan. itu berserakan. Sehingga terangnya. “Saya sendiri ikut menyak- rekonstruksi, saya baca di Ko- Dia pun meminta Kapolda untuk tidur mereka harus Membangun rumahnya Waspada/Mursal AI bersempit-sempitan di kembali sepertinya tinggal sikan mayat Elyas yang sudah ran, Kanit Jahtanras Poltabes Sumut dan Kapoltabes Medan MUNIMAH, 60, beserta dua orang cucunya berdiri di depan rumahnya yang tak layak huni lantai beralas tikar. angan-angan, apalagi menan- di Jalan Mangkubumi Gang Kelinci, Jumat (6/11). terbujur, masih mereka seret Medan AKP Faidir Chan justru berkenan memperhatikan dan pukuli pakai balok. Suami mengatakan ketiga tersangka kasus ini. (h01)
    • 12 Opini WASPADA Senin 9 November 2009 Kisah Sisiphus Bagi Koruptor Raya akhirnya dibredel dalam Peristiwa tak berani menjalankan anggaran Oleh Muchsin Lubis Malapetaka 15 Januari 1974 yang dige- pembangunan karena takut terkena rakkan Hariman Siregar. “penyakit 3 huruf” yakni KPK. Bahkan P emberantasan korupsi di In- Hal itu membuat marah wartawan Di era Soeharto, pemberantasan seorang walikota hanya diam mem- donesia mirip kisah Sisi- Mochtar Lubis, pemilik Koran Indone- korupsi yang menyangkut pejabat nya- biarkan kotanya semrawut karena ta- phus. Begitu susah payah, sia Raya yang kritis. Indonesia Raya ris tak terdengar sama sekali. Kalaupun kut menggunakan anggaran. Sang getir dan absurd. Nyaris tan- membongkar kasus pelarian uang oleh ada peradilan korupsi, kebanyakan walikota lebih memilih “aman” dalam pa harapan. Mitologi Yunani kuno itu pengusaha Lie Hok Thai yang dibawa menyangkut pengusaha dan jaringan- mengakhiri karirnya menjelang pen- menceritakan absurditas Sisiphus yang Menteri Luar Negeri Roeslan Abdul nya, tak sampai menyentuh kekuasaan siun. setiap hari mengangkat batu besar ke Gani ke luar negeri. Roeslan sempat Soeharto. Kasus yang terungkap pada Ketika KPK ditakuti akhirnya dicari puncak gunung, tapi tiap kali tiba di diadili, tapi dampaknya Mochtar Lubis tahun 1986 ketika Raden Sonson Na- titik lemah. Kebetulan Ketua KPK An- puncak, batu itu terguling kembali. dianggap pembangkang oleh Presiden talewaga, ayah Menteri Luar Negeri Ra- tasari Azhar dituduh terlibat dalam Sisiphus mengangkatnya kembali, tapi Soekarno dan dipenjarakan dua kali den Marty Natalegawa sekarang, yang pembunuhan Nasrudin Zulkarnain. terguling kembali. Demikian sete- selama 8 tahun. Sebelumnya Mochtar saat itu salah seorang direktur di bank Puncaknya, KPK berseteru dengan ke- TAJUK RENCANA rusnya. menuliskan kisah kebobrokan peme- pemerintah. Sonson diadili dalam per- polisian akibat tudingan Antasari ter- Di Indonesia, Sisiphus itu kini ber- rintahan tersebut dalam roman “Senja kara korupsi karena terlibat dalam ka- hadap koleganya di KPK. Pintu masuk nama Komisi Pemberantasan Korupsi di Jakarta (Twilight in Jakarta ) yang mem- sus penyelundupan mobil mewah oleh yang dibuat Antasari Azhar ini akhir- (KPK). Bahkan nasib KPK sekarang ini buat berang Soekarno. pengusaha Acai. Selebihnya, kasus ko- nya menciptakan perseteruan panjang SBY Dan Hari Pahlawan lebih menderita ketimbang Sisiphus itu sendiri. Kalau Sisiphus sempat ber- hasil ke puncak gunung, tapi KPK baru Dampak korupsi di era 1950-an itu akhirnya meluas dan memunculkan ketidakpuasan daerah karena terjadi rupsi dibungkam. Ketika Soeharto tumbang pada Mei 1998, muncul istilah gerakan anti Ko- antara KPK dengan kepolisian. Pim- pinan KPK Chandra Hamzah dan Bibit Samad Rianto pun sempat mendekam B angsa Indonesia Selasa (besok) memperingati Hari Pahlawan. Hari berjalan di lereng gunung, batu yang ketimpangan pembangunan yang ter- rupsi, Kolusi dan Nepotisme dalam se- di penjara. bersejarah bagi bangsa kita itu diambil dari semangat perlawanan ‘’Arek- diangkatnya sudah digulingkan. Hal pusat di Jawa. Akibatnya, Wakil Presi- buah seminar di Fakultas Kedokteran Tindakan itu membuat banyak arek Suroboyo’’ melawan penjajah. Namun sebelum itu perlawanan anak- itu ditandai ketika pimpinan KPK Chan- den Mohammad Hatta mengundur- Universitas Indonesia , Salemba, Jakar- orang menjadi marah dan akhirnya anak bangsa melawan Belanda dan bangsa-bangsa lainnya sudah terjadi dra Hamzah dan Bibit S. Rianto dije- kan diri pada November 1956 dengan ta . Dalam Sidang Umum MPR di era masalah tersebut merebet ke ranah bloskan ke penjara. Rakyat kini mulai salah satu alasan maraknya korupsi Presiden BJ Habibie dikeluarkan Kete- sosial dan politik. Presiden Susilo Bam- jauh sebelum bangsa Indonesia merdeka pada 17 Agustus 1945. Kalau dahulu pahlawan bangsa itu identik dengan mereka yang berjuang marah karena koruptor kembali ber- dan Presiden Soekarno suka berpesta tapan MPR untuk menyelidiki KKN bang Yudhoyono pun ikut kelimpung- pesta. pora dan pergi ke luar negeri yang meng- Soeharto dan kroninya. Tapi usaha pem- an karena sudah mengarah ke wilayah mengangkat senjata melawan penjajahan kedaulatan, namun sejalan dengan sudah Begitulah sejarah pemberantasan habiskan uang negara. Efek berikutnya, berantasan KKN itu gagal. Soeharto kekuasaan dan mendadak memanggil merdekanya bangsa Indonesia maka perjuangan secara fisik (heroik) pun berlalu. korupsi di nusantara ini. Dari sejak muncul perlawanan militer di daerah tak kunjung berhasil diadili dengan 4 tokoh nasional untuk mengatasi soal Kini, pahlawan bangsa bisa muncul dari mana saja mereka yang memiliki jasa dan kembalinya kedaulatan RI sampai saat yang kemudian meletuskan pembe- alasan sakit. Yang berhasil dijebloskan tersebut. Seterusnya membentuk Tim pengabdian besar bagi kemajuan bangsa dan negaranya. ini, pemberantasan korupsi tak kun- rontakan PRRI. Korupsi benar-benar ke penjara hanya pengusaha Bob Ha- Pencari Fakta (TPF). Sayangnya, putra-putri terbaik bangsa kita teramat sedikit yang mampu jung mendapat tempat yang layak. Se- menghancurkan negara. san dan anaknya Tommy Soeharto. Ta- Persoalan besar yang dihadapi mencatatkan dirinya dalam memajukan bangsa Indonesia pasca kemerdekaan RI. hingga Indonesia menjadi surga bagi Nasib buruk kembali menimpa pi di penjara Nusakambangan mereka bangsa Indonesia sekarang, mengapa Hal ini bisa terjadi akibat kurangnya perhatian pemerintah terhadap para pejuang koruptor, sebab korupsi – seperti ung- Mochtar Lubis di zaman Presiden Soe- berhasil “membangun istana dan bis- sejak dulu semangat anti korupsi selalu di masa lalu maupun kepada para pahlawan yang sudah mencurahkan jiwa dan kapan Wakil Presiden Bung Hatta – su- harto ketika membongkar korupsi di nis” di sana . dipadamkan. Bagi kalangan yang ber- raganya di berbagai bidang dan profesi. dah menjadi kebudayaan. Pertamina di awal tahun 1970-an. Ka- Begitu sulitnya memberantas ko- kuasa, jawabannya memang sangat Kalau peneliti Pussis Unimed Erond Damanik mengusulkan sejumlah tokoh pers Keadaan sosial dan politik saat ini, sus korupsi Dirut Pertamina Ibnu Soe- rupsi. Karena penjara bukan lagi tem- mudah, karena menyangkut kepen- Sumut menjadi pahlawan nasional, seperti Parada Harahap, Moh. Said, Ani Idrus, mirip seperti era tahun 1950-an ketika towo yang diinvestigasi Mochtar Lubis pat yang menakutkan atau membuat tingan. Tapi sejarah telah membuk- hal itu perlu ditindaklanjuti oleh pihak terkait. Sebab, menjadikan mereka yang benar- Indonesia kembali menjadi Negara ke- selama 3 tahun dengan barang bukti jera. Seorang pengusaha kelapa sawit tikan, bangsa ini pernah berantakan benar berjuang di bidangnya (pers) sebagai pahlawan nasional berdampak positif satuan RI. Undang Undang Dasar Se- dokumen sebanyak 2 peti, membuat yang dijebloskan ke penjara di era re- dan benar-benar hancur berantakan bagi generasi muda untuk meniru sepak terjang para pahlawan bangsa itu. Tidak mentara (UUDS) 1950 menciptakan Soeharto marah. Sebab Pertamina di formasi, membangun “istana” di pen- karena korupsi yang berkonspirasi de- sistem parlementer di mana pemerin- awal kekuasaan Soeharto, menurut pe- jara di luar Jakarta . Bahkan Menteri ngan politik. Pertanyaannya, apakah hanya di bidang pers tetapi juga di berbagai bidang lainnya, termasuk penegak hukum, tahan dikuasai partai politik. Korupsi ngamat ekonomi politik Jeffrey Winters Kehutanan MS Kaban sempat memer- kita rela harus mengulangi kehancuran ekonomi, politik, sosial dll. dalam desertasinya, merupakan sum- merajalela di segala sektor dan parpol gokinya di pesawat terbang. itu dan kembali berdarah-darah seper- Selama ini banyak pejuang kusumah bangsa yang tewas melawan kolonial Belanda mengkavling departemen-departe- ber dana dalam membangun kekua- Kini, ketika KPK lebih berani tampil ti peristiwa PRRI dan Tragedi Mei 1998 dan bangsa asing lainnya tidak mendapatkan penghargaan apa-apa, mengapa hal men dan perusahaan negara. Walau- saannya. memberantas korupsi terutama dalam yang semua itu bersumber dari KKN itu bisa terjadi? Jawabnya karena tidak ada pihak yang memperhatikan dan pun Kabinet Burhanuddin Harahap Mochtar Lubis coba disogok Rp 500 kasus BLBI yang dideponir Kejaksaan dan ketidakadilan dalam bernegara? mengusulkannya. Begitu pula dengan tokoh-tokoh yang berjuang secara intelektual. dari Masyumi berusaha memberan- juta ditawari untuk membangun per- Agung sehingga menyeret Jaksa Tri Kita kembali mengulang kisah Sisiphus Padahal, kita butuh banyak pahlawan bangsa. Dalam kurun waktu enam dasawarsa tasnya, tapi gagal, karena Masyumi ka- cetakan Indonesia Raya oleh Direktur Gunawan dan pengusaha Artalyta Sur- dalam memberantas korupsi. Getir belakangan ini sangat sedikit muncul sosok orang yang dapat dijadikan teladan bangsa. lah dalam Pemilu 1955. Partai Nasional Keuangan Pertamina J. Pattiasina di yani serta menyeret banyak wakil rak- dan absurd. Padahal sudah terjadi pergantian pemimpin Indonesia (PNI) menang dan kembali rumah perwira angkatan laut John Lie. yat ke pengadilan, KPK mulai dibenci. nasional, dari Bung Karno ke Pak Harto lalu berkuasa. Politisi dan pejabatpun ber- Mochtar Lubis marah dan sogokan itu Karena banyak birokrat yang ketakut- Intisari ke Habibie, berlanjut kepada Gus Dur hanya korupsi kembali. ditolak mentah-mentah. Indonesia an. Bahkan banyak pejabat di daerah Penulis adalah pengamat sosial dan politik sekitar dua tahun lalu beralih kepada Megawati, dan kini dipegang Susilo Bambang Momentum tepat buat Yudhoyono (SBY) untuk periode kedua. Momentum memperbaiki ketertinggalan SBY bertindak tegas da- bangsa di berbagai bidang, khususnya dalam Susunan Kelengkapan Dewan Mesti Proposional lam pemberantasan ko- penegakan hukum dan pemberantasan di gedung rakyat itu sebelum melaku- badan legislasi, Badan Kehormatan se- rupsi tanpa pilih kasih. korupsi memungkinkandan serius. Sebab, Presiden SBY jika ia mau dapat dilakukan Oleh Drs. H. Amiruddin kan tindakan yang akan sangat meru- cara bergilir, sehingga tidak terjadi ke- gikan. Hal yang tidak boleh dilupakan senjangan. Dengan demikian kinerja SBY dipilih dengan 60 persen suara rakyat. dewan semakin bagus. seorang anggota dewan bahwa ia ada- Besarnya dukungan rakyat pada SBY P emikiran yang tidak sepaham sakan dalam memangku jabatan yang lah wakil rakyat yang dipercaya untuk Struktur kelengkapan dewan Kota seharusnya dipergunakan dengan sebaik-baiknya dengan menomorsatukan memang bisa menjadi pemicu ada, seperti jabatan ketua, wakil ketua melakukan perubahan terhadap tatan- Medan meliputi 4 komisi yaitu komisi kepentingan rakyat. Bukan malah berkoalisi dengan para parpol yang di mata rakyat utama dalam mewujudkan maupun sekretaris pada masing – ma- an kehidupan masyarakat dan kota. A, komisi B, komisi C dan komisi D. Ser- citranya menurun (jelek). Terbukti, parpol dan DPR/DPRD tidak menaruh pehatian ketidaknyamanan kerja dalam setiap sing komisi, jabatan ketua dan wakil Amanah yang sangat mulia itu tidak ta terdiri dari 3 Badan Kelengkapan. atas pengaduan masyarakat, sehingga aspirasi rakyat selalu terabaikan. instansi maupun organisasi. Tentu saja, ketua pada Badan Kehormatan (BK), seharusnya dipermainkan dan bahkan Di antaranya Badan Legislasi, Badan Munculnya perseteruan antara KPK dan Polri merupakan bukti kurang tanggapnya itu karena setiap individu memiliki pe- jabatan pada Badan Legislasi (Baleg), dijadikan sebagai alat untuk mensejah- Kehormatan, dan Badan Anggaran. Se- Presiden SBY. Kalau saja SBYcepat bertindak dengan menggunakan haknya sebagai mikiran sendiri – sendiri. Meskipun maupun jabatan pada Badan Anggar- terakan pribadi maupun golongan se- dangkan fraksi yang ada terdiri dari Presiden kasus ‘’Cicak versus Buaya’’ ini bisa menjadi sangat berharga bagi kemajuan dalam sebuah partai yang sama. Apa- an (Bangar). mata. Jangan pernah melupakan bah- 8 Fraksi yang mewakili partai – partai masa depan bangsa ke depan. Saatnya Presiden SBY tegas, menyuarakan dengan lagi dengan partai yang berbeda, tentu Kalau susunan kelengkapan dewan wa seorang anggota dewan berhasil . Jadi secara proporsional untuk ke de- saja apa yang dipikir dan dimaksud telah dilakukan dengan cara yang pro- duduk di rumah rakyat karena rakyat lapan fraksi di DPRD Kota Medan me- keras pemberantasan korupsi sampai ke akar-akarnya. Apalagi ia menjadikan oleh sebuah partai berbeda dengan porsional, tentu saja masalah yang yang memilih maka seorang anggota miliki peluang sebagai pemimpin Ba- pemberantasan korupsi sebagai jualan dalam kampanyenya saat Pilpres lalu. maksud dari partai lainnya. Akan tetapi dan Kelengkapan Dewan. Suara terba- muncul saat ini tidak akan terjadi. Se- dewan harus benar – benar melayani Terbongkarnya kebobrokan hukum di kalangan oknum pejabat tinggi KPK, Polri, seharusnya perbedaan itu tidak menja- tiap program kerja yang telah ada dan rakyat dengan tulus dan ikhlas bukan nyak pula dipertimbangkan untuk men- Kejaksaan Agung merupakan puncak dari rendahnya penegakan hukum kita sejak di kendala dalam menjalankan roda akan ada demi kemajuan Kota Medan hanya topeng untuk meraup keun- jadi pimpinan Badan Kelengkapan kemerdekaan sehingga supremasi hukum yang digembar-gemborkan hanya di mulut pemerintahan yang tujuannya hanya dan kesejahteraan masyarakatnya da- tungan dari kepercayaan rakyat. Ingat- Dewan. saja (lips service). Itu bisa dilihat dari banyaknya pejabat dan mantan pejabat yang untuk mewujudkan kesejahteraan pat dijalankan dengan cara bersama lah bahwa anggota dewan adalah pem- Dari susunan formasi di atas dapat ditangkap KPK. Sikap agresif KPK khususnya di bawah pimpinan Antasari Azhar rakyat. – sama dan dalam suasana yang kon- bantu bagi rakyat yang kewajibannya terlihat dengan jelas bahwa partai yang membuat gerah banyak pihak, maka berbagai cara dilakukan pihak-pihak yang Akan tetapi perbedaan itu pasti dusif, tenang dan menyenangkan tan- adalah melayani rakyat sepenuhnya memiliki kursi terbanyak di gedung terancam untuk melemahkan KPK lewat umpan wanita, tahta, dan harta. Ternyata menjadi kendala besar jika tujuannya pa ada perseteruan atau rasa tidak se- tanpa membeda – bedakan status so- dewan berhak mendapat kesempatan itu berhasil! Antasari tersangkut kasus pembunuhan Nasaruddin setelah terbujuk tidak bulat untuk kepentingan rakyat, nang antara satu dengan lainnya. De- sial rakyat. memangku jabatan tertinggi lebih ba- rayuan istri siri korban direktur BUMN itu. melainkan untuk kepentingan pribadi ngan demikian program kerja dapat Lalu, bagaimana sebenarnya su- nyak di setiap komisi maupun di badan maupun golongan. Misalnya saja saat dijalankan dengan cara berkesinam- sunan proporsional itu? Susunan pro- definitif seperti Badan Kehormatan Di sinilah SBY selaku kepala pemerintahan harus membuktikan komitmennya ini, suasana yang kurang kondusif te- bungan. Tidak seperti saat ini, anggota porsional dalam penyusunan keleng- (BK), serta di badan Legislatif (Baleg) dalam upaya pemberantasan korupsi dan merealisasikan janji-janji politik selama rasa di gedung wakil rakyat Kota Me- maupun Badan Anggaran (Bangar). dewan periode 2009 – 2014 terkesan kapan dewan di DPRD Medan seha- kampanye lalu. Konflik yang terjadi antara KPK dan Polri serta Kejaksaan Agung dan. Problema yang cukup rumit na- sangat santai karena tidak memiliki rusnya disusun secara benar, baik dan Penyususunan formasi seperti itu da- jangan sampai menjadi antiklimaks. Setelah rebut-ribut, saling buka-bukaan akhirnya mun masih dalam konteks klasik. Hal agenda kerja. Bagaimana menyusun bermanfaat. Maksudnya. Susunan pat dijalankan juga di DPRD Kota Me- hilang begitu saja. Padahal, rakyat sudah mengetahui lewat media massa bahwa yang seharusnya dapat dibicarakan program kerja kalau masalah susunan yang akan dibentuk dilakukan dengan dan. Jika saja semua fraksi secara mu- bukti-buktinya sudah sangat telanjang adanya keterlibatan pejabat negara dalam dengan hati lapang dan kepala dingin jabatan untuk kelengkapan dewan saja cara yang benar dan mengandung nilai syawarah dan mufakat ingin merubah mafia hukum dan korupsi. malah menimbulkan kontroversi di menjadi prioritas utama yang terus kebaikan bagi seluruh partai yang ada, formasi susunan kelengkapan dewan Tak pelak lagi kondisi penegakan hukum dan khususnya pemberantasan korupsi antara wakil rakyat tersebut. Bagaima- diperdebatkan? sehingga tidak muncul perasaan meru- secara proporsional dengan meng- sudah mencapai titik nadir dengan merebaknya kasus korupsi yang menjadi musuh na nasib rakyat dan Kota Medan di ma- Meskipun kini telah terjadi hal yang gikan dan dirugikan. Kemudian hasil analisa fornasi susunan kelengkapan rakyat. Keterlibatan pejabat tinggi negara, tokoh politik, dan partai politik membuat sa yang akan datang ya? Wah, mungkin tidak diinginkan seperti kondisi seka- penyusunannya dapat bermanfaat un- dewan secara proporsional, tentu tidak jalannya pemerintahan tidak kondusif. Wajar kalau rakyat marah dan melakukan rakyat hanya akan mendapat kekece- rang di rumah rakyat yang semakin te- tuk kepentingan orang banyak, khu- akan terjadi masalah seperti sekarang waan saja. Semoga tidak demikian rasa seperti tungku panas, namun pa- susnya masyarakat yang telah mem- ini bukan ? aksi turun ke jalan, seperti terlihat di Bundaran HI Jakarta kemarin. Mudah-mudahan adanya. nasnya masih dapat didinginkan kem- berikan amanah mulia pada seluruh saja Presiden SBY cepat tanggap dan menjadikan momentum Hari Pahlawan ini Masalah siapa yang seharusnya bali. Itupun kalau setiap anggota lagis- anggota dewan terpilih periode 2009 Penulis adalah Anggota DPRD Kota dengan bertindak tegas terhadap anak buahnya yang terkait penyalahgunaan jabatan memangku jabatan dalam tiap komisi latif dari beragam partai tersebut dapat – 2014. Medan, Fraksi Demokrat. maupun mereka yang terlibat korupsi berjamaah.+ maupun badan kelengkapan dewan duduk bersama dan membicarakan Lalu, seperti apa susunan tersebut? menjadi akar permasalahan yang mun- kembali sistem yang lebih baik dalam Jika membandingkan dengan sistem cul saat ini. Hal itu bukanlah hal yang penyusunan kelengkapan dewan di penyusunan yang telah terbentuk di Hubungi kami pantas untuk diperdebatkan. Meski- pun hal tersebut memang butuh per- DPRD Medan. Lalu, apakah masih be- lum terlambat membicarakan hal badan legislatif kota Banjarmasin mi- salnya, terlihat ada keseimbangan da- KANTOR PUSAT Penerbit: PT Penerbitan Harian Waspada hatian serius agar posisi yang seha- rusnya diduduki oleh orang yang tepat demikian sementara telah terbentuk susunan yang seperti saat ini? Tentu lam penyusunan kelengkapan anggota dewan. Hal itu terlihat dari formasi pe- SUDUT BATUAH Jalan Letjen Suprapto/Brigjen Katamso No. 1 Komisaris Utama: Tribuana Said karena kemampuan dan tanggungja- saja tidak ada kata terlambat untuk nyusunannya yang menggunakan sis- Medan 20151 Direktur Utama: dr. Hj. Rayati Syafrin, MBA, MM wab yang dimilikinya untuk memang- melakukan hal yang baik, apalagi hal tem 6-6-5 setiap tahunnya. Artinya se- Tel: (061) 4150858, Faks Redaksi: (061) 4510025, * Gubsu dukung pemberantasan SIUPP: 065/SK/MENPEN/SIUPP/A.7/198 ku jabatan tersebut. Serta dengan ter- tersebut bertujuan untuk kebaikan rak- tiap partai yang memiliki kursi terba- Faks Tata Usaha: (061) 4531010. cerminnya sila ke dua yaitu keadilan. mafia hukum tanggal 25 Februari 1988 yat banyak. nyak berhak memangku jabatan yang E-mail Redaksi: redaksiwaspada@gmail.com Artinya setiap anggota wakil rakyat Bayangkan saja jika setiap anggota lebih tinggi dalam setiap susunan ko- - Awak idem! Anggota SPS No. 13/1947/02/A/2002 KANTOR PERWAKILAN yang telah terpilih dan duduk di ge- dewan yang diamanahkan rakyat un- misi atau susunan badan definitif, bah- Percetakan: PT Prakarsa Abadi Press dung kehormatan itu dari berbagai tuk memberikan kemakmuran dan ke- kan mendapat kesempatan lebih ba- * Kadis Kesehatan Sumut bawa Bumi Warta Jaya Jalan Kebon Sirih Timur Dalam No. 3 Jalan Letjen Suprapto/Brigjen Katamso No. 1 partai yang ada sama – sama menda- sejahteraan rakyat Kota Medan malah nyak untuk memangku jabatan terse- pasien miskin ke RS Medan 20151 patkan hak yang sama dalam hal apa but. Di mana disebutkan misalnya un- - Bagus, bagus itu, he...he...he Jakarta 10340 gontok – gontokkan di dalam rumah Tel: (061) 6612681 Tel: (021) 31922216, Faks: (021) 3140817. saja, terutama dalam hal susunan ke- dengan satu atap tersebut, pastilah tuk partai dengan suara terbanyak se- Isi di luar tanggung jawab percetakan lengkapan dewan di DPRD Medan. akan berdampak negatif bukan untuk tiap tahun berhak memangku jabatan * Penanganan Gepeng terkendala Jalan Ratu Syafiatuddin No. 21 C Banda Aceh 23122 Harga iklan per mm kolom: Dalam hal ini seharusnya keleng- rakyat dan Kota Medan tentunya. Lalu, ketua, wakil ketua maupun sekretaris anggaran Tel & Faks: (0651) 22385 BW Rp. 11.000,- kapan dewan dapat disusun dengan untuk apa mereka ada kalau hanya un- di setiap komisi yang tersedia. Begitu- - Jadi tetaplah mereka mengemis! FC Rp. 30.000,- cara yang proporsional. Dengan demi- tuk memperburuk keadaan masyara- pun dalam formasi susunan badan ke- Jalan Iskandar Muda No. 65 Lhokseumawe kian setiap partai yang berhasil duduk Halaman depan BW Rp. 33.000,- kat dan Kota Medan? lengkapan dewan. Dalam hal ini semua Tel: (0645) 42109 D oel Wak Halaman depan FC Rp. 90.000,- di gedung DPRD Medan sebagai wakil Seharusnya hal sepele itu menjadi partai dapat diberi kepercayaan untuk Jalan Sutami No. 30 Kisaran. Tel: (0623) 41412 Ukuran kolom: 40,5 mm penerima aspirasi rakyat dapat mera- pertimbangan besar bagi para petinggi menempati formasi komisi – komisi, WASPADA Dewan Redaksi: H. Prabudi Said, H. Teruna Jasa Said, H. Azwir Thahir, H. Sofyan Harahap, H. Akmal Ali Zaini, H. Muhammad Joni, Edward Thahir, M. Zeini Zen, Hendra DS. Redaktur Berita: H. Akmal Ali Zaini. Redaktur Kota: Edward Thahir. Redaktur Sumatera Utara: M. Zeini Zen. Redaktur Aceh: Rizaldi Anwar. Redaktur Luar Negeri: H. Muhammad Joni. Redaktur Nusantara & Features: Gito Agus Pramono. Redaktur Opini: H. Sofyan Harahap. Redaktur Ekonomi: Armin Rahmansyah Nasution. Redaktur Olahraga: Johnny Ramadhan Silalahi. Redaktur Minggu/Humas: Hendra DS, Redaktur Agama: H. Syarifuddin Elhayat. Asisten Redaktur: Rudi Faliskan (Berita) Zulkifli Harahap, Muhammad Thariq (Kota Medan), Feirizal Purba (Sumatera Utara), T. Donny Paridi (Aceh), Syafriwani Harahap (Luar Negeri), Setia Budi Siregar (Olahraga), Hj. Hoyriah Siregar (Ekonomi), T. Junaidi (Hiburan), Hj. Erma Sujianti Tarigan (Agama), Hj. Neneng Khairiah Zein (Remaja), Austin Antariksa (Kreasi), Armansyah Thahir (Otomotif), Anum Purba (Wanita), Hj. Ayu Kesumaningtyas (Kesehatan), Denny Adil (Pelangi). Sekretaris Redaksi: Hj. Hartati Zein. Iklan: Hj. Hilda Mulina, Rumondang Siagian (Medan), Lulu (Jakarta). Pemasaran: Andi L. Said (Medan), H. Subagio PN (Sumut), S. Manik (NAD). Wartawan Kota Medan (Umum): H. Erwan Effendi, Muhammad Thariq, Zulkifli Harahap, David Swayana, Amir Syarifuddin, Ismanto Ismail, Rudi Arman, Feirizal Purba, Zulkifli Darwis, H. Abdullah Dadeh, H. Suyono, Ayu Kesumaningtyas, M. Ferdinan Sembiring, M. Edison Ginting, Surya Effendi, Anum Purba, Sahrizal, Sulaiman Hamzah, Sugiarto, Hasanul Hidayat, Aidi Yursal, Rustam Effendi. Wartawan Kota Medan (bidang khusus): H. Syahputra MS, Setia Budi Siregar, Austin Antariksa, Dedi Riono (Olahraga), Muhammad Faisal, Hang Tuah Jasa Said (Foto), Armansyah Thahir (Otomotif), Dedi Sahputra (Penugasan Khusus). Dedek Juliadi, Zulfan Efendi, Tetty Rosiana, Handaya Wirayuga (Koran Masuk Sekolah/KMS). Wartawan Jakarta: Hermanto, H. Ramadhan Usman, Hasriwal AS, Nurhilal, Edi Supardi Emon, Agus Sumariyadi, Dian W, Aji K. Wartawan Sumatera Utara: H. Riswan Rika, Nazelian Tanjung (Binjai), H.M. Husni Siregar, Hotma Darwis Pasaribu (Deli Serdang), Eddi Gultom (Serdang Bedagai), H. Ibnu Kasir, Abdul Hakim (Stabat), Chairil Rusli, Asri Rais (Pangkalan Brandan), Dickson Pelawi (Berastagi), Muhammad Idris, Abdul Khalik (Tebing Tinggi), Mulia Siregar, Edoard Sinaga (Pematang Siantar), Ali Bey, Hasuna Damanik, Balas Sirait (Simalungun), Helmy Hasibuan, Agus Diansyah Hasibuan, Sahril, Iwan Hasibuan (Batubara), H. Abu Bakar Nasution, Nurkarim Nehe, Bustami Chie Pit (Asahan), Rahmad Fansur Siregar (Tanjung Balai), Indra Muheri Simatupang (Aek Kanopan), H. Nazran Nazier, Armansyah Abdi, Neirul Nizam, Budi Surya Hasibuan (Rantau Prapat), Hasanuddin (Kota Pinang) Edison Samosir (Pangururan), Jimmy Sitinjak (Balige), Natar Manalu (Sidikalang), Arlius Tumanggor (Pakpak Bharat)Parlindungan Hutasoit, Marolop Panggabean (Tarutung), Zulfan Nasution, Alam Satriwal Tanjung (Sibolga/Tapanuli Tengah), H. Syarifuddin Nasution, Mohot Lubis, Sukri Falah Harahap, Balyan Kadir Nasution (Padang Sidimpuan), Idaham Butarbutar (Gunung Tua), Iskandar Hasibuan, Munir Lubis (Panyabungan), Bothaniman Jaya Telaumbanua (Gunung Sitoli). Wartawan Aceh: H. Adnan NS, Aldin Nainggolan, Muhammad Zairin, Munawardi Ismail, Zafrullah, T. Mansursyah, T. Ardiansyah (Banda Aceh), Iskandarsyah (Aceh Besar), Maimun (Lhoksukon) Bustami Saleh, M. Jakfar Ahmad, Jamali Sulaiman, Arafat Nur, M. Nasir Age, Fakhrurazi Araly, Zainal Abidin (Lhokseumawe), Muhammad Hanafiah (Kuala Simpang), H. Syahrul Karim, H. Ibnu Sa’dan, Agusni AH, H. Samsuar (Langsa), Amiruddin (Idi), HAR Djuli, Zainuddin Abdullah (Bireuen), Bahtiar Gayo (Takengon), Muhammad Riza, H. Rusli Ismail (Sigli), T. Zakaria Al-Bahri (Sabang), Khairul Boang Manalu (Subulussalam), Rusli Idham (Meulaboh), Jaka Rasyid (Blang Pidie), Zamzamy Surya (Tapak Tuan), Ali Amran, Mahadi Pinem (Kutacane), Bustanuddin , Wintoni (Blangkejeren), Khairul Akhyar (Bener Meriah), Tarmizi Ripan, Mansurdin (Singkil), Rahmad (Sinabang). Semua wartawan Waspada dilengkapi dengan kartu pers. Jangan layani dan segera laporkan ke pihak berwajib atau ke Sekretaris Redaksi bila ada oknum yang mengaku wartawan Waspada tetapi tidak bisa menunjukkan kartu pers yang sah, ditandatangani Pemimpin Redaksi
    • WASPADA Senin 9 November 2009 Opini 13 Taliban Bangkit Oleh Rosihan Anwar Fakta Yang (Tidak) Mendidik D ALAM bagian ini diceritakan tentang kebangkitan kembali kaum Taliban manusia. Pengekan kebenaran memang penyimpangan UN adalah fakta yang sa- ini dengan tekad dan iktikad baik dari sebagaimana terdapat dalam uraian majalah Newsweek (5 Oktober 2009). memerlukan perjuangan agar tidak ditum- ngat tidak mendidik. Oleh karenanya semua pihak. Alkisah Younas berkata mulanya dia tidak mendengar orang-orang Afghani- bangkan oleh kejahatan yang terorganisir. perbaikan yang mendasar terhadap dua stan berbicara untuk kembali ke negeri mereka berperang.Tapi orang-orang Arab mendengar Penyajian media yang “berlebihan” sumber utama kerawanan UN, yakni ke- Taubat hal itu, dan mereka menggalakkan orang-orang Afghan dan penduduk kabilah lokal untuk juga dapat menjadi fakta yang tidak mendi- bocoran naskah dan perilaku oknum guru Banyak peristiwa (fakta) yang telah tidak menghentikan perjuangan.Tidak banyak terjadi selama tahun pertama, tapi kemudian Oleh Syawal Gultom dik.Terlepas dari kasus yang menimpa KPK, pengawas, oknum kepala sekolah dan ok- menzalimi individu dan bahkan institusi. orang-orang Arab mulai melaksanakan beberapa kamp latihan. Yang pertama didengar Polri dan Kejaksaan Agung, fakta yang di- num Dinas Pendidikan sangat diperlukan. Oknum wartawan dan oknum LSM tidak oleh Younas ialah kamp dekat Wana. Ketika dia punya waktu pergi dari sekolah, maka dia tampilkan di media tertentu saatnya untuk Jika UN dan SNMPTN disatukan, itu berarti jarang melakukan pemerasan lewat fakta D kunjungi kamp latihan. Dia sangat terkesan. Ada lebih dari sebuah kamp latihan. Yang alam Wikipedia (http://id.wiki- dikaji ulang, agar masyarakat dapat mem- menyatukan dua tujuan sekaligus. Mengu- yang dimanipulasi. Bahkan keinginan un- satu dijalankan oleh orang-orang Arab, yang lain oleh orang-orang Chechchen dan Uzbek. pedia.org/wiki/Fakta), fakta (o peroleh gambaran yang utuh. Memang kur penguasaan siswa atas perolehan masa tuk melakukan penyelewengan hampir Berkat pelajarannya di madrasah,Younas bisa berbahasa Arab. Dia berteman dengan orang- “Bahasa Latin” bahasa Latin: harus diakui, peran media untuk memba- lalu dan memprediksi keberhasilan calon tidak lagi mengenal jabatan, tingkat pendi- orang Mesir, Arab Saudi, Lybia,Yaman. Orang-orang Arab bergerak secara terbuka di jalan- factus) ialah segala sesuatu yang ngun peradaban suatu bangsa juga sangat mahasiswa ke masa depan. Tidak mustahil dikan, status dan lain sebagainya. Fakta jalan utama, di kota dan di desa, dengan memperlihatkan tidak khawatir akan keamanan tertangkap oleh o “Panca indra” indra besar. dilakukan, tetapi memerlukan kehati-ha- kasus korupsi yang melanda negeri ini telah diri mereka.Younas memutuskan berhenti bersekolah di madrasah dan menggabungkan manusia. Catatan atas pengumpulan fakta Fakta yang objektif lahir dari sikap yang tian dan ketajaman alat ukur yang akan memunculkan fakta hukum baru hingga diri dengan perlawanan orang-orang Arab. disebut o “Data” data sebagai bentuk objektif. Mendagri menyatakan, daerah digunakan. berujung pada kasus yang menimpa lem- Mohammad bercerita bahwa berakhirnya Taliban ialah permulaan dari karier jamak dari informasi. Ada fakta hukum dan pemekaran akan dievaluasi kembali. Ber- Fakta itu selalu benar sebab dia bicara baga penegak hukum hingga pembentuk- Talibannya. Ayahnya meninggal tahun 1994. Ia harus mengurus ibunya saudara-saudara ada fakta lapangan. Sayangnya, masih dasarkan hasil evaluasi dimaksud, akan apa adanya. Paling tidak dia menyimpan an tim pencari fakta. lelaki dan perempuannya. Maka dia tidak punya waktu bergabung dengan gerakan banyak fakta yang “dipelintir” sehingga ada daerah pemekaran yang disatukan kebenaran. Itulah fakta yang mendidik, Semula berawal dari perilaku oknum. Mullah Omar (pemimpin Taliban). Bertahun-tahun dia sangat tertekan jiwanya karena tidak mendidik. kembali ke induknya. Sejauh ini ada lima meski“menyakitkan” tetapi dia bisa sebagai Ambisi, kefakiran, kekuasaan, uang dan gagal ikut jihad. Setelah ambruknya Taliban akhir 2001 banyak mujahidin yang luka- Dalam kaidah o“Ilmu” keilmuan fak- daerah yang tidak memiliki PAD (Waspa- bahan pembelajaran yang mendidik. Jika keserakahan sebagai pemicunya. Sistem luka dan nanar jiwanya mulai mengunjungi mesjid di Pashawar di mana Mohammad ta adalah suatu hasil o “Observasi” ob- da,7/11/09). Menghukum daerah yang ti- fakta bertentangan dengan hukum, un- dapat tidak berfungsi di tangan orang yang jadi imamnya. Beberapa makmum menanyakan langsung kenapa Mohammad tidak servasi yang o “Obyektif” obyektif dan dak memiliki PAD adalah sikap yang men- dang-undang, regulasi, logika dan nurani, tidak kredibel. Sebaliknya, sistem dapat berjuang dalam jihad seperto orang-orang tadi. dapat dio “Verifikasi” verifikasi semua didik, tetapi membina daerah pemekaran pastilah amat tidak mendidik. menjadi superpower dan sangat power- Haqqani awal 2003 bersama keluarganya pindah ke sebuah rumah sewa di Pashawar. orang. Fakta dapat diyakini karena diurai sehingga memiliki PAD adalah jauh lebih Berdasarkan dimensi waktu, fakta itu ful membangun kepatuhan bersama dan Dia kembali memakai pakaian putih ulamanya. Sekonyong-konyong menteri pertahanan secara objektif dan tidak bertentangan mendidik. Jika dipertimbangkan risikonya, seperti obat. Dimakan pada saat yang tepat, bahkan budaya hukum yang menak- Taliban Mullah Obaidullah datang mengunjungi Haqqani. Dia pemimpin senior pertama dengan logika dan nurani manusia. Setiap adalah lebih arif membina daerah yang dengan cara yang tepat dan dengan dosis jubkan. yang dilihatnya sejak ambruknya Taliban. Dia sedang bepergian seputar Pakistan untuk orang yang mengindera fakta, secara nalu- tidak memiliki PAD sehingga mampu man- yang tepat pula. Jika salah satu saja tidak Jika seluruh peristiwa yang menimpa menghimpun pasukan Taliban terpencar-pencar. Separoh dari pimpinan Taliban kembali riah akan mempekerjakan logikanya untuk diri, dibanding sekedar menggabung- terpenuhi, maka dia berubah fungsi menja- negeri ini diurai, kita sampai pada kesim- berhubungan satu sama lain, katanya, dan mereka bertekad memulai suatu gerakan menguhubungkan fakta yang ada dengan kannya kembali dengan daerah induknya. di racun yang berbahaya bagi sekujur tu- pulan, sumber utamanya ada pada rasa berlawanan untuk mengusir orang-orang Amerika. Haqqani berpikir hal itu tidaklah fakta yang telah dinternalisasinya. Menga- Fakta yang sama dapat difungsikan seka- buh. Fakta yang dikeluarkan hanya akibat cinta yang telah menipis terhadap bangsa mungkin, akan tetapi dia memastikan Haqqani bahwa Haqqani bisa membantu. Dua pa penahanan Bibit dan Chandra menuai ligus fakta yang mendidik atau sebaliknya. desakan pihak tertentu, bukan karena ke- dan negeri ini. Idealisme untuk menjadi minggu kemudian Haqqani menghadiri sebuah pertemuan di mana ada mantan menteri reaksi dari berbagai pihak ?Tidak lebih kare- Pilihan yang penuh pertimbangan dan butuhan, pastilah mengundang kecuri- bangsa yang bermartabat mulai luntur. dan komandan pasukan, duduk bersama. Semuanya ingin melawan orang-orang Amerika. na menurut logika dan nurani orang ba- berbasis pada fakta empirik sebelumnya gaan. Dia menjadi multitafsir dan dapat Rasa takut secara sendiri-sendiri dan secara Obaidullah berkata “Kami tidak perlu anda sebagai deputi menteri atauk birokrat. Kami nyak, penahanan tersebut diduga mengan- dapat menjadi media pendidikan yang menggelinding menjadi bola salju. Fakta bersama-sama sangat memudar. Tampak ingin anda membawa sebanyak mungkin pejuang ke medan pertempuran”. dung fakta lain yang bernuansa politis. sangat efektif. Fakta empiris sebelumnya harus dikeluarkan sesuai kebutuhan dan kita lebih senang menyalahkan dari pada Syahdan Akhundzada pada suatu hari didatangi oleh seorang yang mau membeli Banyak orang yang tidak memahami aspek menunjukkan, semua daerah pemekaran saat dibutuhkan. Fakta seperti ini akan da- memperbaiki. Intensitas menyudutkan sayur mayur dari dia. Seorang mullah yang telah bekerja bertahun-tahun lamanya hukum yang menimpa keduanya, tetapi telah menunjukkan kegigihannya untuk pat menjawab masalah dan bahkan dapat orang dan pihak lain masih lebih menonjol dalam jihad Afghanistan di bagian utara. Kami saling mengenal. Dia bertanya apa yang hanya menggunakan logika dan nalurinya. berjuang. Terlepas dari motivasi instrinsik mengantisipasi berbagai kerumitan. Itulah dari pada intensitas mengajak untuk ber- mau dikerjakan oleh Akhundzada. Berjualan sayur terus atau balik ke medan jihad. Fakta ini menunjukkan, sangat dibutuhkan yang dimilikinya, terlepas apakah itu ke- fakta yang dapat mendidik rakyat. Andai buat baik. Kampanye tentang kebaikan Penghasilan Akhundzada kurang lebih 2000 rupee sehari (sama dengan Rp 33.000). informasi yang benar dan dikeluarkan sedi- inginan rakyat atau segelintir orang, tetapi fakta tentang Bank Century diungkap lebih sering bertentangan dengan fakta yang ada. Itu bagus, tapi dia mau kembali ke jihad. Pada malam hari mereka pergi ke sebuah ni mungkin untuk mendidik rakyat. fakta empirik menunjukkan, perjuangan awal dan disajikan proporsional pastilah Ucapan tidak sesuai dengan perbuatan. pertemuan dekat Pashawar. Di sana Akhundzada melihat komandan topnya dari front Keterlambatan kehadiran fakta yang pemekaran telah menewaskan salah se- lebih mendidik. Inilah sumber utama fakta yang tidak utara yakni Mullah Badullah. Dia adalah ideal Akhundzada. Usaha sayur-mayurnya mendidik sering menguras energi, pikiran orang Ketua Dewan. Oleh karenanya, Banyak fenomena di balik fakta. Ke- mendidik. berhenti dan dia balik ke jihad. Dia dikirim ke Quetta di mana sisa-sisa pasukan kesatuannya dan bahkan materi. National Summit yang membina daerah pemekaran jauh lebih pentingannya juga berbeda-beda. Me- Tetapi ada satu hal yang pasti dan ma- masih ada. Dia pernah memimpin sebanyak 400 orang pejuang. Di Quetta dia menemukan bermakna strategis dalam rangka memper- mendidik dari pada sekedar menyatu- nangkap makna yang tersirat dan tersorot sih dimiliki semua anak negeri ini yakni 15 orang bekas pejuangnya. Mereka berpelukan. Setelah berlatih di Waziristan Utara, tajam Program 100 hari, tidak banyak men- kannya ke induknya. Dalam kajian keil- dari suatu fakta adalah hak semua orang. amanat pepatah lama, hujan emas di mempersenjatai diri kembali, merekrut orang-orang lain, mereka siap untuk balik berjuang dapat perhatian publik akibat fakta perta- muan, benar, evaluasi dilakukan untuk me- Bagi rakyat awam kasus Bank Century negeri orang, hujan batu di negeri sendiri, ke Afghanistan untuk membebaskan tanah air dari kaum penyerbu yaitu militer Amerika. rungan institusi penegak hukum. Sungguh munculkan tiga rekomendasi terhadap hanya merupakan informasi lepas seba- tetapi lebih nyaman tinggal di negeri sen- Mohammad meninggalkan keluarganya supaya diurus oleh saudara lelakinya, lalu sebuah fenomena atau fakta yang kurang sebuah program, to be cancelled, to be gai bukti ketidakakuratan sistem penga- diri. Persoalan dan kerumitan apapun pergi ke Waziristan Selatan. Dia sampai di sebuah masjid di desa pegunungan yang mendidik. modified, or to be continued, akan tetapi wasan perbankan. Tetapi bagi pihak-pi- yang akan menimpa negeri ini, bagi kita terpencil dan jauh letaknya. Di sana seorang mullah (ulama) memeriksa surat perkenalan seakurat apapun evaluasi yang dilakukan hak tertentu, kasus Bank Century dapat bahwa negara ini tetap lebih nyaman dan yang ditulis oleh Azissullah dan membaca dia lebih jauh ke sebuah tempat rahasia, Objektivitas tidak dapat menghilangkan fakta per- menjadi senjata politik. Amat jauh dispa- lebih sejuk untuk menyambung hidup yang tersembunyi baik di tengah bukit-bukit, batu karang, belukar dan pohon. Sekelompok Hari-hari terakhir ini, masyarakat juangan pemekaran yang dilakukan oleh ritas fungsi dan manfaat yang dapat di- yang masih tersisa. Masalah yang me- 20 hingga 30 pejuang dari Arab Saudi, Yaman dan Mesir menemui Mohammad di sana memperoleh berbagai fakta hukum. Kontra daerah. raih. Namun demikian, apapun fenome- nimpa institusi penegak hukum di negeri dengan beberapa orang Afghan dan Chechchen. Mereka sangat curiga dan mengajukan intelijen yang dimaksudkan oleh Susno Fakta lain, SNMPTN diharapkan dapat na dibalik fakta hanya ada satu fungsinya, ini hanyalah sebuah dinamika dan pe- pertanyaan-pertanyaan agak kasar. Duadji (Kabareskrim Polri non aktif) (Was- dihapus pada tahun 2012 karena akan diin- yakni mendidik rakyat melalui hikmah ngalaman berharga untuk belajar dan Seorang Arab lain yang lebih senior mewawancarai Mohammad. Pertanyaannya pada, 7/11/09) dapat ditafsirkan dengan tegrasikan dengan Ujian Nasional (Kom- yang diberikannya. Jika ada fakta yang terus belajar untuk menata ulang supre- yang utama ialah kenapa Mohammad tidak berjuang sama jihad yang dipimpin oleh cara yang berbeda-beda. Jika hal itu dila- pas, 7/11/09). Rencana ini tentu didasarkan telah merugikan karena mengandung masi hukum yang lebih bermartabat. Mullah Omar yang bermata picek itu. Setelah beberapa jam Mohammad dibawa ke kukan sebagai counter terhadap tudingan atas fakta yang terjadi selama penyeleng- kebohongan publik atau kegagalan dia Perubahan perilaku individu, kelompok, pemimpin mereka yakni Abu Khabah al-Masri, seorang agen senior dari Al Qaeda dan suap, maka fakta itu tidak efektif sebagai garaan SNMPTN. Mendiknas berupaya akan mendidik semua pihak untuk tidak institusi, dan negara sangat dibutuhkan. pembikin bom yang tewas dalam serangan pesawat terbang tanpa pilot yang dinamakan fakta yang mendidik. Mengapa demikian akan mengakhiri polemik tentang UN de- mengulanginya. Jika fakta itu sebuah ke- Rasanya detik ini dan untuk seterusnya pesawat Predator bulan Juli 2008. Dia menyambut kedatangan Mohammad, tidak bersikap ? Menurut logika hukum dan nalar teoritik, ngan berkonsentrasi pada pelaksanaan berhasilan maka dia akan mendidik rak- yang amat sangat kita butuhkan adalah bermusuhan seperti orang-orang lain. Setelah dilatih dua bulan lamanya, bagaimana meski memerlukan kerja keras dan waktu UN yang lebih terpercaya. Agar fakta ini yat juga untuk meyakini, keberhasilan pertaubatan yang permanen, baik secara menembak, menjebak musuh dan latihan-latihan perang gerilya lainnya, Mohammad yang memadai, pembuktian kasus suap dapat mendidik maka persoalan krusial bukanlah sebagai tujuan akhir tetapi se- sendiri-sendiri maupun bersama-sama, lulus ujian. Ada 200 pejuang jumlahnya, sekitar 160 orang dari kabilah-kabilah local, telah memiliki cara-cara yang telah baku. tentang objektivitas UN harus dapat segera buah perjalanan yang tak kunjung henti. baik di tempat yang sunyi maupun di beberapa orang Punjabi (dari Pakistan) dan sekitar 40 orang Afghan. Mereka dibagi- Isu suap yang cenderung fitnah telah teruji teratasi. UN merupakan amanat konstitusi Namun demikan, di atas semua fakta di tempat terbuka. bagi dalam beberapa kelompok. Masing-masing kelompok punya dua atau tiga orang dapat dibuktikan dengan mekanisme yang dan bahkan dilakukan banyak negara. atas ada kepentingan yang lebih besar Arab yang ditugaskan sebagai komandan pasukan dan sebagai instruktur. Tiga dari lazim dan sesuai dengan logika dan nurani Namun fakta yang terjadi tentang kasus untuk bangkit bersama menata negeri Penulis adalah Rektor Unimed. kelompok itu dibom oleh militer Amerika ketika melintasi perbatasan. Berbahaya sekali keadaan di sana. Mereka ingin tiba secepatnya di daerah yang dilindungi oleh jurang, karang dan pepohonan. (+++) Dedi Trust Dan Knowledge Management Foliopini Sahputra dedisahputra@yahoo.com ini berarti, perusahaan perlu memberi kebijakan yang memadai untuk memotivasi saling percaya dalam kolaborasi dan bahwa yang dimiliki hanya merupakan milik sendiri dan lebih banyak hanya digunakan untuk keperluan membangun individu secara asumsi tentang peran nilai-nilai perusahaan personal daripada membangun organisasi. belum dapat diandalkan. Dengan kata lain, Dilandasidengantrust makaseluruhanggota trusttersebutmerupakanperekatperusahaan Crocodile Dundee organisasi akan lebih fokus untuk dan hubungan antar karyawan (Covey, 2004). membangun organisasi sehingga dengan Pada domain institusi, yakni identifikasi kemajuan dan keberhasilan organisasi Hari-hari saya belakangan ini‘terjerat’ oleh kan aksi di seluruh nusantara. Oleh Dr. Ir. Manerep Pasaribu dan Arief Grando karyawan pada perusahaannya terhadap tersebut akan memberikan pengaruh yang pihak luar, merupakan institutional trust; positif bagi mereka baik dari sisi pendapatan masalahCicak-Buaya.Dirumahwaktunonton Citra itu lahir dari apa yang difahami yakni, perasaan percaya dan aman terhadap dan peningkatan pengetahuan. Trust dan TV, ketika ngobrol dengan tetangga, ketika orang-orang tentang diri kita sebenarnya, Pendahuluan lembaga (Covey, 2004). Karyawan percaya Dalam organisasi, trustharus ada dalam kaitannya dengan Knowledge Management bertemu teman lama, ketika duduk di warung. yang terbentuk dari akumulasi sikap, per- Akhir-akhir ini kita mengalami distrust bahwa hukum, kebijakan, regulasi dalam dalam organisasi berawal dari kesadaran masing-masingkaryawandantentunyaperlu Di kantor apalagi, di tengah para mahasiswa, buatan dan cara kita dalam mendefenisikan terhadap penegak hukum di negara ini. Ini perusahaan melindungi hak-hak individu bahwa dalam suatu organisasi atau drive atau dorongan dari pimpinan atau bahkan usai sholat berjamaah di masjid, bibir atau mengeskpresikan diri kita. Kemudian dipicu dengan berbagai kasus yang muncul manajemen sehingga dengan adanya di dalamnya. Institutional trust adalah modal perusahaan,knowledge/pengetahuanadalah para jamaah ‘basah’ oleh persoalan ini. apa yang orang rasakan, lihat dan dengar ke permukaan mulai dari KPK, Kepolisian, dorongan dan kepedulian tersebut setiap yang signifikan bagi pertumbuhan sebuah sumberdayayangsangatpentingdandengan Memang luar biasa si Cicak dan Buaya ini. tentang kita itulah yang menjadi bahan bakar Kejaksaan dan terakhir kasus Anggodo. anggota organisasi juga akan memiliki trust perusahaan, serta menciptakan keunggulan demikian perlu strategi untuk Rupanya sudah sejak lama mereka memba- bagi terbentuknya citra diri kita. Kesan itu Penegakan hukum yang dinilai masyarakat untuk saling sharing pengetahuan dan daya saing perusahaan di pasar. mengumpulkan, mengatur dan yang-bayangi hidup kita. Coba tengok lagi terpendam dalam benak orang, sampai tidak wajar menimbulkan distrust yang memiliki keyakinan bahwa setiap kebijakan mengolahnyasehinggadapatbergunasecara dinding rumah Anda, para Cicak itu sudah muncul peristiwa pencetusnya. selama ini sudah terbagun dengan baik. Para yang diberikan oleh manajemen akan Membangun Trust kontiniu bagi organisasi atau perusahaan. menjadikannya tempat perlintasan sejak lama. Maka ketika mantan Kabareskrim Susno pengamat memperkirakan menurunnya dijalankan dengan adil sehingga tidak Dalam bukunya “The Trusted Leader” Proses pengumpulan knowledge dalam Sama seperti buaya, dia ternyata sudah lama Duadji menyatakan sebagai buaya, maka serta trust dapat berakibat para investor menghambatsetiapanggotaorganisasiuntuk Robert Galford menyatakan bahwa seorang organisasi atau perusahaan dapat diawali melingkar di pinggang, di pergelangan tangan, merta kesan dalam benak publik itu naik ke mengurangi kegiatan usahanya. Ilustrasi berkembang secara optimal. pemimpin dalam proses membangun trust dengan sharing dan interaksi yang di dompet dan tas istri dan anak gadis Anda. permukaan. Saat itu juga upaya perbaikan citra diatas menunjukkan bahwa betapa harus memiliki kredibilitas, sifat reliabilitas berkelanjutan antar anggota/karyawan yang MakaketikaCicak-Buayaberkelahi,jangan yang telah dilakukan sejak lama, mengalami pentingnya membangun trust di dalam Riset terdahulu dan kedekatan dengan setiap karyawan atau ada dalam organisasi atau perusahaan heran jika kita terlibat di dalamnya. Ceritanya set-back. Apalagi di tengah masyarakat masih negara,organisasi,perusahaanbahkandalam Nonaka (1991) menjumpai bahwa trust anggotaorganisasi.Kredibilitasberhubungan tersebut sedangkan dalam proses sharing diawali saat Cicak yang nakalan menggoda merasakan pengalaman tidak menyenangkan kelompok kecil di keluarga. merupakan prasyarat bagi best practice dengan kekonsistenan terhadap kebijakan, dan interaksi tersebut diperlukan trust Buaya, mau coba menjeratnya. Kontan saja ketika berurusan dengan hukum. Seperti saat Dalam penelusuran sejarah kisah sukses sharing, terutama bila kolaborasi dalam komunikasi yang baik dan kompetensi yang sehingga hasilnya optimal. Buaya jadi marah, lha wong Cicak yang cuma rumah seorang warga kemalingan, bukannya pembangunan ekonomi negara-negara di transfer knowledge mengandungtacitknowl- dimiliki oleh pemimpin, reliabilitas berkaitan se-upilitu kok ya berani-beraninya ngelawan. pengaduannya ditanggai serius dengan men- dunia, Fukuyama (1996) menemukan trust edge yang rumit. Namun penelitian Barney dengankemauannyauntukdapatdiandalkan Kesimpulan dan Saran Ikrarperangpundikumandangkanke-seantero cari dan menangkap malingnya, tapi malah merupakanfaktorkuncibagisuksesekonomi. dan Hansen (1994) memberi spesifikasi oleh anggota organisasi atau perusahaan dan Trust diperlukan dalam setiap aktivitas jagat nusantara. Geger. dia yang harus keluar biaya yang lumayan Mati hidupnya perusahaan bergantung pada tentang peranan trust dalam kolaborasi, serta terakhir seorang pemimpin harus memiliki baik dalam scope yang luas seperti negara Sang Buaya beraksi, Cicak pun dijerat, banyak untuk bayar ini-itu. trustanggota. Sebaliknya tanpa trustmuncul mengklasifikasikantrust dalam tiga tipe : 1) kedekatan dengan karyawan atau anggota maupun scope yang lebih kecil seperti masuk dalam cengkraman, selangkah lagi berbagai bencana bagi masyarakat atau Weakformtrustterdapatpadakolaborasiyang organisasi lainnya, seorang pemimpin harus perusahaan bahkan pada tingkat yang sangat mau ditelan. Ekornya pun terputus dari tu- *** perusahaan. Coleman (1990) menamakan bersifat terbatas sehingga peluang peka dan lebih banyak memberikan pujian kecil misalnya keluarga. Trust membuat buhnya, menggeliat-geliat, tapi yang ini ma- Kenyataannya, masalah korupsi dan citra trust sebagai social capital. Trust oportunistik cukup kecil, tak terkait dengan atau penghargaan daripada kritik kepada segalanya menjadi mudah, termasuk dalam sih mungkin disambung. Kasihan, kemu- aparat hukum telah menjadi presence of an memungkinkan banyak hal termasuk sumberdaya penting dalam perusahaan; 2) bawahannya. Robert Galford juga knowledge sharing. Pemimpin perlu dian penonton pun ikut bereaksi, ramai- issue atau sebuah isu tempat berkumpulnya mendorong terjadinya share of values Semi-strong form trust terdapat pada menyatakan bahwa seorang pemimpin yang membangun dan memelihara trustdalam ramai bersorak huuuu.... Kecaman dan caci pendapat umum. Di sana tergambar suatu .Demikian halnya di organisasi dan kolaborasi dalam konteks pengembangan dipercaya memang tidak dapat selalu organisasi atau perusahaan. Oleh karena itu maki semakin membesar hampir tak ter- sikap bersama (collective attitude) dan suasana perusahaan. Trust sangat diperlukan untuk sumberdaya bernilai dan didukung oleh memenuhi semua keinginan bawahannya bagun dan peliharalah trustyang sudah ada, bendung. Pertandingan diang-gap tidak adil, hati masyarakat (public mood). Machiavelli mendorong timbulnya kerjasama. Trust peraturan dan kontrol untuk mengurangi namun seorang pemimpin yang dapat jangan sampai ambruk karena trust yang tidak fair. Sang wasit yang katanya netral sudah sejak lama sudah mengingatkan, ’orang membuat segalanya menjadi lancar dan niat oportunistik; dan 3) Strong form trust dipercaya selalu dapat menunjukkan rasa sudah ambruk akan lebih susah untuk itu, kemudian mengambil keputusan de- yangbijaksanatidakakanmengabaikanpublic urusanmenjadisederhana.Jikadihubungkan terdapat pada kolaborasi pada sumberdaya peka dan peduli terhadap bawahannya. dibangun kembali. ngan ‘melahirkan’ sosok lain dalam pertan- opinion (pendapat umum)...’ denganknowledge sharing makatrustsangat yang berharga, tanpa kebijakan, namun dingan itu. Serta merta muncullah Corcodile Sedemikian digjayanya mahluk bernama memegang peranan penting untuk diharapkan berpedoman pada nilai-nilai dan Trust dan Knowledge Sharing 1) General Manager PT. PLN (Persero) Wilayah Dundee, delapan pendekar pemburu buaya. public opinion itu, sehingga tidak ada cara lain kelancaran proses sharing. Hal ini yang prinsip manajemen yang menguntungkan Dengan tumbuhnya trust dalam Sumatera Utara di – Medan dan Staf Pengajar (Anda masih ingat toh sequel film ini) yang lebih baik bagi Buaya selain meme- menjadi pertanyaan :“Bagaimana mungkin semua pihak. Hasil penelitian Barney dan organisasimakasetiapkaryawanatauanggota Program Magister Teknologi & Bisnis Kelistrikan Maka sejak itu, mulai-lah Buaya mendapat nangkan wacana publik. Publictrust. Kesim- parakaryawanatauanggotaorganisasidapat Hansen (1994) menemukan bahwa semi- organisasi dapat merasa lebih terbuka dan pada Sekolah Tinggi Elektro & Informatika (STEI – perlawananseimbang,bahkantersudut.Ketika pulan ini sepertinya sudah mulai disadari, saling bersinergi atau sharing jika tidak strong form trust berperan signifikan sebagai bebasuntuksalingsharingpengetahuan,tidak ITB). orang yang pertama kali mengikrarkan diri hanya saja caranya masih sangat tradisional, dilandasi dengan trust ?”. sumber keunggulan perusahaan. Temuan ada lagi yang merasa bahwa pengetahuan 2) Staff PT PLN (Persero) Wilayah Sumut. sebagaiBuayaitubersumpahatasnamaTuhan pakai ‘air mata buaya’. sambil menangis. Banyak penonton yang lan- Padahal ini adalah momen anti klimaks tas terkesima, tapi banyak juga yang enteng bagi citra buruk penegak hukum, sebuah bagaimana terhadap anak-anak. Apalagi kita sudah tua, uzur, tidak ada gaji pensiun berkomentar, ahh.., air mata buaya. kesempatan emas. Mumpung perhatian dan penghasilan dari mana-mana. Kalau bisa setelah anak itu mendapat penghasilan, publik masih tersedot deras, termasuk oleh jangan jauh-jauh darinya, karena butuh perhatian/bantuan dari anak-anaknya. *** aparat hukum di tingkat bawah; inilah sa- Bapak dulu mandiri, sampai menjadi orang seperti ini”. “E,e Bapak kok lupa, embah Sesungguhnya suatu gerakan yang me- atnya menunjukkan bahwa benar-benar telah dulu kan pejabat, orang yang berpengaruh dan orang yang berjasa”?. “Astagfirullah, Bapak massa,sporadis,tidaklahpernahmunculsecara terjadi reformasi di tubuh institusi, bahwa ada lupa Jack”. instan. Akan selalu ada peristiwa pencitraan yang mendahului. Itu juga terjadi ketika aksi niat yang benar-benar tulus dari dasar hati, bukanhanyaretorikatapiperbaikanyangnyata. Mandiri, Mandirilah Pak “Bapak dulu mandiri sampe menjadi orang seperti ini embah mu kehidupannya susah, E,e, kok lulus, kata seorang Bapak kepada si Musa anaknya. mahasiswa tahun 1998 telah melengserkan Hukumlah dengan tegas siapa yang harus Mandiri yang kira-kira maknanya egois, tidak perlu, tidak butuh, tidak perlu dibantu, Inilah contoh liku-liku kehidupan manusia dimuka bumi ini, bumi Indonesia tercinta. kekuasaanSoehartoyangsangatkuatitu.Ketika dihukum, nanti nalar publik akan mencerna- sama dengan berdikari. Berdiri diatas kaki sendiri. Makanya kita selalu belajar tentang pola-pola kehidupan masyarakat kita dari berbagai aspirasi itu tak terbendung lagi dan bayang- nya. Sekaligus menjadi shock therapy bahkan Bisa-bisa juga sebentar, berangsur lemas, letoy, kemudian ambruk. Banyak orang, entah aspek-aspeknya, dari buku-buku atau dari wong-wong tua, tua usia. Tua pengalaman, bayang kerusakan besar semakin kuat meng- bagi aparat hukum di tingkat bawah untuk karena faktor apa, selalu mengajarkan tentang mandiri, baik terhadap keluarganya maupun banyak mengecap asam garam kehidupan, didunia yang fana ini. hantui. tidak lagi ’macam’macam’. terhadap orang lain, “Biarkan saja, mau bagaimana, bagaimana”. Allah SWT lah yang Maha Besar, Maha Tahu, Maha Kuasa, Maha Pengasih lagi Maha Meskipun, katanya, ada tangan-tangan Butuh pengorbanan memang, namun Dari satu sisi bisa-bisa diterima, yaitu bagi orang-orang yang telah berhasil dan sudah penyayang, serta Maha Bijaksana. tak terlihat yang mengkondisikan aksi maha- kalau tidak, saya khawatir, Crocodile sDundee merasa sukses didalam karir dan kehidupannya. Bagi orang lain dari segala eselon masyarakat Kalau kita hambaNya? Tidak luput dari lupa diri, dusta, dan lain-lain sebagainya. siswa itu, toh tetap mustahil jika tanpa persepsi yang akan memangsa. Kalau sudah begini yang masih menjalan pola kehidupan, bagaimana taktik? Habis bulan suci Ramadhan, kambuh lagi. negatif dalam benak mayoritas bangsa Indo- tujuan pencitraan itu masih harus menunggu “Saya dulu mandiri, tidak ada yang dibantu, dilepas saja oleh orang tua”. nesia saat itu. Persepsi negatif yang dilahirkan momentum yang belum tentu ada dalam Bisa-bisa saja mungkin orang tuanya dulu kurang perhatian terhadap keluarganya, Nursaibah. S olehcitranegatifitu-lahenergiyangmenggerak- kurun seratus tahun. kebetulan setelah berkeluarga dia tidak dikaruniain anak-anak pula. Tidak bisa merasakan Medan
    • 14 Senin, 9 November 2009 WASPADA HARGA BELUM TERMASUK FAX.4561347 Khusus Medan Deli, Marelan, Labuhan, Belawan 1 CM Rp. 12.000 3 CM Rp. 36.000 5 CM Rp. 65.000 7 CM Rp. 91.000 9 CM Rp. 126.000 11 CM Rp. 165.000 IKLAN KHUSUS 2 CM Rp. 24.000 4 CM Rp. 48.000 6 CM Rp. 78.000 8 CM Rp. 104.000 10 CM Rp. 140.000 12 CM Rp. 180.000 6x1,5 kolom Rp. 120.000 PPN 10% Hub. 0812 6390 660 Iklan Anda Dijemput Bursa MERCY Boxer E 200 Thn. 87/88, TOYOTA Avanza Thn. 2004. Type G. Silver metalic. Jok kulit, Bursa BUTUH DANA CEPAT !!! DAN CEPA ANA Bursa Bursa Service AUTOMOTIVE Mdl MP. EL Sun Roof. Silver. BK Ex RENTAL MOBIL Khusus Untuk Nasabah SERVICE/ASESORIS MOBIL ELEKTRONIK ELEKTRONIK Informasi Pembaca Mutasi Rp. 37Jt. Hub. 77863981 tape, VCD, AC DB, PS. Asuransi Macat Dari Bank IKHLAS RENT CAR Bursa Automotive all risk. Harga Rp. 116Jt. Nego. Proses Cepat & Gampang JUAL-BELI PS 1, 2, 3 TV, Keyboard, Mixer, Power, SERVIS SERVIS CUCI AC, ISI FREON, BONGKAR PASANG. MERCY BOXER 88 (200) Hub. 0813 7562 7898 Innova Avanza 300Rb 275Rb Pinjaman Max 1/2 Miliar ‘MULIA JAYA’ Laptop, LCD Projector, Handycam, Camera, Kulkas, REPARASI, KULKAS, MESIN CUCI AC BR CL ND DB : Air Condition : Ban Radial : Central Lock : Nippon Denso : Double Blower PS PW RT VR EW : Power Stearing : Power Window : Radio Tape : Velg Racing : Electric Window BK Asli Medan, warna putih. Kondisi mulus sekali (original). Hub. 061-9114 5520 TOYOTA SE Salon Thn. 86. W. Hitam, Termasuk Supir non BBM. 061-913 123 08 - 0852 6118 2406 RENTAL MOBIL Hub.: Susan 081-397-065-678 POWER M. Cuci, Tape compo, LCD, dll Hub. MARKET ELECTRONIC Telp. 821.0097 - 6690.0693 Jl. Setia Budi No. 424 B dekat Simp. Ring Road AC Hub. DIFA SERVIS 0813 9735 7061 061-69644786 mulus. H. 28Jt. Hub. Jl. Aluminium II No. STEERING AC, KULKAS, M. CUCI, P. CLINER, GENSET AHLI TOSHIBA, SONY, POLYTRON, SHARP, BMW 5201 Hitam 92/93. Mdn asli. MAZDA VANTREND 94 11 Tg. Mulia. HP. 0812 600 77054 1 hari Rp. 250.000. 1 Jam Rp. 25.000 / Max 4 Jam. DANA CEPAT AC, 1 Pk, 1,5 Pk, 2 Pk=1,3Jt s/d =1,9Jt. KHUSUS LG SAMSUNG, SANYO, DIGITEC, FUJI, JVC, TV CHINA, DLL. SIAP DITEMPAT Lengkap, TV, Audio. Sudah Modifikasi Mewah keren. Mulus. Buktikan H. 40Jt. BU. 0812 602 5621 BK 1020 DQ, Warna merah. Kondisi mulus. Hub. 061-68784368 TOYOTA Kijang Diesel. Pick Diantar ke Rumah Konsumen. HP. 061-664 77734 / 0813 9779 1077 Jaminan BPKB Semua Tahun. Proses Cepat, Syarat Ringan. - Ganti Oli - Pasang Power Steering AC Air Cooler= 975rb. Kulkas 1 Pt=450rb s/d =900rb, 2pt=650rb s/d=1,3Jt, K. Mini TV TV & BERGARANSI RIDWAN 77621674, 0812 6303 4400 Up Th. 2001. W. Hitam BU. ALAT PELACAK KENDARAAN = 500rb. K. 2 Pt. Jumbo= 2 jt. M. Cuci, - Service Power Steering TV TOSHIBA 77091118 SONY, SAMSUNG, LG, 2tb=600rb, 1tb=900rb s/d =1,4jt. P. Cliner SANYO, TV CHINA, dll DAIHATSU Taruna CSX 99 W. Biru met, Mobil MITSUBISHI L300 Sparta ‘06. W. Biru met. Hub. Flexi (061) 77756099 With GPS Tracking System Hub. (061) 77052032 - Jln. Sisingamangaraja No. 5 A.B. = 1,2Jt, Genset, 9000w, 7500W, Hub. HARIS spt baru H. 84 Jt Nego. Ban Besar. Daihatsu VR, Ban Baru. Mobil cantik, BK Panjang. Dengan iTrack anda setiap saat dapat mengetahui 1200W=950rb s/d=6000jt. Rocky 4x4 ‘92. W. Hitam. Mulus, siap pakai. TOYOTA Kijang LGX Diesel Thn. ‘99. 0815 3476 7327 Medan TV, PS, DVD, Handicam, Camera, RUSAK Siap di Tempat Bergaransi 0812 6311011 H. 64Jt/Nego. Hub. 061-3031 3617 H. 110Jt/Nego. Hub. 0813 7021 0595 BK Medan asli, mobil mulus, ada TV, * Keberadaan Mobil anda * Laju Kecepatan Mobil Proyejtor, Laptop, Fax. Keyboard jarang pakai, AC Dingin. Hrg. Nego. * Rute Perjalanan * Berbagai Aktifitas Lainnya ANDA BUTUH DANA TUNAI? Telp. (061) 7369224 TV, LCD, 42” Samsung=7,5Jt - 53” LCD Proyejtion. Sony=7,5Jt, 34” Sony=2,5Jt. 32” M. Bishi=2Jt - 29” AHLI TO S H I BA , S O N Y, P O LY T RO N, MITSUBISHI BARU S A M S U N G , S H A R P, S A N YO , DAIHATSU Espass Minibus Thn. 1996. Silver Jaminan BPKB Spd. Motor, mobil Bunga (061) 7344954 Hub. 0812 6096 3457 - 061 77036152 TV Baru / Bekas= 900rb s/d 2,3Jt 14/21 300rb s/d =975rb. SANKEN, FUJI, DIGITEC, LG, JVC, Rooling Soor Rp. 33Jt. Mbl sangat cantik. Bawa Pulang L300 Angs. 3Jt-an. T 120 ss, Colt 110, 125 PS, Pajero Sport, L200,... Hub. Kami: ITrack Medan ringan, data dijmpt. BPKB Aman. Hub. DVD=260rb, TV DVD, Vortable = 1,2jt, PS 1=400rb, TV CHINA, DLL. Murah, Full Garansi Serius Hub. (061) 76728071 / 0812 653 3319 # TOYOTA 100% BARU # BAR ARU Komp. Asia Mega Mas Blok LL No. 32 061-6647 7734 / 0813 9779 1077 (TP) PS2=1 Jt, Handicam/Camera=500rb, s/d 2,3, SIGIT. 76547004 - 0812 6067 7344 BK Panjang. Peminat Hub. 0813 6212 2339 Ready: Innova, Fortuner, Rush, Yaris, Vios, Altis, Hilux, D. Cabin (Pick Up Telp. 0813 6075 0388 - 7321 726 - 77872232 Bursa Proyejtor Epson=4Jt. Laptop Dual Core =3,5Jt- Ampli, Spk, Power, Yamaha, Peavey, BMB, KN-7000, dll SUZUKI Carry Minibus Thn. 1996. Bunga 0%) Tukar Tambah...Oke !!! Kunjungi Situs kami: iTrack.iqios.com ANDA BUTUH DANA KOMPUTER Hub. Senang Hati: 4577146 - 7707 3637. MAJU TEKNIK DAIHATSU Espass Pick Up Thn. 2004. Hub. 0812 655 6962 / 061 77958206 Jaminan Apa Saja, Sertifikat Tanah. Jl. Sekip 67 A (Jual/Beli/T.T Baru/Bekas) AC Warna merah lengkap, nama langsung. 7030118 Proses Cepat, Syarat Mudah. Hub. W. Hitam. Mobil original. Mesin sehat sekali. Jl. Singgah mata HP. 0813 9712 7771 Bursa 061-8222774, HP 0816 314 1807 . 76750084 TOYOTA Corona GL Thn. 85. AC, Tape, RYAN TONER Pajak baru, Ban Baru. Hub. 77774326 V. Racing, W. Biru metalik. Kondisi mulus, BUTUH UANG Bursa KULKAS, M. CUCI DISPENSER (BERGARANSI) SUZUKI Carry Minibus Thn. 88 Karoseri DIBELI CATRIDGE : CANON, HP KOMUNIKASI MINI & EFEKTIF DAIHATSU Taft 93Dijual Alexander warna biru, BK Mdn, Jl. Bukit BK 2 Angka. Hub. 0819 2175 890 CANON 40, 41, 830, 831. HP 21, 22, AC/TP. W. Hitam. BUTUH DANA TUNAI BUNGA RENDAH 60B, 60C, 27, 28, 56, 57 Bursa Siguntang 32. HP. 0813 6179 0291 TOYOTA Kijang Capsul LSX Solar Model LGX 1 - 2 %, 1 Jam Cair. Jaminan, SHM, SK Laserjet. HP 12A, HP 36A, HP 35A, dll. Hub. 0852 7590 9601 Thn. 99 a/n. Sendiri, Orisinil sekali, Full Acesories, Baru / Bekas Dengan Harga Tinggi BUSANA / AKSESORIS SUZUKI Escudo 2.0 Thn. 2004 VR, BR, PS, PW, CL, Remot, DVD JVC, AC Dingin, Camat, BPKB Mobil, Truk, Kreta dan Juga Hub. 061-76699002 / 0878 682 44474 DAIHATSU Xenia Li Thn. 2006 VVTi. Coklat met, original. Plat BH (Jambi) Hrg. 104Jt Nego. Hub. 0813 7644 7297 mobil yang masih kredit. Over Leasing IKLANKAN PECI MAHKOTA Lengkap, warna hitam, nama sendiri. Jl. Rp. 122 Jt. Hub. 0816 3113 953 dan Bantu Pelunasan BPKB. Hub. (061) Bukit Siguntang 31. HP. 0812 630 1881 TOYOTA Super Kijang G, SSX G Thn. 95. W. Abu2 met. BK Asli Medan, 8445716, 0813 7044 6633 (Heny) PRODUK ANDA MENJUAL PECI TEMPAHAN Berbagai Model Dan Warna SUZUKI Carry Alexander Thn. 86 Mulus sangat mulus. Lengkap dan Terawat. Jl. Prof. H.M. Yamin SH. No. 340 / Jl. Serdang “DAIHATSU PAKET NOVEMBER MURAH” sekali luar dalam. Mesin sehat, terawat. Xenia DP 20Jt-an atau Angs. 3 Jt-an Sudah lengkap. Hrg. 17,5 Nego. Hub. 061-9135 6484 Hub. Jl. Peringgan Gg. Perjuangan IV Helvetia HP. 0812 6060 6959 WASPADA xpress Depan Gg. Sadu Medan Terios DP 27Jt-an atau Angs. 4 Jt-an sudah lengkap. Pick Up DP 7 Jt-an atau Ang. 2 Jt-an + Hadiah Info Hub. Astra Daihatsu 0813 6177 3589 / 77943677 “DAIHATSU PAKET MURAH” SUZUKI Carry Minibus 1985, W. biru, cat mulus, jok oke, Velac Racing belimbing, kondisi mobil BURUAN STOCK TERBATAS - Kijang LSX EFI, Biru THN DP ANGS - Kijang LGX Htm, Diesel, BK Mut, Ban Maxxis ‘01 35 Jt 3,6 Jt ‘01 25 Jt 3,2 Jt - Cherokee 4x4 M/T Biru, BR 31, Velg asli ‘95 20 Jt 2,2 Jt - Zebra Espas 1.6 Maroon Met, VS, BR ‘96 14 Jt 1 Jt PECI MURNI TEMPAHAN ISTIMEWA Gran Max Pick Up DP 7 Jt’an Angs. 2 Jt-an sehat (bersih). Hub. Acuan - Zebra Master Pick Up, Bak 3 Way Hitam ‘04 55 Jt Nego H. ADAM AKIL HSB - Isuzu Panther Touring, Hitam, Mulus ‘01 125 Jt Nego Gran Max Minibus DP 16 Jt-an Angs 3 Jt-an Jl. Kirana 17 - 77159251 - - Isuzu Panther Pick Up 2.4 ‘04 75 Jt Nego Jl. Setia Budi No. 49 A 8223975 Luxio D M/T DP 7 Jt’an Angs. 4 Jt-an 0811 635101 Bisa T. Tambah. - Land Cruiser VX Turbo Diesel, 4x4, Mulus ‘96 60 Jt 8 Jt Xenia 1.0 DLX DP 10Jt An. Angs. 3 Jt-an - Mercy E230, New eyes, Hitam ‘96 47 Jt 3,4 Terios TX TS X’Tra M/T DP 23 Jt’An Angs 4 Jt’an Sirion D M/T DP 20 J’an Angs. 4 Jt’an * TOYOTA TERBARU * Hub. SM. Raja 368 Simp. Limun 0812.6336.6155 / 0813.7588.7306 Bursa Hi-Lux PU DP 17 Jt-an. Bawa Plg... PERCETAKAN Hub. WINDI HP. 0812 6078 052 Flexi 061 (77402067) Innova Rush, Yaris, Fortuner, Ready Stock. Bunga Ringan. Hub. 061-77875227 Bursa atau 0815 304 2382 ALAT BERAT HONDA Civic Thn. 76. W. Hijau, AC, Tape, VR, BR, Ex Mutasi. Hrg. 10Juta. BAR ARU *** TOYOTA 100% BARU *** Hub. Jl. Aluminium II No. 11 Tg. Mulia. READY: Innova, Yaris, Fortuner, Vios, Rush, dll. Info Lengkap. Hub. 0813 DIJUAL CEPAT HP. 0812 600 77 054 70200318 / (061) 7672 3521 Cash - Credit. 3521. 3 Unit Mobil Derek Kepala. Bantu Jual Mobil Lama Anda. Mercedes LP 911/42. Hub. 061- HONDA City 1.3 Thn. 96. Hijau met, TOYOTA Kijang Grand Extra 7345408 atau 0813 6179 9453 BK Mdn. BBN a/n. Pembeli Rp. 58Jt. Thn. 96 W. Abu2 gelap, AC DB, PW, Hub. 0813 9655 7102 Hrg. 74 Juta Hub. 0813 70135 779 TRUK King Kong Roda Enam Mitsubishi. Truk King Kong Tronton KIA Picanto Sporty M/T Thn. 2005. Biru met. BK Mdn asli Rp. 91 Jt. TOYOTA 100% BARU AVANZA, RUSH, INNOVA, FORTUNER, YARIS, Roda Sepuluh Mitsubishi Hub. HP: 0878 6859 5855 CATUR RELOAD CATUR RELO VIOS, ALTIS, CAMRY Hub. 0813 7512 Hub. 0812 6594 2789 7297 - (061) 7795 1428 0812 6076 727 1 Chips All Operator Murah & Lengkap. Transaksi 24 Jam. Free Registrasi Min. Deposit 100 RB Dicari Master / RS Hub. (061) 7877531 Johor Katelia Indah No. 194 Medan Ingin Promosikan Produk Anda Harian WASPADA Media yang Tepat untuk Iklan Anda FD CD KIRIMKAN... DATA IKLAN ANDA DALAM BENTUK DP lai mu 20 Jt-an* DIGITAL Keterangan lebih KHUSUS BULAN INI SAJA lengkap silahkan hubungi: TELPON : 061 - 4576602 FAX : 061 - 4561347 * Format: JPG - TIFF (Photoshop)
    • WASPADA Senin 9 November 2009 Agenda 15 07.30 Kuis Siapa 07.30 Musik Inbox 07.00 Tom & 07.00 Pororo The 07.00 I Love You 07.05 Indonesia 07.30 Musik 09.00 Kabar 9 07.00 Kartun Avatar 07.30 I Gosip Lebih Berani 09.30 Halo Jerry Little Penguin Full This Morning Dering 09.30 Kabar 08.00 Inuyasha 08.00 Selamat 09.00 Musik : Selebriti 09.00 Layar 07.30 Star Kids Indone- 07.30 Metro Xin 09.00 Sketsa Pasar 09.00 Movie Pagi Dahsyat 10.00 Sinema Pagi Pagi 08.30 Espresso sia Wen 09.30 D’Show 10.00 Pariwara Animasi 09.00 Dorce 11.00 Silet 12.00 Liputan 6 10.30 Ala’mak 10.00 Heboh 09.30 FTV 08.05 Healthy Life 11.00 Insert 13.00 Kabar 10.30 Genie 10.00 Dengarlah 12.00 Seputar Siang 11.00 Sidik 11.30 Topik Siang Drama 09.05 Expedition 12.00 Reportase Keadilan 11.00 Dapur Aisyah Aku Indonesia 12.30 Sinema 12.30 Layar 12.00 Musik Klik 11.30 Patroli 10.05 The Inter- Siang 13.30 Expose 11.30 Resto Sedap 10.30 Musik 60 12.30 Sergap Siang Kemilau 13.30 Wacky 12.00 Fokus view 12.30 Missing 14.00 Kamus 12.00 Abdel & Minutes 13.00 Sinema Siang 14.30 Status 13.30 1001 Races Siang 11.05 Ceritarasa Lyrics Kuliner Temon 11.30 Redaksi 15.00 Kabar Kabari Selebriti Cerita 14.30 Panji Sang 12.30 Happy William 13.30 Bioskop 13.00 Global Siang Siang 15.00 Kabar 15 15.30 Mata Mata 15.00 Playlist 14.30 Go Show Penakluk Siang 11.30 Indonesia 14.30 Masalah Kota 12.00 I Gosip 15.30 Kabar 16.00 Minta Tolong 16.00 Kepompong 15.00 Upin & 15.00 Djarum 14.30 KiSS Megapolitan 15.30 Makna Masalah Kita Siang Super Indonesia Pasar 17.00 Seputar 17.00 Liputan 6 Ipin 15.30 FS Starlit 12.05 Metro Siang Kehidupan 15.00 Garasi 13.00 Laptop Si League 16.00 Mata Indonesia Petang 16.00 Classic 17.00 Tangisan 13.05 Oasis 16.00 Insert Sore 15.30 Bindi The Unyil 17.30 Rumah 18.30 Uya Emang 17.30 Topik Kamera Cartoon Isabella 15.30 Public 16.30 Orang Jungle 13.30 Jalan Hadiah Kuya 17.00 Ninja Petang 19.00 Di Balik Corner Ketiga Series 17.00 Telusur 16.00 Mata Angin Sesama 18.00 Doa Dan 19.00 Bayu Cinta Warrior 18.00 Mantap Jilbab Zaskia 19.05 Suara Anda 18.00 Suami 17.30 Kabar 18.00 Are You 15.30 Asal Usul Karunia Luna 18.00 Si 19.00 Segeerrr 20.00 Inayah 20.30 Prime Suami Takut Istri Petang Smarter The 5th 16.00 Jejak 19.00 Safa & 20.00 Cinta Fitri Mamat Anak 20.00 Tawa Sutra 22.00 FS : Worlds Interview 19.30 Gong 19.30 Di Balik Grader Petualang Marwah 21.30 Terlanjur Psr Jangkrik 21.30 Movie Within 21.05 Top Nine Show Langit Berita 19.00 Starteen 18.00 Ups Salah 20.30 Cinta Dan Cinta 19.00 Cerita Special 00.00 Gelar News 21.00 Realigi 20.30 Kerah 21.00 Awas Ada 20.00 Opera Van Anugerah 23.00 Gala Sinema Fantasi 23.00 Topik Kita Tinju 21.30 TBA 22.00 Bioskop Putih Sule Java 22.00 Rommy 01.00 Liputan 6 20.00 Star Buzz 00.00 Topik Profesional 22.05 Economic Trans TV 21.00 Apa Kabar 22.00 La Lights 21.00 OKB Rafael Malam 23.00 Sinema Malam 01.00 Fokus Challenge 23.30 Bioskop Indonesia Malam Indiefest 22.00 Bukan Master Hipnotis 01.30 Buser Layar Lebar 00.30 Lensa Malam 23.05 Metro Trans TV 22.30 Jejak Islam 23.00 Global Empat Mata 23.00 Box Office 01.30 Luar Olahraga Malam 01.30 Sinetron Realitas 01.00 Repotase 23.00 Auto Malam 23.30 Dua Dunia Movie Biasa Kasih Dan 23.30 Metro Expert 23.30 Lega Calcio 00.30 Sport 7 01.00 Seputar Amara Sports 23.30 Kabar Serie A Italy Malam Indonesia Arena Catania vs Napoli CATATAN Jadwal acara TV di atas bisa diubah sewaktu-waktu oleh stasiun TV yang bersangkutan tanpa pemberitahuan **m30/B Bursa DIBUTUHKAN SEGERA RU M A H P e r m a n e n S H M , Bursa Service Bursa PENDIDIKAN Pegawai Toko Handphone (Wanita), Pengalaman diutamakan Lamaran hub. ETC LT. 4 Plz Medan Perumahan di Jl. Balam Medan PERABOT KONSTRUKSI ALAT PENGAMAN KUSUK TRADISIONAL Hub. (061) 7621.1560 KURSUS KOMPUTER CEPAT Fair 5A (dekat Toilet) Up. Bp. Leo SEDOT MOBIL SEDOT : 77737996 & LULUR TEMPAHAN MURAH LPK PAULINE DIBUTUHKAN RUMAH DIJUAL -Lemari pakaian 3 pintu Sungkai asli Rp. 1.500.000 tempahan WC MAJU JAYA : 0852 7093 3649 JA Hub. MBAK DINA - Aplikasi Window XP/ Internet................ 200 Rb (2 minggu) -Kursi Sofa Kulit 3 ,2 1 pakai Spring Rp. 1.300.000 0812.6499.1979 - Komputer Aplikasi Perkantoran Lengkap 350 Rb (1 bulan) CAKE SHOP & CAFE yang sedang Jl. Pancing Komp. IAIN No. 12 Medan, LT. 15,15x29,1 (441m²), LB. 171 (m²), 1½ Hub Telp. (061) 6618116 - 6616802 0819 33 408099: MURAH : GRS. 1 THN. - Autocad 2D/ 3D/ 3D Max......................... 300 Rb (10 hari) berkembang, membutuhkan beberapa Tkt, SHM, 4 KT, 2 KM, Garasi, PLN, PDAM, Bersedia dipanggil ditempat WC 8442271 - SAP/ EBTAB (Tehnik Sipil)....................... 400 Rb (10 hari) Pria/ Wanita utk ditempatkan sbb: Bebas banjir, Maaf khusus muslim - - Merakit Komputer/ Lengkap................... 400 Rb (6 hari) Autocad 2D + 3D + 3D Max/ SAP............. 1,2 Jt (4 bulan) A. ACCOUNTING (WANITA) Hub. 0812.601.7682 SPRING BED DIJUAL MURAH - Desain Grafis Komplit............................. 500 Rb (1 bulan) B. PRAMUNIAGA C. DRIVER (WANITA) (PRIA) Spring Bed 6 kaki 2 lapis Spring Bed 5 kaki 2 lapis Rp. 1.100.000 Rp. 1.075.000 0813 7035 7291 PIJAT LULUR - Kurikulum Standar Nasional (SKNI) Daftar langsung belajar, Waktu Bebas, Tanpa batas usia D. KOKY (PRIA) RUMAH DIJUAL Spring Bed 4 kaki 2 lapis Rp. 1.000.000 Jl. Setia Budi DAN REFLEKSI TUMPAT Jl. Sei Batang Hari Ujung 170 Medan Telp. 844.2158 - 844.2159 E. BARMAN (PRIA) Jl. Amal Luhur Perm. Tata Harmoni Spring Bed 3 kaki 2 lapis Rp. 900.000 Website: www.lkp-pauline.com Dengan syarat: - Bisa membuat Laporan Keuangan (A) - Menguasai Microsoft Office (A) No. 5 Tkt. II, L. 8m, P. 14m Hub. (061) 7760.5667/ (061) 846.9229, Maaf TP Spring Bed 3 kaki Dorong Rp. 1.000.000 Garansi Per 10 tahun Hub. 061-661.8116 - 661.6802 WC TUMPAT, Sal. AIR, K. Mandi TUMPA Tel. 7878078, 77008458 SAVIRA - Memiliki SIM A (C) - Menguasai menu-menu makanan NARO SERVICE Jl. Sisingamangaraja PENGOBATAN ALAT VITAL - Bisa membuat minuman/ juice RUMAH DIJUAL 2 LANTAI Anda Butuh Perabot JL. MANDALA BY PASS SAMPING BRI WC ANDA TUMPAT - SEDOT - Belum Berkeluarga, Bersedia tinggal SHM, IMB, Gas kota, Dkt Karaoke Inul, dkt Ruko ditempat kerja - Tidak sedang kuliah Multatuli baru, di pusat kota dkt Jl. H. Misbah/ Jepara Asli? HUB. 0812.6047.6830 dkt Jl. Teratai di Jl. Melur 13/27 Nego Hub. 8219951 - Berpenampilan menarik - Memiliki loyalitas yg tinggi - Sanggup bekerja di bawah tekanan Hub. 0858.3172.4371 - (061) 414.3742 MALIOBORO PERABOT Jl. Setia Budi No. 2 Lamaran di tulis tangan rapi, diantarkan ke: NEW FRIENDS BAKERY DIJUAL Hubungi: Jl. Bilal No. 90 P. Brayan Medan Bursa Mobil. Sedot Jl. Brayan Medan WC 0812 642 71725 2 PINTU RUKO GANDENG Telephone Toko : 661.6285 PELUANG BISNIS JL. SETIA BUDI NO. 131 SAMP. APOTIK KALIMAS Rumah : 661.1540 Uk. 8,5x19m (SHM) Fax : 661.6285 (061) DIJUAL MURAH PELAMINAN Adat Minang, Mandailing, Melayu, LOWONGAN KERJA depan SPBU Paya Geli Jl. K.L. Yos Sudarso depan SMA Negeri 1 Tebing Tinggi Gebyok Serta Perlengkapannya. Hub. PAK ADI HP. Kami sebuah lembaga yang bergerak Telp. (0621) 24243 0813 96200 801 Sei Mencirim - Kp. Lalang WC dalam bidang pendidikan, Anda bingung utk mengatasi keuangan TUMPAT/ SAL. AIR membutuhkan beberapa untuk Hub. 844.5568 rumah tangga mari segera bergabung 845.8996 ditempatkan pada posisi sbb: 0813.9798.0019 dengan PT. IMOUNE LOYALTY 0812.631.6631 A. SUPIR Soluti terbaik dan pasti saat ini, sila dan Bergaransi/ Setia Luhur 160 F B. OFFICE BOY RUMAH BARU DIJUAL !! datang ke Kantor Jl. SM. Raja No. 4 Bursa HP. (061) 455.9375 Medan PENGOBATAN C. OFFICE GIRL JATI GRAHA MINIMALIS HP. 0813.7098.3877 (Lina) Bursa Persyaratan: JL. JATI - SEI MENCIRIM TRAVEL / WISATA SUDAH KEMANA-MANA? Bursa 1. Pendidikan min. SMU (point A & B) SUNGGAL TYPE 60 DEPOT AIR MINUM Tidak Sembuh? Jangan Putus Asa ! LOWONGAN KERJA 2. Pria umur max. 40 thn (Point A) 3. Minimal memiliki SIM A Umum (point A) SHM, PLN, PAMD UNIT. TERBATAS !!! Kalau mau pasang murah dan bagus MULTAZAM TRAVEL Kelumpuhan / Stroke, Syaraf Terjepit, Pinggang, Pengapuran, Kaki - Tangan, LOWONGAN AYO...BURUAN !!! Dicari Mandor Tukang Batu yang pengalaman 4. Memahami jalan di wilayah Medan Belanja Barangnya Aja Melayani: Lutut Linu & Nyeri, Sulit Jongkok - Bangun. untuk merenovasi bangunan gaji harian (Point A) HUB. (061) 7762.0120 Segala perlengkapan Hub Telp. 456.2350 HP 0813.1864.1501 . Depot isi ulang R.O dan 1. TIKET MURAH: MEDAN - Diabetes, Asam Urat, Dll. 5. Jujur dan bertanggung jawab (061) 6870.4088 Supriyono Jl. Teuku Umar Medan Hexagonal JAKARTA - BATAM - PENANG, (REAKSI LANGSUNG RINGAN) 6. Lamaran lengkap tdd: Pas photo, DIBUTUHKAN WANITA (GADIS/ JANDA) “PANDAN PUTIH” “PAND ANDAN DLL (TIKET DAPAT DIANTAR 1X TERAPI 50.000 (Diluar Obat) Jaga anak, Perawat Gaji Rp. 500 - 1 Jt/ bln (bersih) Hub. “CAHAYA” (061) 7670.0079 HP. 0812.6514.3676 FC, KTP, SIM, Ijazah terakhir, Kartu Keluarga, Riwayat Hidup Kirimkan surat lamaran anda ke Harian RUMAH DIJUAL Hub. 081361 309280/ 77642 832 LANGSUNG KE ALAMAT) 2. UMROH MURAH & HAJI PLUS Hub. SIN SHE SPESIALIS SYARAF & OTOT Jl. Imam Bonjol No. 46 Medan DIJUAL DIBUTUHKAN Ass. Salon yg mahir pks laki² pakai Waspada dengan kode MLK, lamaran paling lama 14 hari setelah iklan terbit Di Jl. Setia Budi Gg. Rambutan Depot Air Minum Isi Ulang di Jl: (KHUSUS) Telp. (061) 415 5432 - 456 0424 Flexi. 7750 6827 Batang Kuis / Tanjung Morawa. 3. MANASIK HAJI klipper n sanggul. GP 500.000 + 20 o/o dr hsl kerja + U. mkn/ hr I No. 20 Tanjung Sari - Medan Depot Full Kaca/Elit. 4 Filter Media MINI & EFEKTIF Salon Modren Jl. Kpt. Muslim 261D + 1 Unit Beca Bermotor. Sisa Hubungi: HP. 0813.6104.9322 Bursa dekat Ringroad dan Kampus Kontrakkan 21 bulan lagi. Dilengkapi Galon : TV, Dispenser TIKET : (061) 456.7532/ 0812.6302.6293 Ingin Promosikan DICARI GURU PROPERTY Untuk Pondok Pesantren, beberapa orang LB. 353m², TT: 35x19m: 665m² IKLANKAN (sudah ada karyawannya) Harga : 55 Juta/Bisa Nego. UMROH & HAJI : (061) 457.6116 - Produk Anda Ust/ Ustzh, Diutamakan yang bisa berbahasa Arab dan Inggris S1/ D3, bagi Informasi Pembaca PRODUK ANDA Hub. (061) 6949 6111 (061) 7731.3385 Harian yg berminat antar surat lamaran ke: Jl. Karya Bakti No. 103 Medan Johor Bursa Property Fas. 3 KT, 1 K. Tamu, 1. R. Keluarga, CARA CARI UANG 0813.6137.2321 / 0812.656.6807 Bursa Dari jam-08.00 s/d 12.00 Wib atau Hub HP. Ustzh Aisya, SE 0813.6267.7766 GR : Garasi KM : Kamar Mandi LB : Luas Bangunan LT : Luas Tanah KP : Kamar Pembantu RM : Ruang Makan KT : Kamar Tidur RT : Ruang Tamu 1 R.TV, Ruang Makan, Dapur, MATERI BANGUNAN PALING MUDAH DAN CEPAT Penghasilan tambah mudah, tanpa ganggu kerja, cocok untuk segala usia, tidak butuh pengalaman. Rahasia WASPADA ADA JOB BID. PENDDK PLAYGROUP/ TK Min. SLTA, Cpt krj, Usia max. 35 thn SHM: Sertifikat Hak Milik Garasi, Telp, PAM, SHM mendapatkan uang banyak. Tapi Praktis. Tidak usah repot, Uang bekerja untuk kita. Bisnis ini Aman. Terpercaya, Halal Media yang Tepat DIJUAL CEPAT TOKO 2 LT dan Legal. Dikelola Management yang baik. Transparant. Hub. Jl. KH. Wahid Hasyim 92 Medan Uk. 4x5m, depan Pajak Hongkong Hub. 0813.1116.6500 Bukan Money Game / MLM Penggandaan Uang! untuk Iklan Anda K. Simpang, Harga 60 Jt/nego Modal Rp. 230 Ribu, Hasil perhari bisa Rp. 250.000,- Tp. 4533.875 - 456.9269 Jl. Karya Wisata Hub. 0813.6290.8097 Potensi penghasilan perminggu Rp. 1.750.000,- No. 23 A Johor Tp. 786.1690 Medan RUMAH Dijual Jl. Eka Warni KUD No. 88 Gedung Johor Mdn, Tanah 0813.9641.0800 - 0812.1006.785 Modal Rp. 430 Ribu. Hasil Perhari Bisa Rp. 500.000,- Potensi penghasilan perminggu Rp. 3.500.000,- “H. MOHD. RAWAL” 7,5x25m²,KT 5, KM 2, Keramik 8 Gipsum, Gerasi mobil, Harga 350 Jt/ Modal Rp. 1.500.000,- Hasil perhari Bisa Rp. 1 Juta FD SPECIALIST AMBEYENT TANPA OPERASI Potensi penghasilan perminggu diatas Rp. 10 Juta DIBUTUHKAN SEGERA nego Hub. 0813.7694.9191 TANAH Terbukti Nyata ! Akan dibimbing dan dibantu. PUTUS SAMPAI KE AKAR2NYA DIJAMIN Kami, sebuah industri, PMA, membutuhkan Informasi Hub: 77136099 / 0812 6392 2299 TDK SEMBUH UANG KEMBALI GARANSI tenaga kerja trampil, sehat dan punya motivasi RUMAH/ Tanah dijual cepat, Type 36 DIJUAL CEPAT CD Ciri2 Ambeyen: Disekeliling Dubur Ada kerja yang tinggi untuk ditempatkan sebagai: Batako, Listrik, SHM, Luas 309m², Sebidang Tanah di Jl. Haji Miskin No. 18 Kisaran Bursa Benjolan Seperti Daging Tumbuh/Jerawat, A. Translator Bhs. Jepang (TBJ) 42 Jt/nego Hub. 0813.6231.0330 Uk. 10x25m Hub. 0813.7079.9888 PERKEBUNAN Gatal, B.A.B Keras, Keluar Darah Segar. B. Production Controller (PRC) C. General Affairs Staff (GAS) RUMAH DIJUAL CEPAT (B.U) DIJUAL BERJENIS BONSAI/ POHON KIRIMKAN... Susah Duduk Seperti Ada Yang Mengganjal. Duduk Serba Salah. Nyeri (Ngilu). Dubur TANAH DIJUAL DAN RUMAH SERUT ELEMEN TAMAN/ BATU SUSEKI: Seperti Luka, Solusinya Datang dan D. Karyawan Produksi (KRP) Persyaratan: Dekat Brayan CENTER (SHM) P. 51, L. 12 Jl. Bambu No. 50, Bisa untuk Ta n a h : 4 4 5 m ² , B a n g u n a n 2 1 5 m ² , 1. 2. LOHAN SIUNG DAUN BULAT MIRTEN DATA IKLAN ANDA Berobatlah ke “H. MHD. RAWAL” Jl. HM. Joni No. 32/ Jl. Aman No. 4 (Letter L) 1. Pria/ wanita, usia 22 - 30 tahun (A, B dan C) dan 20 - 25 tahun (D) buat Rumah Kontrakkan Pekarangannya luas Pasar Merah, Teladan Timur 3. 4. ANTING2 PUTRI KELINGKIT DALAM BENTUK PUSAT: Jl. Prof. H.M. Yamin S.H (Serdang) No. 251 A DIGITAL 2. Pendidikan minimal D3 B. Jepang (A), D3 Hub. 0852.9700.1251 Hub. (061) 457.2160 HP. 0852.7160.1070 5.CENDRAWASIH Simpang Pahlawan Tel.(061) 4563067 semua jurusan (B & C), SLTA/ sederajat (D) SHM, Tanpa perantara 6.CERRY Cabang I Jl. Bunga Harum (Benteng) No. 26 Suka 3. Menguasai MS Windows, terutama Word dan 7.HOKKIAN TEH DAUN HALUS Jadi belakang Brimob Pekan Baru Microsoft Excel (A, B & C) U. MUSLIM 8.ANTING2 PUTRI PARIGATA BUNGA DOBEL Keterangan lebih Telp. (0761) 45368 HP. 0812.656.8700 Cabang II: 4. Dapat berbahasa Jepang, lisan & tulisan (A) Tanah Uk. 7,5x28m (Notaris), Rp. 500 Rb/ POHON2 TSB DIATAS ADA BONSAI JADI meter Jl. T. Bongkar (antara Rel & T. Lapang) DAN BAHANNYA lengkap silahkan Jl. Jend. A. Yani No. 105 Telp. (0641) 22457 HP. 0852.262010594 5. Dapat berbahasa Inggris, lisan & tulisan (C) 6. Mampu menjaga kerahasiaan tugas Mandala samp. Mesjid Silaturahim HUB. BPK. EDDIE JL. KARYA 192 KOMP. hubungi: Langsa: 0852 6201 0594 PEMDA SEI AGUL DEKAT TOKO ROTI MA- SPECIALIST MATA TANPA OPERASI HP. 0852.7636.3891 - (061) 6963.6190 7. Berdomisili di kota Medan Siapkan lamaran anda dan lengkapi dengan JESTIC NO HP. 0813.7002.5788/ 661.7461 TELPON : 061 - 4576602 Dapat disembuhkan sampai tuntas Segala jenis mata seperti mata: - Katarak, Plus, Minus, Glaucoma CV/ DRH, Copy KTP, Ijazah, no. telp. yang dapat dihubungi, pasphoto terakhir dua lembar (latar TANAH DIJUAL HILANG / TERCECER FAX : 061 - 4561347 - Mata Merah, Berair, Bengkak, dll Khusus yg mau masuk angkatan minus jarak pandang +/- 7 Meter B/W (buta warna), juga dapat di sembuhkan biru), dan kirim ke: Jl. Gaperta Ujung, Ukuran 15x25m, TERCECER * Format: JPG - TIFF (Photoshop) sampai tuntas, Insya Allah Hub. IBU FARIDA AKRAM Jl. Prof. H.M. Yamin S.H (Serdang) Surat Tanah (Segel) A/n. Willem Bagian Personalia SHM (Samping Tosiro Jaya) Sihombing Lt +/- : 830 M2. Tercecer No. 251 A Tel.(061) - 4563067 Mdn Izin Depkes R.I Terdaftar PO. BOX 9999 sekitar Sei Bamban. Bagi yang Medan Hub. 0812.6418.650 menemukan Hub. Todo Sihombing atau kirim via E-mail ke: ptmi@ptmi.co.id HP 0812 6487 4955 - (0621) 41329 . BALAI PENGOBATAN TRADISIONAL Selambat-lambatnya 2 (dua) minggu setelah iklan ini diterbitkan. Hanya pelamar yang LAHAN SAWIT TERCECER SURAT ASLI ALAT VITAL Ingin Dijual Lahan Kosong 46 Ha, Cocok memenuhi syarat dan lamaran yang untuk Kebun sawit, Sudah di beko jalan Hak Guna Bangunan No. DITANGANI OLEH AHLINYA: M. SUHERDI Promosikan DARI PELABUHAN RATU SUKABUMI JABAR dialamatkan ke: PO. BOX diatas, yang akan dipanggil untuk seleksi. Cantumkan kode pilihan air, Lokasi ½ jam dari Kota Bagan Batu, 152, Tgl. 16 - 04 - 1992. Kel. Terapi keperkasaan seksualitas Pria hasil permanen tanpa Produk di pojok kanan atas lamaran Serius hub. 0813.9712.3499 Pulau Brayan Darat. a/ efek samping, alami, bebas pantangan, untuk semua usia Hasil langsung reaksi ditempat, cukup satu kali berobat Anda TANAH DIJUAL n. Pintor Muliadi dahulu MENANGANI KELUHAN: MENAMBAH UKURAN LOWONGAN KERJA RESMI KE MALAYSIA 7x17m, SK Camat, Hrg 15 Jt/ nego, Lksi. bernama Koo Hong Pin. - Panjang: 13, 14, 15, 16, 17, 18, 19, 20 cm Harian Jl. Sempurna Gg. Sayur, 2,5 Km dari Stasiun - Besar: 3,5. 4,5. 5. 5,5. 6 diameter Dibutuhkan Tenaga Kerja Wanita untuk di pekerjakan pada perusahaan Electronic terkemuka di Malaysia. Kilang COMPANY, bukan KA. Bandar Khalifah, lewat sekolah Budi Rahayu Gg. Ke 3, sblh kiri, Serius hubungi Ya n g t e r l e t a k d i J l . Jemadi. Bagi yang - - - Memperkeras, Tahan lama Ejakulasi dini, Mani encer Impotensi, Lemah syahwat WASPADA KONTREK (OUT SOURCING), sebagai berikut: Baginda Sagala 0812.6546.161 (No SMS) 1. WESTERN DIGITAL M SDN. BHD 2. SANYO AUTOMEDIA M. SDN BHD, SEBRANG PRAI menemukan akan diberi - Diabetes, kencing manis/ batu Juga melayani problem asmara, mempercepat jodoh, Media Syarat-syarat pendaftaran dan seleksi: 1. Wanita Umur 18 s/d 30 tahun 2. Pendidikan minimal SMP sederajat hadiah sepantasnya. pengasihan, penglaris, buka aura, pasang susuk, dll yang Tepat 3. Membawa Fotocopy Ijazah, KTP, Kartu Keluarga Hub: Rezeki Sembiring ALAMAT KELINIK TETAP: (asli di bawa sewaktu interview) 4. Membawa phas photo warna 3x4: 3 lbr A. RINCIAN GAJI 0813 7500 9791 Jl. SM. Raja Masuk ke Jl. Utama No. 18 Medan Dari Toko Roti Majestik ±100meter untuk 1. WESTERN DIGITAL (M) SDN. BHD - Gaji Pokok : RM 450/ bln Izin Kejaksaan: B/DSP.5/12/2008 Izin Dinkes: No. 448/0649/I/2008 Iklan Anda - Tunjangan kehadiran - Tunjangan shift - Tunjangan makan - Tunjangan lainnya : RM 50/ bln : RM 107/ bln : RM 16,50/ bln : RM 57 - RM 78/ bln FOTO COPY Bursa Harian WASPADA HP 0812.6388.7999 . Buka setiap hari - Bonus: Bonus Prestasi dan tahunan 2. SANYO AUTOMEDIA SDN. BHD WASIRI PENGOBATAN TRADISIONAL - Gaji Pokok - Tunjangan Kehadiran - Tunjangan Berdiri - Bonus : RM 430/ bulan : RM 60/ bulan : RM 1/ hari : RM 40/ bulan CANON ALAT VITAL BIKIN PRIA MAKIN PERKASA - Tunjangan Makan : RM 0.50/ hari - Tunjangan di bagian Mesin : RM 60/bulan DARI CISOLOK PELABUHAN RATU - BANTEN SELATAN (Untuk Ambeien) - Tunjangan Makan (Waktu Lembur/ Overtime): DI TANGANI LANGSUNG SAMA BP. H. AMARUDIN a.2Jam atau Lebih: RM 1.50, B. 4 Jam atau lebih: RM 2.50 - Tunjangan Shift: a. Petang: RM 3, b. Malam (8 Jam): PEWARIS TUNGGAL HJ. IBU IROH RM 8, c. Malam (12 Jam): RM 10 B. FASILITAS Metode ini dengan cara di totok di bagian syarat2 penyakitnya yang lemah dan pengobatan ini di Trapi langsung dlm waktu Wasiri berani menjamin kesembuhan tuntas - Levy subsidy 100% 30 mnt stlh itu diberikan ramu2an alami dan terjamin, tanpa - Asrama, tiket pulang, kemudahan kesehatan, asuransi, berangkat naik pesawat terbang efek samping dan bisa menyembuhkan berbagai penyakit ambeien/wasir anda. Sangat berkhasiat dan cepat - Tidak dipungut biaya proses pemberangkatan. Biaya yg dideritanya 100% obat alami, bebas semua Agama di potong di Malaysia setelah TKI bekerja. Adapun jumlah biaya tersebut adalah sebesar RM 1800 *MENGOBATI menghilangkan ambeien. Wasir yang menonjol (Rp. 5.100.00) dan di potong selama 2 tahun. LAKI-LAKI - Untuk Perusahaan Sanyo Automedia boleh yang mantan/ eks TKI Sanyo Prai dan Bayan Lepas dan Impotensi maupun yang tumbuh di dalam. Redakan rasa Kurang Keras/ Loyo gajinya disesuaikan dengan gaji terakhir sewaktu pulang ke Indonesia CASH & BONUS STABILIZER 3000W + Ukuran Panjang - 11 - 12 - 13 - 14 - 15 - 16 - 17 - 18 + Besar 4 - 4 - 5 - 5 - 6 sakit, perih dan menghentikan pendarahan waktu C. JADWAL SELEKSI: CREDIT UNTUK PEMBELIAN MESIN IR - Sanyo Automedia Sdn Bhd: Senin, 9 November 2009 - Western Digital Sdn. Bhd: Setiap Hari Kerja Lemah Syahwat/ Ejakulasi Tahan Lama MAHAR buang air besar, mencegah infeksi dan panas Hubungi: Segera daftarkan diri anda sekarang juga ke: PT. MUTIARA KARYA MITRA INDAH BERSAMA Diabetes/ Gula Hernia/ Bro 600.000 dalam serta melancarkan buang air besar. SIUP NO: 629/MEN/2006 Jl. Karya No. 68 Sei Agul Medan Alamat Praktek JL. KAPTEN MUSLIM NO. 89 C MEDAN TELP: (061) 845.2956 (DEKAT RSU SARI MUTIARA) Telp. 061 6639308 - 6620533 Jl. SM. Raja depan Garuda Plaza masuk Dpt Diperoleh di Sumatera - Aceh Contact Person: Mega 0813.6220.2213, HP. 0816 301761 - 0813 70900400 Gg. Keluarga Belok Kiri No. 4 Ecy: 0813.7515.5055 - 0812.6408.0074 0852 6144 8000 - 061 77009000 HP 0812.6057.6444 . Hub: (061) 7365429 - 7362887
    • WASPADA Senin 9 November 2009 Sumatera Utara 17 Kota Zhuhur ‘Ashar Magrib ‘Isya Imsak Shubuh Syuruq Kota Zhuhur ‘Ashar Magrib ‘Isya Imsak Shubuh Syuruq Kota Zhuhur ‘Ashar Magrib ‘Isya Imsak Shubuh Syuruq Kota Zhuhur ‘Ashar Magrib ‘Isya Imsak Shubuh Syuruq Medan 12:11 15:30 18:12 19:22 04:42 04:52 06:08 Langsa 12:14 15:34 18:14 19:24 04:46 04:56 06:11 Sabang 12:24 15:44 18:24 19:33 04:57 05:07 06:23 Tarutung 12:10 15:29 18:13 19:22 04:40 04:50 06:06 B. Aceh 12:25 15:44 18:24 20:34 04:57 05:07 06:23 L.Seumawe 12:17 15:37 18:17 19:27 04:50 05:00 06:16 Pandan 12:11 15:29 18:13 19:23 04:40 04:50 06:06 T.Tinggi 12:09 15:28 18:11 19:20 04:40 04:50 06:06 Binjai 12:12 15:31 18:13 19:23 04:43 04:53 06:09 L. Pakam 12:10 15:30 18:12 19:21 04:42 04:52 06:07 Sibolga 12:11 15:29 18:13 19:23 04:40 04:50 06:06 Panyabungan 12:08 15:25 18:11 19:20 04:36 04:46 06:02 Bireuen 12:19 15:39 18:19 19:28 04:51 05:01 06:17 Sei Rampah12:10 15:29 18:11 19:20 04:41 04:51 06:07 Sidikalang 12:12 15:31 18:14 19:23 04:43 04:53 06:08 Teluk Dalam12:15 15:32 18:18 19:28 04:43 04:53 06:09 B. Pidie 12:19 15:38 18:19 19:28 04:51 05:01 06:16 Meulaboh 12:21 15:41 18:22 19:31 04:53 05:03 06:19 Sigli 12:22 15:42 18:22 19:31 04:55 05:05 06:20 Salak 12:13 15:31 18:15 19:24 04:43 04:53 06:08 G. Sitoli 12:15 15:33 18:18 19:28 04:45 04:55 06:10 P.Sidimpuan12:09 15:27 18:12 19:21 04:38 04:48 06:04 Singkil 12:15 15:33 18:17 19:26 04:45 04:55 06:11 Limapuluh 12:08 15:27 18:10 19:19 04:39 04:49 06:05 K. Jahe 12:12 15:31 18:14 19:23 04:43 04:53 06:08 P. Siantar 12:10 15:29 18:11 19:21 04:40 04:50 06:06 Stabat 12:12 15:31 18:13 19:22 04:43 04:53 06:09 Parapat 12:10 15:29 18:12 19:21 04:41 04:51 06:06 Kisaran 12:08 15:27 18:09 19:19 04:38 04:48 06:06 Balige 12:10 15:28 18:12 19:21 04:40 05:50 06:05 Takengon 12:18 15:38 18:19 19:28 04:50 05:00 06:16 GunungTua 12:07 15:25 18:10 19:20 04:37 04:47 06:02 Kutacane 12:14 15:34 18:16 19:25 04:45 04:55 06:11 R. Prapat 12:06 15:25 18:09 19:18 04:36 04:46 06:02 T.Balai 12:07 15:26 18:09 19:18 04:37 04:47 06:03 Sibuhuan 12:07 15:25 18:10 19:20 04:36 04:46 06:02 Dihisab oleh: Tim Ahli Badan Hisab dan Rukyat (BHR) Sumut Tapaktuan 12:17 15:36 18:19 19:28 04:48 04:58 06:14 Lhoksukon 12:17 15:37 18:17 19:26 04:49 04:59 06:15 Lomba Melukis Ramaikan Polisi Gerebek Natal Oikumene Pesta SS P.BRANDAN (Waspada): BINJAI (Waspada) Menyambut Hari Natal 25 Desember Aparat Polsek P Brandan me- . mendatang, Panitia Natal Oikumene akan menggelar berbagai ringkus 5 pria sedang pesta kegiatan di antaranya lomba melukis bagi siswa TK dan SD, shabu-shabu (SS) di salah satu pengobatan gratis dan kegiatan bakti sosial. rumah kawasan By Pass Pura- Demikian Ketua Panitia Natal Oikumene Raiderta Sitepu, ka II, Kec. Sei. Lepan, tak jauh Jumat (6/11) di DPRD Binjai. Guna menyuksesksan kegiatan dari lokasi pertambakan, Sabtu itu, pihaknya juga telah melakukan audiensi kepada Walikota (7/11) sore. Binjai dan unsur Muspida Kota Binjai. Rencananya kegiatan Tersangka, DS, 33, warga ini dilaksanakan 5 Desember mendatang di Gedung Olah Raga Tangkahandurin, Kec, Brandan (GOR) Kota Binjai. Barat, DH, 30, warga Jalan Sedangkan kegiatan lain lomba membaca alkitab, lomba Tanjungpura, Gg Salmah, Kel. koor antar gereja yang akan digelar di Gedung Serba Guna Pelawi Utara, Kec, Babalan, RW, GBKP dan GKPI Kota Binjai 22 November serta pengobatan 34, warga Jalan Sutomo, Gg gratis. Selanjutnya, 28 November akan digelar jalan santai yang Seroja, Kel, Pelawi Utara, Kec, akan dimulai di Lapangan Merdeka Binjai dan finish di Gedung Babalan, IM, 37, warga Bukitra- Olahraga Binjai. (a04) ta, Desa Sei. Siur, Kec, Pangka- lansusu dan HB, 41, warga 38 Pelajar Ikuti MTQN DusunSukadamai,DesaPantai Barat Kec, Seruway, Aceh Se Teluk Aru Tamiang . Penangkapan ini berawal SEI LEPAN (Waspada) : MTQN antar pelajar se-Teluk Aru informasi yang diperoleh polisi Kamis (5/11) digelar di halaman kantor Camat Sei Lepan Langkat dari masyarakat. Mendapat diikuti 38 pelajar tingkat SD, SMP dan SMA. informasi ini, petugas ke lokasi Ketua Panpel MTQ pelajar se-Teluk Aru Jumiran, SPd dan mengamati sejumlah pria didampingi Asyari, SPd kepada Waspada mengatakan, tujuan ke luar masuk rumah, lalu petu- diadakan MTQ tingkat pelajar ini mencari bibit bibit qari dan gas melakukan penyergapan. qariah di lingkungan UPT Dinas Pdan P se wil-Teluk Haru yang Hasilnya, petugas menda- nantinya akan mewakili wilayah Teluk Aru keTingkat Kabupaten patkan pelaku sedang asyik Langkat. mengkomsumsi barang ha- Di samping itu upaya dalam menjalankan syiar agama dan ram tersebut. Polisi juga mene- Waspada/Abdul Hakim upaya untuk memasyarakatkan Al Quran di tengah kehidupan mukan barang bukti beberapa DITIMBUN: Sepanjang dua kilometer ruas Jalan Juanda Kota Binjai yang rusak parah dan sempat diblokir warga sepekan, Minggu (8/11) ditimbun. paket SS, 1 set bong, 7 mancis, masyarakat muslim di Teluk Aru bisa lebih dinikmati. (c02 ) rokok, 10 HP serta dua dompet. , Kapolsek, AKP Mhd. Syo- Kades Diingatkan Jangan Diskriminasi SEI RAMPAH (Waspada): Asisten ITata Praja Pemkab Serdang Pasca Banjir, Tebingtinggi fian Sinaga dikonfirmasi Was- pada, Minggu (8/11) mengata- kan, sesuaiketerangandaripara tersangka, mereka membeli barang terlarang tersebut dari Bedagai ZainalArifinmenegaskan,KepalaDesasebagaipimpinan masyarakat di desa jangan diskriminasi kepada masyarakatnya dalam hal pemberian rekomendasi pembuatan izin usaha galian C. Hal itu ditegaskannya dalam rapat menanggapi tentang Dan Sergai Dilanda DBD teman HB seorang bandar nar- koba di Kualasimpang. Untuk membeli SS itu, lanjutnya, kelima tersangka patungan mengumpulkan uang. (a02) adanyalaporan wargaDesaSungaiBuaya,Kec.Silinda,Kab.Serdang TEBINGTINGGI (Waspada): Kelima pasien DBD dirawat Kabupaten Sergai yakni Santa bingtinggi mengatakan, meng- Bagi pasien yang berasal dari Bedagai terhadap salah seorang pengusaha pengambilan batu di ruang isolasi RSU, tiga orang Emerelda Batu Bara, 18, warga harapakan dinas kasehatan Kota Tebingtinggi yang telah di Desa Kulasar yang merusak tanggul irigasi mereka. Akibatnya Selain mendatangkan banjir, di antaranya warga Tebingtinggi Desa Batu 12, Keca. Dolok segera melakukan fogging memiliki Jamkesmas tidak Tersangka 20 hektare lebih areal persawahan petani sudah empat tahun curah hujan yang terjadi dan dua orang warga Kabu- Masihul dan Polta Damanik, 52, (pengasapan–red) agar wabah dikenakan biaya. tidak bisa dikelola. Rapat itu digelar diruang pertemuan Asisten beberapa hari ini, juga paten Sergai. warga Bandar Kalifah, Kab. yang disebabkan dari gigitan Ditambahkan, selama Penipuan Rp11 M I Pemkab Serdang Bedagai di Firdaus, Rabu (4/11). Menurut sumber di rumah Sergai. nyamuk aedes agepty tidak me- bulan September 2009, tercatat Dalam hasil pertemuan itu disimpulkan, pengusaha yang mengancam datangnya wadah penyakit Demam sakit, Sabtu (7/11) kelima pasien Santa Emerlda Batu Bara, nyebar dan menyerang warga 13 orang warga terjangkit DBD Menyerahkan Diri telah merusak irigasi dapat memperbaikinya, sementara untuk masing-masing Dinda Amelia,5, salah seorang pasien mengaku lainnya, terlebih dimusim peng- dirawat di RSU, 10 diantaranya ke depan truk pengangkut batu tidak lagi dibenarkan lintas Berdarah Dangue (DBD). STABAT (Waspada): Salah warga Kel. Persiakan, Kec. sudah hampir seminggu men- hujan saat ini. warga Tebingtinggi dan 3 warga di kawasan irigasi,tetapi mencari jalan dari jalan yang lain. seorang pegawai negeri sipil Tercatat 5 orang warga Padang Hulu, Rizki Herlingga, jalani diopname di rumah sakit, Direktur RSUD Dr Kum- Kabupeten Sergai. Sedangkan (a07) selaku bendahara gaji di Dinas terjangkit DBD dirawat di 5, Warga Kel. Sri Padang, Kec. karena terserang DBD dan pulan Pane Tebingtinggi, dr H di Bulan Oktober tercatat 21 Kesehatan Langkat, SA, dengan Rambutan dan Kristina Pasa- selama itu sudah menghabiskan Vive Kananda Sp THT, ketika orang pasien DBD, 16 orang RSU Dr. Kumpulan Pane diantarkan keluarganya me- Ayub Teken Kontrak Politik Tebingtinggi. ribu, 15, warga Kel. Bagelen, Kec. Padang Hilir, Tebingtinggi. 12 botol cairan infus. R Br Simbolon salah se- dikonfirmasi wartawan mem- benarkan lima pasien DBD warga Tebingtinggi, 4 warga Kabupaten Sergai dan 1 warga nyerahkan diri ke Mapolres, Sabtu (7/11) menyusul telah BINJAI (Waspada) : Ketua Gabungan Pengusaha dan Sedangkan dua orang warga orang orang tua pasien asal Te- dirawat intensif di ruang isolasi. Kabupaten Batubara. (a09) diamankannya KH juru bayar Konstruksi Indonesia (Gapensi) Kot a Binjai Ayub Syaiful terkait kasus penyimpangan membuatstatemenditandatanganidalamkontrakpolitikbersama guru dan PNS. Dia mengatakan itu kepada wartawan, Jumat (6/11) di Sekretariat Pemenangan KebersamaanTuntaskan Pengangguran Rakorda MUI Sumut Berakhir uang simpanan senilai Rp11 miliar. Hal itu dibenarkan Kabag STABAT (Waspada): Rapat dullah Syah dalam sambutan- sekretariat yang tetap sehingga Abdullah syah mengingat- menggalang dana sehingga MUI Binamitra Polres Langkat (KTP) Center, Jalan Samanhudi, Binjai. Koordinasi Daerah (Rakorda) Kompol Edi Sudarsono. Menu- nya mengemukakan beberapa memudahkan dalam pelayanan kan agar kepengurusan MUI di ditingkatkan kabupaten dan Penandatanganankontraktersebutdilakukannyadihadapan -III Majelis Ulama Indonesia rutnya, SA diantar keluarganya poin hasil Rakorda terutama masyarakat, ujar Abdullah Syah daerah untuk membuat tero- kota mampu mandiri. notaris Halimah, SH pada saat peringatan Hari Sumpah Pemuda dandikenakan Pasal378KUHP (MUI) se-Sumut yang berlang- program kerja kedepan yang seraya berharap agar segenap bosan baru dengan berbagai Sebelum acara penutupan, 28 Oktober 2009. Dikatakannya, hal ini dilakukannya karena sung di Gedung PKK Langkat terkait penipuan. diharapkan lebih baik dari unsur pengurus hendaknya program unggulan guna me- seluruh peserta berziarah ke prihatin terhadap nasib para guru dan PNS yang hingga sekarang sejak Jumat berakhir,Minggu (8/ Meski dua pelaku telah sebelumnya dan menyeluruh berkerja dengan penuh per- ningkatkan pemberdayaan ma- perkampungan relijius Babus- masih belum stabil, karena berbagai kendala yang dihadapi 11) sore dan secara resmi ditu- ditahan, lanjutnya, polisi terus hingga ke tingkat kecamatan. hatian dan ikhlas serta mampu syarakat. Beberapa kepengu- salam dan disambut Tuan Guru Pemko Binjai. (a04) tup oleh Bupati Langkat. mengembangkan kasusnya Kepengurusan MUI dalam meningkatkan kerjasama an- rusan MUI sudah ada yang Babussalam Syekh Hasyim Al Ketua MUI Sumut H Ab- semua tingkatan harus memiliki tara ulama dan umara. membuat terobosan dalam Syarwani. (a01) untuk meringkus pelaku lain Pembangunan Garasi PU yang terlibat dalam penggela- pan.Inisejalandengantuntutan Menghamburkan Uang Demo Mahasiswa Di Medan Terkait Golkar Timbulkan Reaksi puluhan bidan sebelumnya. Mereka meminta polisi STABAT (Waspada): Dalam pengerjaan proyek APBD tahun TEBINGTINGGI (Waspa- Ketua PK Padang Hilir Menurut dia, demo seke- Ketika ditanya aktor intelek- calon tunggal sehingga hasil juga memeriksa oknum Kadis 2009 di Kab. Langkat yang sedang berlangsung, dibangun garasi da): Aksi demo mahasiswa di Haidin Sinaga, didampingi Sek- lompok mahasiswa mengatas- tual di belakang demo itu, Haidin pleno menetapkan calon tung- Kesehatan dan mantan Benda- terbuka di Kantor Dinas PU senilai Rp216.411.000 dengan ukuran kantor Gubsu dan DPD Partai retaris Mujahit Sinaga, Minggu namakan Jaringan Mahasiswa mengatakan, hal itu bukan gal sebagai Ketua DPRD hara Dinkes yang memiliki tidak terlalu lebar karena volumenya tidak tercantum dalam Golkar Sumut beberapa hari lalu (8/11) mengemukakan, secara Bersatu Anti Korupsi (Jambak) kapasitasnya untuk menjawab. Tebingtinggi. peranan penuh dalam wadah plang proyek. yang menggungat Ketua DPRD pribadi dan organisasi mereka di kantor Gubsu dan ke Ketua Hal itu sudah level tingkat DPD Sesuai ketentuan, Golkar se- simpan pinjam itu. Tuntutan Sementara menurut anggota DPRD Langkat, Khairuddin Tebingtinggi HM Sjafri Chap mendukung Syafri menjadi DPD Golkar Sumut Ali Umri atau tingkat kota. bagai partai pemenang Pemilu bidan itu hingga kini tetap me- Nasution, Kamis (5/11), proyek yang hampir rampung itu dinilai menimbulkan reaksi dari Pim- Ketua DPRD Tebingtinggi pe- yang meminta Sjafri Chap Dijelaskannya, rapat pleno di Tebingtinggi secara otomatis minta uang mereka kembali mubazir dan hanya menghamburkan uang, sebab tidak jauh pinan Kecamatan (PK) Padang riode 2009 - 2014 sebagaimana dipecat, dikordinir oleh orang Partai Golkar di Hotel Safari mendapat jatah kursi Ketua dan tidak ingin menanggung dari lokasi pembangunan itu telah ada dua lokasi parkir cukup Hilir. hasil rapat pleno DPD kemarin. yang tidak bertanggungjawab. baru-baru ini, Sjafri sebagai DPRD.(a09) rugi membayar cicilan di bank. lebar yang selama ini kurang dimanfaatkan. (a38) Pantauan Waspada juga demikian, dua bangunan garasi yang dibangun dua tahun silam hanya dimanfaatkan sekadarnya. Kenyataan pada hari kerja mobil-mobil dinas hanya sebagian Putusan Rumah Dinas Ketua DPRD Sudah Di PN T. Tinggi Cemburu, Pacar yang parkir di tempat itu, terkesan mubazir dengan adanya bangunan baru. Jika pihak Dinas PU beranggapan untuk garasi MEDAN (Waspada): Putu- san Mahkamah Agung RI terkait mana hingga lebih dari 17 bulan, salinan putusan tidak sampai bingtinggi Syawal Aswad Siregar, SH.MH, saat dihubungi soal itu, dia enggan menyampai- kannya. “Datang saja Senin me- rumah dinas Ketua DPRD Kota T. Tinggi senilai Rp125. 050.000 Ditikam Hingga alat-alat berat, masih di lingkungan Kantor (a38) kasus korupsi inventaris rumah dinas Ketua DPRD Kota Tebing- ke PN Tebingtinggi. Salinan pu- tusan itu, baru sampai di meja informasi itu, dan dia membe- narkan telah turunnya putusan ngambil salinannya,” kilahnya. Kasus korupsi inventaris itu, diperkirakan telah merugi- kan negara senilai Rp8 juta lebih. Tewas STAIS T. Tinggi Berbenah, tinggi, telah sampai Ke Penga- dilan Negeri. Putusan itu, MA Panitera PN Tebingtinggi 27 Oktober 2009. “Sekarang sudah MA RI ke PN Kota Tebingtinggi, dalam kasus korupsi dana rumah dinas Ketua DPRD kota Tebingtinggi, mulai disidangkan Dana berasal dari APBD 2004, pengadaannya tidak sesuai STABAT (Waspada): Cem- buru karena mendengar pacar Sambut Tim Akreditasi menguatkan putusan Penga- dilan Tinggi Sumut dan menolak ada sama panitera,” ungkap sumber. inventaris rumah dinas ketua DPRD. Dia menyebutkan, April 2006 di PN Tebingtinggi. Putusan di tingkat pertama, dengan Keppres No.18/2000. Kasus lain yang juga meli- selingkuh dan akan menikah denganoranglain,akhirnyaSU, TEBINGTINGGI (Waspada)Tim akreditasi BAN PT melaku- kasasi jaksa terhadap tiga Isi dari putusan MA RI, lanjut berkas itu telah sampai sekira ketiga terdakwa masing-masing batkan Ketua DPRD HMSC dan 26, warga Sawit Seberang nekat kan peninjauan lapangan ke kampus STAIS Tebingtinggi Deli tepidana, yakni Bendahara sumber, ketiga terdakwa ma- dua minggu lalu. “Ketua DPRD divonis majelis hakim 18 bulan kini berada di tingkat kasasi MA menghabisi nyawa kekasihnya di komplek MTs Percontohan, Jalan Imam Bonjol. Peninjauan DPRD Rasmayani Sekretaris sing-masing dipidana hukuman sebagai terpidana tiga,” kata penjara. Kemudian di tingkat RI, adalah kasus dana Asuransi Erva Br Ginting, 19, warga Desa meliputi saranadan prasarana, kelembagaan, sistemadministrasi, DPRD Drs H Nizar Rangkuti dan penjara dengan masa perco- Aswad, saat ditanya siapa banding, oleh PT Sumut vonis Jiwa Anggota DPRD senilai Sei Musam, Batangserangan kurikulum, dosen, dan kegiatan kemahasiswaan dalam rangka Ketua DPRD HM Sjafri Chap. baan 18 bulan. “Putusan itu terdakwa dalam kasus itu. diperbaiki menjadi hukuman Rp500 juta. Dalam kasus itu Sabtu (7/11). menuju lembaga pendidikan tinggi yang terakreditasi. Sumber, Minggu (8/11), tinggal menunggu eksekusi jaksa Sedangkan terpidana I dan penjara dengan masa percoba- terdakwa pertama mantanWakil Tersangka diringkus Polsek Kedatangan tim Asesor BAN PT, Dr HM Samsul Hady,M.Ag menyebutkan putusan MA RI dan mungkin secepatnya dilak- II yakni Bendahara Rasmayani an 18 bulan. Putusan PT Sumut Ketua DPRD Sutoyo telah di- dan Dr.Asy’ril Muhajir,MAg mendapat sambut hangat jajaran Padangtualang dua jam setelah sebenarnya telah inkrach pada sanakan,” tegas sumber. dan Sekwan Drs H Nizar Ra- itu, kemudian dikuatkan MA RI. vonis 18 bulan dengan sejumlah pimpinan STAIS di antaranya Ketua Drs.Kh.Suherman,SH, Pem- Juni 2008. Namun, entah bagai- Terkait itu, Panitera PN Te- ngkuti. Lebih jauh soal putusan Kasus itu berlangsung sekira tiga ganti rugi dan menjalani huku- kejadian.Pengakuantersangka, bantu Ketua I, Josua Barus,MA, Ketua III Ismail,S.Ag, Ketua tahun. man di Lapas Tebingtinggi. dia merasa cemburu dengan Prodi PAI, Masriana Rambe,SPd, Ketua Yayasan Sri Deli dan Kasus pengadaan inventaris (m10) kekasihnyayangdidugaberseli- Pimpinan Pondok Pesantren Bandar Tinggi, Sekh Salman Daem ngkuh dengan pria lain. serta hadir staf ahliWalikota Tebingtinggi, Ismail Budiman,SH. Proses akreditasi berdasarkan pantauan Waspada, Kamis Polisi Temukan Dugaan Bahkan, kekasihnya itu dikabarkan dalam waktu dekat (5/11) berlangsung alot mulai dari pagi pukul 08:00 hingga pukul 12:00. (a09) Korupsi KONI Binjai Rp 1,5 M akan menikah dengan pria lain. Merasa tidak ada pilihan lain, BINJAI( Waspada): Kepolisian Resort Binjai kembali tersangka menikam bagian perut dan dada korban dengan PAN Sergai Jaring Balon Bupati menemukan dugaan korupsi di KONI Binjai sebesar Rp 1,5 miliar yang dananya dianggarkan dalam APBD Binjai tahun 2007. pisau. Dia melakukan itu di Dalam minggu ini beberapa saksi yang telah dimintai salah satu panglong, Dusun SEI RAMPAH(Waspada): Partai Amanat Nasional Kab. Batu Sembah, Kec. Batangse- Serdang Bedagai menjaring bakal calon (balon) Bupati dan keterangannya oleh polisi, 5 orang di antaranya bakal naik statusnya menjadi tersangka. Demikian diungkapkan seorang perwira rangan tempat Erva bekerja Wakil Bupati periode 2010-2015 secara terbuka untuk umum Perempuan itu pun lang- maupun kader Partai yang akan diusung dalam Pilkada Sergai di Polresta Binjai, Minggu (8/11). Sementara itu Kapolresta Binjai AKBP Kenedy ketika sung bersimbah darah dan Mei 2010. Hal tersebut disampaikan Ketua Tim 9 Pilkada DPD PAN dikonfirmasi membenarkan . Pihaknya saat ini menunggu hasil dibawa ke RSU Batangsera- Sergai Ridwan Sitorus, SE didampingi Wakil Ketua Edi Muslih, audit dari BPKP yang direncanakan Kamis (12/11) hasil temuan ngan. Namun nyawanya tidak SH, Sekretaris M.Yani, dan anggota Mic Benteng, Yudi, SH, yang menyatakan kerugian negara dalam penggunaan dana KONI berhasil diselamatkan akibat Ridwan SE, Sukarman , Muhainuh di Sekretariat DPD PAN Waspada/M Zeini Zen Binjai yang tidak tepat sasaran diserahkan ke polisi ,sehingga banyak mengeluarkan darah. Sergai, Desa Firdaus, Sei Rampah, Sabtu (7/11). “Pendaftaran MENGEMBANGKAN KREATIVITAS: Muhammad Riza Azizi, 8, (t-shirt bergaris hitam) pelajar polisi baru bisa melakukan gelar perkara di Poldasu. Sedangkan tersangka lang- mulai Senin (9/11) sampai (19/11) serta Sabtu dan Minggu kelas II SD Al Azhar Medan serius mewarnai disaksikan sang adik Muhammad Zamakhsyari, Dugaan korupsi yang merugikan Negara sebesar Rp 1,3 miliar sung kabur ke areal perkebu- di sekretariat,’’ jelas Ridwan. 5. Riza, merupakan satu dari ratusan anak TK dan SD yang pada hari Minggu (8/11) mengikuti di KONI Binjai ini yang diduga melibatkan mantan Ketua Harian nan sawit. Bagi Balon Bupati dan Wabup yang mendaftar baik dari lomba mewarnai yang diselenggarakan sebuah perusahaan waralaba makanan di sebuah KONI Ir Haris Harto, Kadispora Binjai Ahmad Kuasa sebagai Kanit Serse Polsek Padang- internal partai maupun eksternal partai atau umum mempunyai pusat perbelanjaan di pinggir Jalinsum Tanjungmorawa, Deliserdang. Lomba seperti ini perlu penanggung jawab penggunaan dana olah raga, oleh pihak penyidik tulang Resor Langkat, Ipda hak dan peluang yang sama mendapat dukungan dari PAN, mendapat perhatian dari pemangku kepentingan sehingga kreativitas anak usia sekolah tidak telah menyelesaikan pengambilan keterangan kepada saksi saksi. Febby Arianto membenarkan. tambah Ridwan.(a07) akan mati. (a04) (a38)
    • 18 Sumatera Utara WASPADA Senin 9 November 2009 Tim Sukarelawan Regu Perlindungan Hutan Terbentuk SAMOSIR (Waspada) : Sebanyak 80 orang penduduk yang bermukim di daerah kawasan hutan dan lahan di wilayah Samosir Polres Madina Temukan Lagi Utara mengikuti sosialisasi pencegahan dan dampak kebakaran Hutan dan lahan. Kegiatan ini difasilitasi oleh Dinas Kehutanan Kab. Samosir dengan mendatangkan narasumber dari Balai Konservasi sumber Daya Alam Provsu wilayah Ekosistem Danau Toba, beretmpat di Ho- 2 Hektare Ladang Ganja tel Thyesa Ambarita, pekan lalu. PANYABUNGAN ngan Kesbanglinmas dan aparat Bupati Samosir Mangindar Simbolon melalui Sekda Tigor Polsek Kotanopan menindak- (Waspada): Jajaran Satuan Simbolon mengatakan, ada tiga kendala menjadi tantangan bagi lajutinya dengan terjun ke lokasi kita dan dapat menyebabkan kebakaran hutan terjadi secara sporadis Narkoba Polres Madina yang jauh dari pemukiman di Kabupaten Samosir yakni faktor alam yang memiliki curah hujan bekerjasama dengan penduduk dan kondisinya cu- yang relatif rendah, jumlah musim kemarau lebih panjang dari Kesbanglinmas, Satpol PP kup terjal karena berada diper- musim hujan. (c10) bukitan cukup tinggi. dan Polsek Kotanopan, Kapolres Madina AKBP Drs kembali menemukan 2 Engkos Kosasih dalam jumpa Panwaslu Kab. Samosir hektare ladang ganja dalam pers di Polres Madina, Jumat ( 6/11) mengatakan, seluruh Evaluasi Kinerja suatu operasi penyisiran di kawasan Torsihite Desa areal penemuan ladang ganja berada di lahan seluas 2 hektare SAMOSIR (Waspada):Tim Panwaslu Provinsi Sumut yakni Zakaria Gunungtua, Kec. dengan jumlahnya 1.676 batang. Taher, Sendari Ginting, dan Kepala Sekretariat Raja Shanan, SSos “Selain menemukan tana- hadir mengikuti rapat evaluasi akhir kinerja dan pemberhentian Kotanopan, Kab. Mandailing Natal, Jumat (6/11). man ganja siap panen, petugas seluruh panwaslu kecamatan, sekretariat Panwaslu dan PPL, Sabtu kita juga menemukan sekitar (31/11) di Hotel Gorat. setengah kilo biji ganja kering Ketua panitia rapat evaluasi akhir kinerja Gunawan Sinaga, ST yang untuk pembibitan dengan kepadaWaspada mengatakan,kegiataninididanaidariDIPAPanwaslu Meski jarak tempuh yang terbungkus di dalam plastik hi- Kab. Samosir sebesar Rp40 juta. harus dijalani tim menuju 2 tam yang tersimpan direrumpu- Ditambahkan, Sinaga kegiatan panwas kecamatan sudah berjalan hektare lokasi ladang ganja yang berada di perbukitan Torsihite tan tanaman ganja,” ujarnya. selama 10 bulan yang dimulai dari pemilihan legislatif dan pemilihan Kapolres Engkos Kosasih presiden 2009. Hadir di sana Ketua Panwaslu Kab. Samosir Binsar memakan waktu 6 jam , tidak membuat petugas yang dipim- memperkirakan, kegiatan pena- Manihuruk, SH dan anggota Panwaslu lainnya. (c10) pin Kasat Narkoba E. Banjar naman ladang ganja di wilayah Nahor dengan personil 20 orang Madina telah terorganisir, kare- Pemkab Dairi Merasa Berprestasi putus asa dan mundur. nanya dia berharap kepada Ladang berhasil ditemukan masyarakat yang mengetahui SIDIKALANG (Waspada): Pemkab Dairi merasa sudah melakukan dan sebagai barang bukti 1.676 keberadaan ladang ganja dan berbagai terobosan menonjol pada tahun anggaran 2008. Khusus batang tanaman ganja diperki- jenis narkoba lainnya untuk tidak dalam bidang ekonomi, PDRB (Produk Domestik Regional Bruto) rakan berumur 5-6 bulan ber- bosan-bosannya melaporkan- berdasarkan harga berlaku. hasil dicabut dan dibawa ke nya ke Polres Madina. Menurut Sekretaris Daerah Arsenius Marbun, persentase naik komando. Dengan penemuan ladang 8,8 persen dari Rp2. 860.204.000.000 tahun 2007 menjadi Rp Keterangan diperoleh, dite- ganja di kawasan Kecamatan 3.114.091.600.000.Selanjutnya,PDRBperkapitatercatatRp10.641.434,67 mukannya ladang ganja itu ber- Kotanopan ini, Polres Madina tahun2007naik7,59persentahun2008denganbesaranRp11.449.581,77. kat laporan diberikan masyara- telah berhasil membersihkan Berbagai urusan wajib dinilai memperoleh kemajuan, seperti kat ke Polres Madina. Setelah ladang ganja sebanyak 17 kali Waspada/Munir Lubis di bidang pendidikan, papar Marbun ditandai dengan penambahan mendapat laporan anggota Pol- dalam kurun waktu satu tahun Kasat Narkoba Polres Madina E .Banjar Nahor ketika mencabuti tanaman ganja yang siap panen di perbukitan Torsihite sejumlah sekolah baru baik tingkat SD, SMP maupun SLTA. Olimpiade res Madina bekerjasama de- terakhir. (a24) kawasan Kec. Kotanopan, Jumat (6/11). tingkat nasional berhasil dijuarai anak didik dari kabupaten ini. Paparan itu disampaikan kepada masyarakat dan wartawan terkait laporan penyelenggaraan pemerintahan daerah tahun 2008, Rabu (4/11) di ruangWakil Bupati. Kendati demikian, peserta meng- Polres Samosir Dalam Waktu Warga Siraisan Guru Di P. Siantar Unjukrasa Ketiga Kali ungkapkan ragam kritik kepada Sekda. (a28) Dekat Musnahkan BB Ganja Temukan P SIANTAR (Waspada): Ketiga kalinya para guru, . dana kependidikan, DPRD periode 2004-2009 mau 102 Desa Di Paluta Gelar Pilkades SAMOSIR (Waspada): Jaja- batang pohon ganja kering siap Mayat baik dari sekolah swasta maupun negeri di Kota Pematangsiantar sesudah berunjukrasa, Rabu (4/ mendampingimerekadantuntutandipenuhiPemko. Akhirnya, Alosius Sihite meminta agar mereka ran Polres Samosir khususnya panen, 561 batang pohon ganja 11)danKamis(5/11)kembaliberunjukrasake DPRD, selaku anggota DPRD agar dihargai, apalagi sudah GUNUNG TUA (Waspada) : Sebanyak 102 desa di Kabupaten SIBUHUAN (Waspada): Satuan Narkoba masih terus dalam polybag tinggi sekira 30 Jumat (6/11) menuntut bantuan dana insentif mau shalat Jumat, para guru diminta bersabar Padanglawas Utara (Paluta) akan menggelar pemilihan kepala desa Warga Desa Siraisan, Kec. Ulu melakukan penyelidikan terkait cm, 573 batang pohon ganja sebesar Rp50.000 per bulan atau Rp600.000 per sampaishalatJumatselesai.M.RivaiSiregarmeminta (Pilkades) tahun 2009 bulan Desember mendatang. Barumun, Padanglawas, penemuan ladang ganja seluas yang telah ditanam tinggi sekira tahun per guru dari Gubsu agar dibayar Walikota. hal senada kepada para guru hingga akhirnya unjuk “Pemerintah Kabupaten Padanglawas Utara akan menggelar Jumat(6/11), sekira pukul 1 hektare, Minggu (1/11) di Du- 40 cm, 1.300 bibit ganja yang Kali ini, tidak ada penutupan pintu gerbang rasa dihentikan sementara sampai pukul 13:00. pemilihan kepala desa (pilkades) secara serentak di 102 desa, yang 09:30, dikejutkandenganpene- sun Tiga Huta Balian, Desa telah disemaikan. dan para guru mencapai dua ratusan orang yang Saat para guru yang kebanyakan guru perem- tersebar di 9 kecamatan, Di Kabupaten Padanglawas Utara sesuai muan mayatlaki-lakidibawah Sianjur Mula-mula, Kec. Sianjur sebelumnya berkumpul di lapangan H. Adam Malik puan itu sedang duduk-duduk di taman halaman dengantahapanakandilaksanakanserentakpadatanggal28Desember Direktur Narkoba Poldasu jembatanSungaiSiraisan.Saat Mula-mula. bergerak dengan leluasa saat masuk ke halaman gedung DPRD, beberapa delegasi para guru bertemu 2009,’’ kata Kepala Badan PMD dan Pemerintah Desa Kabupaten Kombes Jhon Thurman Panjai- ditemukan, posisi mayat telu- Menurut Kasat Narkoba gedung DPRD pada pukul 11:15. dengan Ketua DPRD Marulitua Hutapea, SE dan Padanglawas Utara, Drs Rachmat Effendi Harahap kepada Waspada, tan yang turun ke TKP hari ngkup, kaki dan mulut korban Ipda D. Sinaga, barang bukti Di samping membawa satu spanduk, dalam beberapa anggota DPRD di ruang kerja Ketua DPRD. Kamis (5/11). minggu malam menyampaikan mengeluarkan darah segar. yang akan dimusnahkan meru- unjuk rasa hari ketiga itu, para guru yang tergabung Hasil pertemuan delegasi para guru dengan Disebutkannya,sesuaidengantahapanpenyelenggaraanpilkades, terima kasih ke Polres Samosir Informasi yang dihimpun pakan hasil penemuan ladang dalam Aliansi Peduli Pendidikan Kota Pematang- DPRD diumumkan Ketua Umum FKGH Rindu untuk kegiatan Santiaji atau sosialisasi dilangsungkan dari (2-6/ dan memerintahkan agar tetap menyebutkan, korban perta- ganja di Sianjur Mula-mula. siantar yakni gabungan dari organisasi pendidikan Marpaung, SPd yang menyebutkan hasil pertemuan 11) serentak di sembilan kecamatan yakni Kecamatan Simangambat, melakukan penyelidikan meng- ma kali ditemukan oleh Barang-bukti yang akan dan guru terdiri Dewan Pendidikan Kota, Fesdikari, sangat mengecewakan, karena DPRD hanya Kecamatan Dolok Sigompulon, Kecamatan Dolok, Kecamatan ungkap pelakunya. (c10) warga yang hendak mandi di dimusnahkan di antaranya 288 PGSI, SGSI, PGRI, FKGH dan FKG-PNS turut mem- menawarkandengarpendapatantaraDPRDdengan Portibi, Kecamatan Halongonan, Kecamatan Padang Bolak, sungai, kemudian warga melapor ke Polsek Barumun. bawa poster-poster. Pemko dan para guru pada Kamis (12/11). Pengu- Kecamatan Padang Bolak julu, Kecamatan Batang Onang, Kecamatan Hulu Sihapas. Pendaftaran bakal calon kepala desa terdiri atas tiga tahapan, pendaftaran tahap I selama 4 (empat) hari dari tanggal Mahasiswa Tapsel Kapolres Tapsel AKBP Subandria Melalui Kapolsek Aliansi dengan Koordinator Lapangan Drs Tim- bul Panjaitan melalui spanduk yang mereka bawa muman itu membuat para guru berteriak-teriak terutama para guru perempuan. menuntutWalikota mencairkan dana insentif guru- Para guru berteriak agar ke rumah dinas Wali- (17/11) hingga (20/11), tahap II dilaksanakan dari tanggal (23/11) hingga(26/11)danPendaftarancalonKepalaDesatahapIIIdilaksanakan Dan P. Sidimpuan Dukung KPK Barumun, AKP H Herwan- syah Putra di dampingi Kanit gurunegeridanswasta,membayarkandanabantuan siswa miskin, merealisasikan uang makan dan kota menuntut hak mereka atau mogok mengajar bila bantuan dana insentif dari Gubsu tidak dibayar. dari tanggal (30/11) hingga (2/12). Reskrim, Ipda Kusnadi mem- Selain itu ditambahkan, untuk pengiriman berkas calon kepala P.SIDIMPUAN (Waspada): geri (STAIN), Universitas Mu- benarkan kejadianitu.Korban pakaian guru dan transparansi pengelolaan dana Delegasi para guru yang tidak bisa meredam kekece- desa dari desa menuju kecamatan dilaksanakan dari tanggal (3/ Ratusan mahasiswa dari selu- hammadiyah Tapanuli Selatan diketahui bernama Ali Erpin pendidikan. waan para guru akhirnya memanggil anggota DPRD 12) hingga (7/12), sedangkan dari kecamatan menuju ke kabupaten ruh perguruan tinggi di Kab. Ta- (UMTS), Universitas Graha Nu- Alias Kukrom, 28, warga Desa Selain itu, para guru yang bergantian menyuara- Zainal Purba agar menjelaskan hasil pertemuan dilaksanakan dari (8/12) hingga (10/12), dan Pelaksanaan hari H panuli Selatan dan Kota Padang- Janji Lobi, Kec. Barumun. kan tuntutan mereka menyebutkan surat Sekda mereka. santara (UGN), Sekolah Tinggi Pilkades digelar 28 Desember 2009 dan pelantikan kades 31 Desember sidimpuan, menggelar aksi Berdasarkan hasil peme- bertanggal 12 Mei 2008 berbunyi antara lain sudah Zainal Purba menyebutkan DPRD akan mem- Kejuruan Ilmu Pendidikan fasilitasi dengan mengundang pihak Pemko dan 2009. (csp) moral dukungan terhadap Ko- riksaan, olah TKP dan peme- dinaikkan Kesra dari Rp50.000 menjadi Rp75.000 (STKIP), Universitas Benteng hingga tidak mungkin menjadi Rp25.000 seperti para guru pada Kamis (12/11). Namun, saat Zainal misi Pemberantasan Korupsi Huraba (Benhur) dan lainnya. riksaantimmedis RSUDSibu- (KPK) yang menurut mereka yang dijelaskan pejabat Pemko saat unjukrasa Purba berbicara, para guru itu malah bernyanyi- PGRI Wadah Meningkatkan saat ini tengah dikebiri. Pantauan di lapangan, Jumat (6/11), ratusan mahasiswa itu huan, korban tewas akibat hanyut terbawa arus sungai sebelumnya, bantuan insentif dari Gubsu Rp50.000 nyanyi dan tidak memperdulikannya hingga Zainal Aksi mengatasnamakan diri sudah dibayarkan bersama dana Kesra dari APBD Purba meninggalkan mereka.. Profesionalisme Dan Kesejahteraan Guru Aliansi Mahasiswa Bersatu bergerak dari kampus masing- masing dan berkumpul di tugu dan membentur batu-batuan sungai sehingga dari mulut Pemko Pematangsiantar pertriwulan seluruhnya Saat itu terjadi dialog para guru dengan para Peduli Keadilan itu juga mem- korban mengeluarkan darah Rp75.000 per bulan sejak Januari 2009. delegasi mereka hingga Ketua SGSI Bikman Manalu SIBUHUAN (Waspada): Pengurus Persatuan Guru Republik beri dukungan khusus kepada air mancur inti Kota P Sidim- . Padasaatitu,koordinatorlapanganyangmelihat mengimbau agar memberi kesempatan kepada Indonesia (PGRI) diharap mampu menjadi wadah untuk mendorong segar, diperkirakan tewas dua pimpinan non aktif KPK puan. Selain meneken duku- sehari sebelum ditemukan. jumlah para guru yang berunjukrasa tidak sesuai pihak DPRD memfasilitasi dengar pendapat demi meningkatkan profesionalisme dan kesejahteraan guru. yang sedang dirundung masa- ngan pada 4 meter kain putih, yang diharapkan dari lima ribuan lebih guru di kebaikan bersama para guru. “Kalau kita paksakan Demikian HM Rido Harahap, SE, Ketua DPRD Padanglawas (crif) lah, Bibit Samad Rianto dan mereka juga mengajak warga Pematangsiantar menyebutkan ada dugaan pihak- hasilnya menjadi tidak baik.” pada acara pelantikan pengurus PGRI Kec. Barumun masa bhakti yang melintas untuk membu- pihak tertentu berupaya melemahkan perjuangan Salah seorang guru malah berteriak menyatakan Chandra Martha Hamzah. 2009 hingga 2014 di gedung nasional Sibuhuan, Sabtu (7/11). Kata HM Ridho Harahap, PGRI Barumun harus siap menjalankan Mahasiswa itu berasal dari buhkan tandatangan dukungan. Ribuan Warga paragurudanmenyebarpesansingkat(SMS)melalui Aliansi sudah dipatuhi hingga para guru mau berun- Sekolah Tinggi Agama Islam Ne- (a20) telefon selular kepada para guru seolah-olah Koor- jukrasa sampai tiga hari berturut-turut. “Kalau sam- tugas-tugas yang diemban terutama kepada pengurus yang baru dilantik bagaimana untuk memperbaiki dan meningkatkan kualitas Lepas 450 dinator Lapangan Aliansi menyatakan unjukrasa pai Kamis (12/11) lagi dibicarakan, tuntutan kita tidakjadi,Jumat(6/11)itu.“Sayatidakpernahmengi- akan mentok. Jangan sampai molor lagi biar jangan pendidikan di daerah ini, termasuk mendorong peningkatan profesionalisme guru. Calhaj Madina rim SMS seperti itu dan tindakan itu sengaja hendak sampai ada tudingan miring terhadap Aliansi.” melemahkan perjuangan guru.” Koordinator Lapangan menyebutkan, Kamis Bupati Padanglawas elalui Plt Asisten I Tata Praja dan pemerinta- PANYABUNGAN (Was- Anggota DPRD di antaranya Zainal Purba, (12/11) bukan mau unjuk rasa lagi, tapi mau menun- han, Drs Imran Efendi, SmHk mengatakan, dengan dilantiknya pada): Ribuan warga Kab. Alosius Sihite, Kennedy Parapat, SE, Gundian dan tut hak para guru agar dicairkan. “Kalau mau ke pengurus PGRI Kec. Barumun dapat berkembang lebih maju. MandailingNatal(Madina)ikut Ir. Rudolf M Hutabarat menjelaskan, pertemuan rumah dinasWalikota silahkan saja, tapi hati-hati, Adapun pengurus PGRI Kecamatan Barumun yang dilantik, melepas keberangkatan 450 karena sudah banyak yang mau menunggangi para antara delegasi para guru dengan pimpinan dan Ketua Hatimul Ansor Siregar, SPd, Sekretaris Gismar Nasution, jemaah calon haji (calhaj) asal anggota DPRD serta pejabat Pemko di ruang kerja guru. Kita harus jaga wibawa dan kehormatan kita.” SPd, Bendahara, H Mahmud Hutasuhut. (a32) daerah itu menuju Asrama Ketua DPRD sudah dijelaskan tentang bantuan Namun, para guru masih menuntut agar dalam Haji Pangkalan Mahsyur dana insentif dari Gubsu. surat undangan DPRD kepada para guru dibuat Pengadaan Mess Pemkab Dairi Medan, dipusatkan di Masjid Nur Alan Nur kawasan Aek Para guru langsung berteriak dan tidak mau menerima, karena menurut mereka, bantuan dana catatan agar para kepala sekolah tidak melarang para guru menuntut hak mereka. Selain itu, para Di Jakarta Tidak Prioritas Godang Panyabungan, Jumat (6/11) malam. insentif dari Gubsu baru ada mulai tahun anggaran 2009, sedang dana Kesra sudah ditetapkan Rp75.000 guru turut mencemooh para kepala sekolah yang hanya tau melarang, namun bila uang para guru SIDIKALANG (Waspada):Pengadaan mess Pemkab Dairi sistem Warga yang datang dari per bulan sejak tahun 2008. cair, selalu yang pertama meminta bagian dan sewaberbiayaRp 1.125.000.000dinilaikurangrasionaldanmembebani Waspada/Ist berbagai penjuru wilayah itu Pada saat itu, para guru menuntut agar DPRD tudingan lainnya. anggaran. Demikian salah satu poin hasil evaluasi Gubsu, Syamsul Bupati Simalungun HT Zulkarnain Damanik (kanan) menerima datang untuk melihat secara mendampingi mereka ke Balai Kota, namun Akhirnya para guru bubar sesudah Arifin terhadap P APBD (Perubahan Anggaran Pendapatan dan penghargaan dari Ketua Mahkamah Agung RI di gedung Mr. langsung keberangkatan KennedyParapatmemintaagarmerekapergisendiri. mengancam akan mogok mengajar bila ternyata Belanja Daerah) tahun 2009 sebagaimana tertuang dalam SK nomor Koesoema Atmadja di Jakarta, Jumat (6/11). calhaj yang difasilitasi Pemkab Namun, para guru tetap ngotot agar DPRD men- Kamis (12/11) bantuan dana insentif dari Gubsu 903/4402/K/tahun 2009 tanggal 28 oktober 2009. Madina itu. dampingi mereka seperti saat mereka menuntut tidak cair.(a14) Dituliskan, jika untuk mendanai sewa mess setiap tahunnya “ Kami ingin melihat dibutuhkan dana cukup besar, maka lebih efisien dan efektif jika pemerintah daerah merencanakan pembangunan mess disesuaikan Bupati Simalungun Terima secara langsung keberangka- tansaudarakamidalam setiap 15 Ranperda Madina Diajukan Ke DPRD dengan tingkat urgensi dalam kaitan mendukung kelancaran pelaksanaan tugas kedinasan dengan mempedomani ketentuan peraturan perundang-undangan. Penghargaan Dari MA tahunnya,dan kita melihat pemberangkatan calhaj Ma- dina dari tahun ke tahun terus PANYABUNGAN ( Waspada): Pemkab ranperda tentang ketertiban umum, ranperda Mandailing Natal mengajukan 15 Rancangan tentang kawasan dilarang merokok, ranperda Sahala Siagian, Kepala Bagian Umum Sekretariat Daerah SIMALUNGUN (Waspada): sejumlah kepala daerah se-In- membaik,” ujar Hasan Na- Peraturan Daerah (Ranperda) ke DPRD daerah kawasan dilarang memakai handphone di lingku- dikonfirmasi, Jumat (6/11) menjelaskan, pihaknya telah menjawab Setelah menerima penghargaan donesia antara lain Bupati Mua- sution, warga Kecamatan itu untuk bisa dipelajari, dibahas sekaligus bisa ngan sekolah. surat gubernur dimaksud. Biaya itu adalah untuk kebutuhan lima dari Menakertrans tentang K3, ra Bungo, Belitung, Walikota Batang Natal. tahun,bukansatutahun.Sehubunganitu,dalamwaktudekatdilakukan diajukan ke sidang paripurna maupun tahapan- Renperda pencabutan atas peraturan daerah kemudian menerima penghar- Gersik, Bengkulu dan Jakarta Hadir dalam kegiatan tahapan selanjutnya sehingga dapat disahkan Nomor 17 tahun 2001 tentang izin bongkar muat, penandatangan kontrak antara pemilik rumah atas nama Nessy gaan dari Menkeu tentang pe- Timur. pelepasan itu Bupati Madina Vanesse berstatus mahasiswa dengan pemerintah. Pencairan menjadi peraturan defenitif di kabupaten itu. ranperda pencabutan perda Nomor 20 Tahun ngelolaan anggaran, selanjut- Para kepala daerah yang H Amru Daulay, SH dan Ketua keuangan dilaksanakan setelah diawali penandatanganan surat di “Pengajuan ke-15 Ranperda ke gedung dewan 2001 tentang retribusi pembinaan dan pengem- nya, Jumat (6/11), Bupati Sima- menerima penghargaan karena Tim Penggerak PKK, unsur hadapan akte notaris. Diutarakan, mess terletak di Jl Tebet Dalam lungun HT Zulkarnain Damanik dinilai telah memberikan per- Muspida, anggota tim peng- sesuai dengan 15 Ranperda Madina Diajukan bangan usaha koperasi. IV-F nomor 93 KelurahanTebet KecamatanTebet, Jakarta Selatan.(a28) kembali menerima pengharga- hatiannya dalam menumbuh- gerak PKK, kepala-kepala Ke DPRD sesuai dengan surat bernomor 180/ Ranperda pencabutan atas perda nomor 20 an dari Mahkamah Agung RI kembangkan nilai-nilai kepahla- SKPD, pembimbing manasik, 1777/ HK/ 2009, tertanggal 5 Oktober 2009 ,” tahun 2001 tentang jasa kontrak pemborongan 1.000 Lebih Warga Miskin (MA-RI). Penghargaan yang diterima wanan antar generasi. Bupati Simalungun HT Zul- ulama, tokoh adat, tokoh masyarakat serta undangan ujar Kabag Humasy DPRD Madina Drs Armen- syah kepada wartawan Jumat (6/11). pekerjaan dan pengadaan barang / jasa menjadi retribusi dokumen pelelangan pengadaan barang Dapat Pengobatan Gratis dari MA-RI berkat jasa dan peran serta Bupati Simalungun karnain Damanik menyampai- kan rasa syukur dan terimaka- terkait lainnya. Menurut Kakandepag Menurutnya, ke-15 Ranperda kini sedang mendapat pembahasan dalam rapat komisi- / jasa dan perubahannya nomor 19 tahun 2006, ranperda tentang retribusi pengujian kendaraan HT Zulkarnain Damanik dalam sihnya atas perolehan peng- Madina Drs Muksin Batubara, komisi, setelah itu baru diajukan ke rapat paripur- bermotor. P SIANTAR (Waspada): Menyambut HUT Brimob ke-64, 1.000 . hargaan dari Mahkamah Agung lebih warga miskin di Kota Pematangsiantar dan sekitarnya mendapat menumbuhkembangkan nilai- jamaah calonhajiMadinayang na dewan. “Setelah diparipurnakan, para anggota Selanjutnya ranperda urusan pemerintah RI. Dikatakan, dalam sebulan pengobatan gratis, khusus penyakit mata, THT serta kulit dan kelamin nilai kepahlawanan antar gene- terakhir Kabupaten Simalungun terdaftar berjumlah 452 orang dewan akan melaksanakan tahapan-tahapan yang menjadi kewenangan Pemkab Madina, ran- di Markas Kompi 2 Detasemen B Brimob, Pematangsiantar, Sabtu rasi di daerah. Penghargaan itu telah berhasil meraih tiga peng- atau meningkat sekitar 9 selanjutnya,” jelasnya. perda pengelolaan barang milik daerah, ranperda (7/11). langsung diserahkan Ketua MA- hargaan dari pemerintah pusat, persen dari tahun 2008 yang Adapun Ranperda yang kini mendapatkan perubahan atas perda Nomor 27 tahun 2006 “Baru tahun ini dilakukan bakti sosial Brimob menyambut RI, Dr H Hariffin Tumpa, SH masing-masing dari Menaker- hanya berjumlah 428 orang. pembahasan di tingkat komisi-komisi yakni me- tentang retribusi pembinaan norma kerja penga- HUT ke-64, namun, hasilnya sangat mengagetkan, karena saat di gedung Mr Kusuma Atmadja trans, Menkeu dan MA-RI. Namun dua orang di nyangkut retribusi penggantian biaya cetak doku- wasan, keselamatan dan kesehatan kerja di pendataan hanya 600 warga miskin yang terdata, tapi saat pelaksanaan di Jakarta. Menurutnya, pengharagaan antara calhaj gagal berangkat, yang hadir 1.000 orang lebih,” sebut Kasat Brimobdasu Kombes men kependudukan dan akta catatan sipil. Ran- lingkungan perusahaan, dan renperda perubahan Kabag Humasy Pemkab Si- itu bukan hanya ditujukan ke- satu meninggal dunia yaitu perda retribusi usaha industri, izin perluasan atas perda nomor 39 tahun 2007 tentang pemben- Verdianto B didampingi Wakaden B Brimob Tebing Tinggi Kompol malungun Simesono Hia men- pada bupati saja, tetapi meru- M Naziruddin dari Panyabu- Suhari, Danki 2 Den B Brimob Pematangsiantar AKP Heriyono, dan tanda daftar industri. tukan susunan organisasi tata kerja sekretariat jelaskan, selain kepada Bupati pakan pengharaagaan kepada ngan Barat dan sakit Maimu- Kemudian ranperda perubahan atas peratu- daerah, sekretariat DPRD dan staf ahli pada Koordinator Tim Dokter Spesialis Dr Irwanto, SpOG dan Iptu Eli Simalungun penyerahan peng- seluruh masyarakat di Kab. Si- nah dari Purbabaru Kec. saat menyaksikan pengobatan gratis itu di aula Markas Brimob malungun. (a15) ran daerah nomor 34 Tahun 1999 tentang pajak Pemkab Madina, kata Humasy DPRD Madina Pematangsiantar. (a14) hargaan juga diberikan kepada Lembah Sorik Marapi. (a24) pengambilan dan pengolahan bahan galian “C”, tersebut. (a24)
    • WASPADA Senin 9 November 2009 Sumatera Utara 19 Kertas Pengumuman TKS MENYEBERANG JALAN: Banjir yang melanda Kab. Dishub Dikoyak OTK Batubara mulai meluas dan mengenangi sejumlah LIMAPULUH(Waspada):Terjadinya pengoyakan terhadap kertas pemukiman warga dan pengumuman lulus seleksi sebagai Tenaga Kerja Sukarela (TKS) areal pertanian di Desa di Dinas Perhubungan (Dishub) Kab. Batubara akibat ada yang Nanasiam, Kec. Medang merasa kesal atau kurang puas atas pengumuman itu. Deras, Sabtu (7/11). Bahkan ‘Inibisaterjadikarenaadayangkurangpuasdenganpengumuman genangan banjir mulai penerimaan sebagai TKS yang hanya 20 orang dari ratusan pengikut menyeberang ruas jalan seleksi,’ sebut kalangan warga Batubara kepada Waspada, Jumat desa akibat meluapnya (6/11). Sungai Bahkeras karena Tanggapandankomentarawargaituterkaitterjadinyapengoyakan tidak mampu menampung kertaspengumumannama-namayanglulusseleksiyangdipanjangkan debiet air yang berasal dari di kantor tersebut, Senin (2/11). sungai di kawasan Kab. Akibatnya, kalangan peserta seleksi TKS kecewa sebab tidak Simalungun pada musim dapat mengetahui apakah dirinya lulus seleksi atau tidak. ‘Lihat penghujan akhir-akhir ini, mana mungkin pengumuman dapat dilihat karena hanya tinggal ini.Terlihat banjir perekat,’ sebut seorang pelamar TKS yang engan menyebutkan mengenangi pemukiman jati dirinya. warga dan menyeberang Dia mengaku pula, dijanjikan sebagai TKS di Dishub dengan ruas jalan desa. Sebagian mengeluarkan biaya membeli seperangkat pakaian kerja maupun warga ada memanfaatkan keperluan administrasi. Sedangkan yang diterima hanya 20.(a11) genangan banjir untuk mencuci kendaraan Ponpes At Thoyyibah Rantauprapat bermotor. Seperti terlihat di dalam foto salah seorang Terus Melengkapi Diri warga sedang sibuk membersihkan kabin truk MEDAN (Waspada): Pondok Pensantren AThoyyibah Indo- digenangan banjir. nesia di Jalan lintas Sumatera (Jalinsum), km 13 Pinang Lobang, Waspaada/Iwan Has Rantauprapat, terus melengkapi diri dengan kesempurnaan, sehingga mampu melahirkan santri-santri yang unggul dan berkualitas. Kesempurnaan itu semakin nyata, kata Humas dan Media Sekolah Ponpes at Thoyyibah Ismayuddin, SAg menirukan ucapan Pimpinan Ponpes at Thoyyibah Ir H Tamsil Lubis dalam siaran persnya, Jumat (30/1) kepada Waspada di Medan. Kelengkapan itu tercermin dari terbangunnya enam lembaga Simujur Belum Pernah Perampas Ijazah Diamankan yakni Ka. Madrasah Drs Zulkifli Bahari, PKM (Pembantu Kepala Madrasah) 1 membidangi litbang Drs Karim Lubis, MSi, PKM 2 bidang kurikulum H Abdul Hadi, Lc, PKM 3 bidang kesiswaan Arfanuddin, SAg, PKM 4 bidang keuangan Hj Susan Abdah, LC, PKM 5 bidang humas dan media sekolah Ismayuddin, SAg dan PKM Terima Bantuan Pasca Banjir SIMPANGEMPAT (Was- pada): Unit Buru Sergap Pol- sek Simpangempat Polres Asahan berhasil mengaman- 6 bidang sarana prasarana Ustadz Syaifuddin. (m14) SEISUKA (Waspada): Desa pihak lainnya, belum ada sama gian lagi mulai hidup segan mati jur ini sekaligus meminta ban- menjadi genangan air banjir kan pelaku perampasan ija- Simujur, Kec. Seisuka, sekali,” ujar Kholip. tak mau. Kemudian banyak juga tuan agar tanggul jebol segera mencapai ketinggian 0,5 hingga zah, Sabtu (7/11) pukul Termasuk, lanjutnya, pihak buah kelapa sawit yang tak da- ditutup. Namun hingga seka- satu meter. 15.45. Evendi Ritonga Bantu Batubara belum pernah yang akan memberikan ban- pat diambil hasilnya karena ban- rang laporan dan permohonan- Bila banjir melanda dan Korban, ARI,27,warga, menerima bantuan tuan. Belum ada yang berkoor- jir itu. Kerugian warga ratusan nya itu belum ada realisasinya. menggenangni badan jalan ini Dusun II, Desa Tanjunga- Warga Bagan Toreh berkaitan bencana banjir dinasi atau menyampaikan in- juta rupiah, ujarnya lagi. Demikian juga peninggian maka hubungan transportasi lam, Kec Seidadap diaman- formasi kepada kami. Rencana Kholip mengaku, sudah badan jalan yang menjadi akses dari dan ke desa ini akan terpu- kan di kediamannya oleh Iptu KOTAPINANG (Waspada): Akibat pertikaian lahan antara ratusan yang sudah melanda desa Pemkab Batubara melalui Dinas bingung akan melapor ke mana keluar masuk desa ini tepatnya tus. Hal ini juga sudah dilapor- Mahyudi, dan dibantuan warga Dusun Bagan Toreh Desa Sei Meranti, Kec. Torgamba Labu- ini sejak sekitar setahun Pertanian akan memberikan lagi agar tanggul jebol itu dapat di areal perkebunan Tanjung kan dan disampaikan permo- Unit Serse Res Airbatu, dan hanbatu Selatan (Labusel) dengan pihak PT Sinar Belantara Indah belakangan ini. bantuan korban banjir Simujur ditutup. Berbagai instansi Kasau berbatasan dengan Simu- honannya. Tetapi juga belum dari tangan tersangka di- (SBI) baru baru ini, petani BaganToreh kehilangan mata pencaharian. inipun sampai sekarang kami kompeten sudah diberikannya jur. Badan jalan sepanjang ada realisasinya, ujar Kholip amankan 3 Ijazah yang Menurut Syafwan Rambe dari Tim Evendi Ritonga, Sabtu (7/ laporan tentang banjir di Simu- sekitar 300 meter ini setiap tahun lagi.(a25) diduga hasil kejahatan. belum pernah mendengarnya, 11) mengatakan, melihat warga sudah kehilangan mata pencaharian, Hal itu dikatakan Kepala Sementara, di waktu tegas Kholip. Evendi Ritonga Ka Biro AUK Unimed, bantu warga di Dusun Toreh khususnya kawasan Bangun Jaya, Sepadan Jaya dan Sidojadi. Bantuan diserahan langsung kepada warga berupa 500 kg beras, Desa Simujur, M Kholip kepada Waspada di Simujur, Sabtu (7/ Menurut Kholip, banjir yang melanda Simujur me- Pimpinan Alwashliyah Keluarkan yang berbeda, Polsek Sim- pangempat berhasil meng- 11) sehubungan pernyataan Ka- amankan perampas HP serta 50 kotak mi instan, guna untuk dapat meringankan penderitaan warga di sana. (c05) bag Humasy Pemkab Batubara, Efrianis, Pemkab melalui Dinas mang tidak ke areal pemukiman warga. Relatif sedikit saja rumah SK Tanpa Mekanisme Organisasi dengan tersangka, AD,18, warga Dusun VII, Desa Pertanian setempat akan warga yang tergenang. Hanya Tanjungalam, Kec Seidadap, saja 300 hektare lebih areal per- AEKKANOPAN (Waspa- Agustus lalu sudah menerbit- adalah mekanismenya, apa 6 Kelompok PKK Ikuti membantu korban banjir Simu- jur (Waspada, Sabtu 7/11). tanian warga yang sudah ham- da): Pimpinan Alwashliyah Su- matera Utara Keluarkan Surat kan SK PD Al Washliyah Labu- hanbatu Utara, tanpa ada pem- dibalik semua ini, kenapa PC tidak dilibatkan, kalaupun tidak diamankan petugas karena telah merampas HP milik pir setahun tergenang air banjir. Seminar Budi Pekerti “Sampai hari ini belum ada bantuan ke desa kami yang ber- Sebagian besar merupakan Keputusan (SK) Pengurus Dae- rah Labuhanbatu Utara tanpa beritahuan sebelumnya dan namanya tercantum di jajaran melalui Musda, minimal PC di- mintai pendapatnya, lanjut Samsiar Tarigan,19, warga Simpangempat, saat korban LIMAPULUH (Waspada): Bupati Batubara OK Arya Zulkarnain, kaitan dengan bencana banjir areal tanaman kelapa sawit. melalui musyawarah daerah wakil ketua. Syahnan. akan pergi Kuliah. membuka resmi acara ‘Seminar Budi Pekerti, Sopan Santun Dalam di Simujur ini. Apakah itu ban- Sekitar 30 persen di antara atau mekanisme organisasi, se- “Saya terkejut, tiba-tiba saja Hal senada diungkapkan Kapolres Asahan AKBP Keluarga dan Masyarakat’ di aula MAN Limapuluh, Senin (27/10). tuan dari pemerintah maupun tanaman itu sudah mati. Seba- perti tidak diundangnya pimpi- disampaikan ada undangan Ketua PC Alwashliyah Kualuh Mashudi melalui Kapolsek Hadiri Ketua TP PKK Kab. Batubara Ny Khadijah Zulkarnain, nan kecamatan, sehingga mem- untuk pelantikan PDWashliyah, Selatan H Darkin Tanjung se- Simpangempat AKP Rudy Ketua Darma Wanita Persatuan, Ny Rahmawati Sofyan, Kadis/ Ka. Badan, Kabag Umum Asmunan, S.Pd,Camat Limapuluh M Kembalikan Kutipan Bagi buat pimpinan cabang Kualuh- hulu dan Kualuh Selatan merasa katanya nama saya duduk di wakil ketua, saya merasa kece- waktu bersama Ketua PD Al- washliyah Labura H.Syafril Candra, SH membenarkan, dan menurutnya, kejahatan kecewa. wa kenapa organisasi sebesar Azmi, SAg dan ketua Panitia Pe- jalanan ini harus ditumpas Nasir, SSos. Bupati Batubara mengatakan, TP PKK merupakan mitra peme- rintah dan pilar utama dalam menata kehidupan berkeluarga dan Pelamar CPNS Di Batubara Hal itu disampaikan di- sampaikan Ketua PC Alwashli- Al Jam’iyatul Washliyah dalam membentuk kepengurusan di lantikan H Ridwan Rambe SPdi di Masjid Al Aman Aekka- habis. “ Tidak ada tempat bagi bermasyarakat. Juga merupakan wadah pemberdayaan wanita LIMAPULUH(Waspada): persnya dengan wartawan me- yah Kec. Kualuhhulu Drs A Syah- tingkat kabupaten tanpa ada nopan. pelaku kejahatan di wilyah turut berperan aktif dalam pembangunan terutama membangun Pengutipan terhadap pelamar ngaku untuk melakukan pen- nan Nasution dan Ketua PC musyawarah, padahal di Labu- Darkin Tanjung yang juga hukum Polres Asahan, keluarga dan masyarakat. CPNS dilingkungan Pemkab dataan sekaligus menganjurkan Alwashliyah Kecamatan Kualuh hanbatu Utara sejak dahulu ketua MUI Labura itu menya- semuanya akan kami sikat,” “Melalui kegiatan seminar ini seluruh tim penggerak PKK se Batubara untuk dikembalikan desa/kelurahan untuk me- Selatan H Darkin Tanjung, SPd sudah ada 7 pimpinan cabang rankan kepada Ketua PD Al- ujar Rudy. (a37/csap) Batubara semakin eksis dan mampu meningkatkan peran aktifnya demi menjaga citra baik dimata ngembalikan. kepada wartawan, Senin (2/11). terbentuk,” ujar Syahnan. wasliyah versi SK PW SU agar sebagai motor penggerak kehidupan dalam keluarga dan di tengah masyarakat,” harap bupati. (a30) masyarakat. “Ini sejalan dengan pro- Begitupun katanya mela- porkan diri ke desa atau kelura- Syahnan Nasution merasa sangat terkejut karena menge- Menurutnya dirinya kece- wa bukan karena ketua yang mengundurkan waktu pelan- tikan dan segera laksanakan Warga gram Pemkab mengharapkan penerimaan CPNS Tahun 2009 han bagi pendatang tidak saja tahui PimpinanWilayah AlWas- hliyah Sumatera Utara sejak ditunjuk, siapapun yang diper- caya silakan saja, yang kita protes Musda dengan mengundang PC se Labura. (csi) T. Tiram Dapat Tim Irwasda Dan Dari Bina Marga berjalan bersih dan bebas KKN,” diberlakukan bagi pelamar CPNS akan tetapi diwajibkan Kompor Gas Survei Desa Pematang Celeng sebut Ketua DPRD Kab. Batu- bara, H Surya, BSc kepada Was- bagi seluruh PNS yang berasal dari luar daerah yang bertugas Pemuda Tewas Diduga Ditubruk KA TANJUNGTIRAM (Was- pada, Rabu (4/11). pada): Kompor gas bantuan BILAHULU (Waspada): KedatanganTim Irwasda dan Bina Marga Apa lagi pernyataan Asisten di Batubara sebagaimana Perda KISARAN (Waspada): Se- beberapa jam lalu, karena da- tidak pulang ke rumah, karena dari Kab. Labuhanbatu didampingi dari Kec. Bilahhulu hanya melihat No 24 Tahun 2009. orang pemuda ditemukan rahnya sudah mulai membeku,” dia pergi melihat hiburan (key- pemerintah untuk rakyat di II Sekdakab Batubara Iskandar desa-desa se Kec. Tanjung- (survei) ke Desa Pematang Seleng tentang pengerasan jalan yang Lubis, SH pada kunjungan sidak “Ini akan kita instruksikan tewas dengan badan terpotong ujar Dokter jaga rumah sakit. board) yang tidak jauh dari mengunakan Anggaran Dana Desa (ADD). ke jajaran PNS berasal dari luar dua, di areal rel lintasan Kereta Oleh sebab itu, kata dokter, tiram sejak, Sabtu (7/11). ditempat pendaftaran secara lokasi kejadian. Pernyataan itu disampaikan Kepala Desa Pematang Celeng Api (KA) jurusan Medan-Ran- dilakukan penjahitan, karena Sumber di Kelurahan tegas menyatakan tidak ada kuti- daerah untuk melaporkan diri Polisi Khusus KA Paimun Suriono, Selasa (3/11) via telefon selularnya kepada wartawan. tauprapat di Dusun I, Desa Pulau tubuhnya terpotong dua, dan Tanjungtiram, Batubara, pan bagi pelamar CPNS dan ke desa atau kelurahan tempat dikonfirmasi Waspada di sta- Sabtu,(7/11) mengatakan, Suriono juga menjelaskan, sebelumnya ada empat kepala desa merupakan kewajaran bila hal domisilinya karena diwajibkan Bandring, Kec. Pulau Bandring, tangan kirinya putus dan bebe- siun mengatakan, belum me- yangbakaldiperiksadariIrwasdaKab.Labuhanbatuterkaitpengunaan Kab. Asahan, Minggu (8/11) rapa bagian tubuh yang terko- kompor elpiji untuk kelura- itu dikembalikan. sebagaimana Perda,” ujarnya ngetahui dengan pasti apakah han sudah diterima dan akan Anggaran Dana Desa (ADD).“Yang pertama dikunjungi tim itu Desa Asisten II Pemkab Batubara didampingi Kabag Humas sekitar pukul 06:30. yak, disebabkan benturan atau Pematang Seleng, Senin (2/11), kemudian setelah itu baru menyusul lindasan alat berat. “Di salah satu korban tewas ditabrak KA atau langsung didistribusikan ke- Iskandar Lubis, SH dalam temu Efrianis SH.(a11) Korban, Suparmin, 27, beberapa desa lagi.Tim itu hanya survei saja,” katanya melalui telefon saku celana korban, ditemukan tidak, namun demikian pihak- pada warga sebanyak 754 warga yang sama dengan lokasi selular. kejadian, ditemukan dengan pecahan botol minuman, dan nya akan melakukan pengece- KK. Setiap lingkungan dapat Camat Bilah Hulu H. Abdullah Hasyim, SE ketika ingin ditemui di kantornya tidak berada di tempat. Menurut Sekcam Khairuddin, Pengoyakan Pengumuman TKS bersimbah darah dengan tubuh terpisah menjadi dua berjarak diduga itu miras,” ungkap Dokter. kan terhadap KA yang melintasi jalur itu. mengirimkan 5 warga untuk diberikan penjelasan guna pemakai an kompor gas ter- “Bapak camat lagi rapat di kantor bupati, kalau mau menunggu ya silakan tunggu saja. “ pintanya seraya mempersilakan duduk di kantornya. Dishub Batubara Cermin Kekesalan 3 meter dari rel KA, sehingga jenazah korba langsung dibawa Abang korban Sumarno, 30, dikonfirmasi Waspada men- jelasakan, tidak menduga adik- “Kami akan melakukan pe- ngecekan ulang, dengan masinis KA yang melintas tadi malam sebut sebagai penyambung lidah kepada warga setem- ke RSUD H Abdul Manan Sima- Saat menunggu kedatangan camat sempat berbincang-bincang LIMAPULUH(Waspada): umuman seleksi TKS Tahun tupang Kisaran untuk divisum. nya meninggal seperti itu, pasal- hingga pagi ini,” ujar Parmin. pat. Setiap penerima kom- mengenai hasil kunjungan Tim Irwasda ke desa Pematang Seleng, Pengoyakan kertas pengumu- 2009 di lingkungan Dishub “ Korban sudah meninggal nya, kemarin malam korban (csap) por gas dilampiri selembar Khairuddin menjelaskan dirinya selaku Ketua verifikasi di kecamatan man lulus seleksi sebagaiTenaga setempat yang dipajangkan di kertas menunjukkan nama itu hanya pendamping tim dari kabupaten saja. (c01) Kerja Sukarela (TKS) di lingku- ngan Dinas Perhubungan (Dis- luar kantor dinas teknis, Senin (2/11) yang dilakukan OTK. Kader Pendukung SBB Siap pangkalan untuk isi ulang gas berikutnya. hub) Kab Batubara kemung- Akibatnya kalangan peserta Camat Tanjungtiram Dinkes Labuhanbatu kinan merasa kesal atau kurang puas dengan hasil peng- mengikuti seleksi TKS kecewa sebab tidak dapat melihat mau- Melakukan Perubahan melalui Sekcam M. NasirYu- hanan, Minggu (8/11) mem- Laksanakan Operasi Katarak umuman. pun mengetahui namanya ter- KISARAN (Waspada): Kader dilakukan di Kabupaten Asahan itu, yakni melakukan gerakan- benarkan pendistribusian ‘Ini dapat saja terjadi karena masuk salah satu dari 20 orang pendukung Syamsuddin Batu- pada tahun-tahun mendatang, gerakan dan bersatu demi peru- kompor gas bantuan peme- BILAH HILIR(Waspada): Dinas Kesehatan Pemkab Labuhanbatu yang diumumkan lulus seleksi. bara siap melakukan perubahan maka workshop ini dilakukan,” bahan,” jelas Ridwan. kurang puas dengan hasil peng- di Asahan, terkait dengan diada- ujar Kordinator JP-SBB Ir Lokot Sementara, Sekretaris JP- rintah sudah sampai untuk mengadakan operasi katarak mata di Negeri Lama, Kec. Bilah Hilir Dia mengaku dijanjikan umuman yang diterima sebagai kan workshop pembekalan dan Ridwan Batubara dikonfirmasi SBB Kabupaten Asahan Ma- delapan dari 12 desa/ kelu- di Puskesmas, Rabu (4/11). sebagai TKS di Dishub dengan TKS hanya 20 orang dari ratusan penguatan Kapasitas tim oleh Ja- Waspada, Minggu (8/7) di ngaraja Manurung SH melapor- rahan di kecamatanTanjung- Operasi gratis dilaksanakan dengan dana APBD Labuhanbatu jumlah mengikuti seleksi,’’ sebut mengeluarkan biaya membeli ringanPendukungHSyamsuddin Sekretariat JP-SBB di Jalan SM kan, workshop Pembekalan dan tiram. Disebutkan kekura- 2009 dan rencananya 100 warga. Sebelum operasi terlebih dulu seperangkat pakaian kerja mau- beberapa kalangan masyarakat Batubara (JP-SBB), Sabtu (7/11) Raja No 33 Kisaran. Penguatan Kapasitas Gelombang ngannya untuk 4 desa lain diperiksa darah, glukosa darah, jarak pandang. pun keperluan administrasi. Batubara kepada Waspada di Gedung SPSI Kabupaten “Tujuan pokok kita dalam I, Sabtu lalu yang diadakan di Ge- seperti Bog ak, Sukamaju, Demikian dijelaskan Kadis Kesehatan Labuhanbatu Dr.Nazmil Sedangkan yang diterima hanya Jumat (6/11). Asahan. kegiatan ini, tidaklah sekedar dung Serikat Pekerja Seluruh In- Bagandalam, Sei Mentaram Fuad Harahap, M.kes melalui Kabid Yankes dan Farmasi H. Sutajid 20 orang untuk ditanggung oleh Mereka mengatakan itu me- “ Sebagai langkah kaderisasi dukungan kepada SBB untuk jadi donesia(SPSI)KabupatenAsahan, akan diberikan, Senin (9/11) didampingi Kepala SeksiYankes Dr Edison Stepen kepada Waspada, nanggapi terjadinya pengoya- SKPD setempat dari ratusan dan penyamaan persefsi tentang BupatiAsahanperiodelimatahun Jalan Latsitarda Kisaran itu, diikuti hari ini.(a30) Rabu (4/11). kan terhadap kertas hasil peng- jumlah keseluruhan.(a11) konsep perubahan yang akan ke depan saja, namun lebih dari 180 orang peserta (csap/a36) Sutajid menambahkan, tujuan operasi katarak ini untuk menu- runkan angka kebutaan yang disebabkan oleh katarak. Dari 100 warga yang diperiksa matanya akan yang dioperasi 65. Hadir di sana Camat Bilah Hilir Jumirin, Kapuskesmas Bilah Danyonif Marinir Menembak Bersama Wartawan Hilir Hj Faridah Hanum dan warga Negeri Lama. Sedangkan, Jumat (6/11) Dinkes melaksanakan khitanan missal diikuti 120 peserta P.BRANDAN (Waspada): melakukan penembakan yang disiplin pasti akan ditindak dan Karenanya, untuk mencetak di Aek Paing, Kec. Rantau Utara, untuk warga yang kurang mampu. Komandan Batalyon Infantri benar. Kemudian, dari markas kami tidak akan menutup-nu- prajurit yang tangguh, kegiatan Camat Rantau Utara Drs April Hasibuan Kamis (5/11) (Danyonif ) Marinir Mayor Marinir wartawan berangkat ke tupinya,” ujar dia mengakui latihan harus terus ditingkatkan. (Mar) Umar Farouq di sela acara lapangan tembak dengan me- selama ini kontribusi wartawan Terkait peralatan senjata, menambahkan khitanan massal dan gratis bagi warga kurang sangat besar. Pasi Ops, Mayor (Mar) Tommy mampu.(c01) silaturahim dengan insan pers naiki tank amfibi BTR-50 buatan memberikan kesempatan pada Ukraina tahun 1999. Ia mengemukakan, untuk Hutagaol menyatakan, senjata wartawan media cetak meng- Sedangkan dalam perte- mewujudkan Marinir yang produksi dalam negari buatan Dirjen Adm Kependudukan ikuti latihan menembak di muan silaturahim Mayor (Mar) besar, kuat, loyal, profesional, dan memiliki semangat ke- Pindad sudah memenuhi stan- dar internasional. Terbukti, kata- lapangan tembak batalyon itu Umar Farouq didampingi Wa- Berikan Pembekalan Teknis di Tangkahan Lagan, Kec. Sei. danyon MH Silalahi, Pasi Ops. bersamaan dalam menjaga ke- utuhan NKRI, diperlukan pena- nya, pada even perlombaan menembak di Brunai Darus- Lepan, Langkat, Selasa (3/11). Mayor (Mar) Rommy Hutagaol, KOTAPINANG (Waspada): Pj Bupati Labuhanbatu Selatan Para wartawan itu Asrirrais naman disiplin yang ketat. salam yang diikuti beberapa Pasi Intel Kapten (Mar) Naja- Alhamdulillah, katanya, negara termasuk AS, Indonesia (Labusel) Hj R Sabrina diwakili Sekdakab Drs Abd.Rajab Pasaribu, (Waspada), Wahyudi (Warta- muddin mengemukakan, hubu- MAP membuka pembekalan teknis pemutakhiran data kependu- selama enam bulan ia memim- mendapat juara I dan II. kita), Misno Hadi (Medan ngan baik antara Marinir de- pin di Yonif 8 Tangkahan Lagan, Sementara, berkaitan de- dukan, Kamis (5/11) di ruang pertemuan Kantor Bupati Labusel. Bisnis), Reza Fahlepi (Medan ngan insan pers perlu dibina pelanggaran disiplin dari para ngan HUT Marinir ke-64 pada Pembekalan dihadiri seluruh camat, kepala desa/lurah, para Bisnis), Asrizal (Andalas) dan secara berkelanjutan. prajurit tercatat nihil. 15 November, Yonif-8 menga- Kepala SKPD (Satuan Kerja Perangkat Dinas) sedangkan Instruktur Herry Ginting (Analisa). Dikatakan, di mana tempat Farouq menyatakan, tugas dakan berbagai kegiatan di an- Herawati dan Goffar dari Dirjen Administrasi Kependudukan Latihan menembak itu pasti ada ditemukan oknum pasukan Marinir ke depan se- taranya donor darah, pember- Jakarta. menggunakan pistol untuk jarak prajurit yang baik termasuk yang makin berat dan kompleks un- sihan Taman Makam Pahlawan, Pasaribu mengatakan, amanat UU No. 23 Tahun 2009 10 meter dan senjata SS1 untuk nakal. Karena itu, Danyon ber- tuk mengamankan kedaulatan lomba dayung perahu karet Waspada/Asrirrais pengelolaan administrasi kependudukan dilakukan melalui jarak 400 meter. harap, jika menemukan hal-hal MENEMBAK: Wartawan sedang konsentrasi membidik sasaran NKRI dari ancaman, baik yang untuk umum, open turnamen pembangunan Sistem Informasi Administrasi Kependudukan Sebelum mengikuti latihan, yang tak baik tolong dikonfir- datang dari dalam mau pun dari bola voli dan berbagai lomba tembak dengan menggunakan senjata api laras panjang jenis (SIAK), pencanangannya telah dilaksanakan di Labusel pada wartawan diberi pembekalan masi kepadanya. luar mengingat garis pantai kita keterampilan khusus bagi kala- SS1 dalam kegiatan latihan menembak di Yonif-8 Marinir September 2009. (c05) oleh pelatih tentang tata cara “Prajurit yang melanggar cukup luas, yakni 81.900 km. ngan istri prajurit.(a02) Tangkahan Lagan, Selasa (3/11).
    • 20 Sumatera Utara WASPADA Senin 9 November 2009 Komplotan Spesialis Kambing Ulama Palas Harus Lanjutkan Antar Kabupaten Dibekuk GUNUNGTUA (Waspada) : Pencuri spesialis kambing asal Masyarakat Sipirok Desak Komitmen Mukhtar Muda Nasution Kabupaten Labuhanbatu, yang kerap melakukan pencurian kambing di berbagai kecamatan di perbatasan antara Kabupaten Padanglawas Utara dan Kabupaten Labuhanbatu, dibekuk oleh Tim Reserse DPRD Sumut Dan Gubsu MEDAN (Waspada): Berpu- langnya ke Rahmatulalh tokoh kharismatik Padanglawas Tuan Guru Mukhtar Muda Nasution mengingat kehidupan yang cenderung religius dan jumlah pendudukberagamaIslamsangat dominan, yakni 95 persen Mus- Pikiran dan cara Mukhtar Muda, kata Ansor, bisa menjadi referensi dalam memperkuat usaha bersama mewujudkan Polsek Padang Bolak, Jumat (30/10), di Jalan Lintas Sumatera tepatnya di Desa Rokan Baru, Kecamatan Halongonan, Kabupaten MEDAN (Waspada) : Tokoh Selatan. Di sana banyak lahir ibu kota Tapsel di Sipirok. membuatmasyarakatkehilangan lim. Padanglawas sebagai daerah Padanglawas Utara masyarakat Sipirok desak DPRD tokoh-tokoh nasional, seperti Mr Paling lambat 18 bulan sejak figur yang memberi pengaruh Menurut Ansor lagi, maha- agama dalam arti yang luas. Ter- Informasi dihimpun Waspada, menyebutkan, gembong spesialis besar dalam kehidupan, khusus- siswaberpandanganPadanglawas masuk dalam menghempang Sumut dan Gubsu agar menyu- Amir Syarifuddin, Burhanuddin undang-undang tersebut di un- pencurian kambing,Yusrizal alias Ucok,35, warga Jalan AhmadYani nya religiutas. akan diuji dalam mempertahan- Westernisasi dalam berbagai rati BupatiTapanuli Selatan (Tap- Harahap, Hasjrul Harahap dan dangkan pada 10 Agustus 2007. kan suasana religiutas tersebut bentuk yang tidak sejalan dengan Kecamatan Rantau Utara, Kabupaten Labuhanbatu, Rozali alias Hal itu dikemukakan Ketua sel) Ongku P Hasibuan.Yang ber- . mantan Kepala Bakin Syamsir Padahal hitungan 18 bulan sudah Umum Pengurus Pusat Gerakan setelah ditinggalkan Mukhtar kaidah Islam. Jon,54, warga Desa Parbaungan, Kabupaten Labuhanbatu, Sugeng sangkutan, dinilai tidak mampu Siregar. jatuh tempo 10 Februari 2009. ,21, warga Desa Bolok Songo, Kecamatan Sisumut, Kabupaten Mahasiswa Padanglawas (Gema Muda. Baik dari segi jumlah pen- Dikatakannya, salah satu merealisasikan UU No.37 dan 38 Masalah tersebut sudah lama “Untuk ituYopie mengutip kete- Padanglawas) Ansor Harahap di- duduk dan juga dalam pelaksa- keberhasilan Kota Sibuhuan yang Labuhanbatu, Slamat alias Kribo,54, warga Desa Sisumut, Kecamatan tahun 2007, tentang pemindahan berlarut-larut dan tidak masuk rangantokohpemudaFaisalReza dampingi pengurus lainnya naan nilai-nilai Islam itu sendiri sekarangsebagaiibukotaPadang- Kotapinang, Kabupaten Labuhanbatu Selatan. Mereka kerap beraksi dengan mengendarai mobil. Ibukota Tapsel ke Sipirok. akal, padahal lokasi pertapakan Pardede, mengingatkan Bupati Ahmad Habibi Dalimunthe, dalam kehidupan hubungan lawas yang tidak terlepas dari Kapolres Tapanuli Selatan, AKBP Subandria yang dikonfirmasi Para tokoh itu sudah mene- untuk perkantoran sudah ada, Tapsel agar menjalankan roda Jabaluddin Siregar dan Sugianto antar manusia dan hubungan usaha Mukhtar Muda adalah Waspada melalui Kapolsek Padang Bolak, AKP Maju Siregar, SH mui Ketua DPRD Saleh Bangun kata mantan Ketua BPD Kadin pemerintahan di Sipirok. di Medan, Kamis (5/11). dengan Allah. menolak adanya hiburan malam Kamis (5/11) di Gunungtua membenarkan. dua hari sebelumnya, Ketua de- Sumatera Utara. Selamainiyangsudahmenja- Menurut Ansor, mahasiswa “Kita semua mendapat tan- yang dapat mempengaruhi kehi- Kapolsekmenambahkan,dalampemeriksaan, tersangkamengaku wanmenyatakanakanmerespon “Jadi, kalau dibilang kawasan lankan tugas di Sipirok yaituWakil selama ini memandang Mukhtar tangan lebih berat mewujudkan dupan religiutas masyarakat yang keinginan masyarakat Sipirok. itu daerah patahan Semangko Bupati Aldin Rapola Siregar. “To- Muda (alm) adalah tokoh yang Serambi Mekkah di Padanglawas selama ini terbina. “Ulama yang baru satu kali beraksi mencuri kambing yaitu di Desa Rokan Baru, Demikian penegasan Drs H yang selalu terjadi gempa, tidak koh masyarakat disana mengha- banyak berjasa menjaga kewiba- dengan tiadanya tokoh yang tinggal harus jadi penerus Kecamatan Halongonan, Kabupaten Padanglawas Utara. (csp) selama ini sangat berperan dalam Yopie S Batubara, mantan ang- masuk akal, selama ini tidak rapkan Bupati Tapsel dapat waan daerah Tapanuli Bagian komitmen keagamaan Mukhtar Selatan (Tabagsel), khususnya Pa- upaya mewujudkan dan mem- Muda” ungkapnya. gota DPD RI asal Sumatera Utara pernah terjadi gempa di daerah mematuhiundang-undang,”ujar Perwada Dideklarasikan kepada wartawan di Medan, itu,” ujar dia. Yopie. danglawas yang bercita-cita menjadi Serambi Mekkah bumikan nilai-nilai Islam,” kata Ansor. Nama Jalan GUNUNGTUA (Waspada) : PersatuanWartawan Daerah (Perwa- Jumat (6/11). Kalau bupatinya masih tetap Kenapa, kata tokoh masyara- Sumut. ‘’Mahasiswa berkabung Untuk itu, lanjutnya, maha- Selanjutnya, Gema Palas me- da), Kab. Padanglawas Utara, Kamis (5/11) dideklarasikan di Restauran KataYopie, ketika menerima bertahan dengan prinsipnya, kat Sipirok itu, perpindahan ibu atas kepergian Mukhtar Muda siswa sangat berharap agar para nilaicukuppantasnamaMukhtar Lobu Bara, Simpang Purba Sinomba, Pasar Gunung Tua. delegasi DPP Naposo Nauli Bu- warga masyarakat akan menem- kota Tapsel ke Sipirok itu, bukan memenuhipanggilanAllahuntuk ulama Padanglawas khususnya, Muda Nasution menjadi nama Ketua Dewan Penasehat Perwada, H Mahjaruddin Tanjung, lung Napa Napa ni Sibualbuali puh jalur hukum, padahal saya semata-mata didasari keinginan, selama-lamanya,’’ kata Ansor. agar menanamkan dan melan- salah satu jalan di Kota Sibuhuan. menyampaikan, Perwada adalah suatu kesatuan bagi jurnalis daerah Sipirok (NNBS) di ruang kerja mengharapkan kalau bisa jangan merupakan keharusan dari Ditegaskannya, keinginan jutkan komitmen almarhum Oleh karena itu mahasiswa yang mempunyai kebersamaan sejiwa dan seperasaan dalam Ketua DPRD Sumut, hadir juga sampai ke arah itu. undang-undangharusdijalankan beliau sama dengan cita-cita Tuan Guru Mukhtar Muda da- meminta Pemkab Padanglawas melaksanakan tugas dan fungsi sebagai sarana dan prasana aspirasi Wakil Ketua DPRD Sumut Ir Bahkan kataYopie, tuntutan setiap warga Negara Kesatuan mahasiswa dalam mewujudkan lam upaya mewujudkan kabu- untuk mempertimbangkan panyalur dari setiap elemen masyarakat daerah khususnya di Kab. Chaidir Ritonga, MM dan Ketua itu juga semakin bergelinding. Republik Indonesia. (m32) peradaban Islam di Padanglawas paten yang Islami. usulan ini. (m34/a32) Paluta. Komisi A Mohammad Nuh. Misalnya, Jumat (6/11) datang Ketua Perwada, Darwin Siregar, mengatakan, pendeklerasian Sementara dari tokoh ma- dari Forum Komunikasi Masya- dan pembentukan Perwada adalah sebagai bentuk keperdulian syarakat Sipirok yang hadir antara rakat Tapanuli Selatan (FMKTS), terhadap pembangunan Paluta. Dimana diperlukan kinerja secara lain Prof Moenaf H. Regar, guru mereka berunjuk rasa di kantor nyataolehpers terhadaplajupembangunandisemuabidang,cetusnya. besar fakultas ekonomi USU, dr Bupati Tapsel. Susunan kepengurusan Perwada, Ketua Darwin Siregar, Wakil Ketua Sori Parlah Harahap, Sekretaris Hendri Saputra Hasibuan, Arifin, S. Siregar, SPKK, HR Jurian- Dalam orasinya, pengunjuk SH,Wakil Sekretaris H Nadirhan Parapat, BendaharaTohong Pangon- di Siregar, SE dan tokoh pemuda rasa mengingatkan BupatiTapsel dian Haraha,p SPd. Kepala divisi perencanaan dan pembangunan asal Sipirok Faisal Raja Pardede. Ongku P Hasibuan agar menja- . organisasi, Astro Simamora, Pirgong Harahap dan Ongku Harahap. Yopie merasa heran, Sipirok lankan amanat yang dituangkan Sedangkan dewan pembina, H. Mahjaruddin Tanjung, Suparlin daerah dengan sejarah yang kuat dalam undang-undang pemeka- Syahwadin Dalimunthe dan Firdaus Harahap, SAg. (csp) dalam perkembangan Tapanuli ran wilayah yang menyebutkan
    • WASPADA Senin 9 November 2009 Aceh 21 MTQ Cari Pahala, Banjir Rendam Dua SD, Bukan Cari Piala Murid Diliburkan KOTA LHOKSEUMAWE, (Waspada): Menghadapi PANTONLABU, Aceh Utara Unit Pelaksana Teknis Dinas Pem- MTQ ke 30 tahun 2010 Pemerintahan Kota (Pemko) Lhok- (Waspada): Hujan lebat yang meng- binaan Kependidikan (UPTD-PK) seumawe mulai menjaring peserta qari/qariah terbaik. guyur Kec. Tanah Jambo Aye sepan- Tanah Jambo Aye dan Dinas Pendi- Begitu pun dalam Musabaqah Tilawatil Quran jang Jumat (6/11), membuat sejum- dikan Aceh Utara,” ujar Manan. (MTQ) Walikota mengingatkan peserta terutama harus lah kawasan terendam banjir. Bah- Kepala UPTD-PK, Tanah Jam- bernawaitu (berniat) mencari pahala. “Tegasnya, peserta kan ribuan murid dua SD Negeri bo Aye, Muhammad Isya, S.Pd, harus memahami MTQ sebagai ajang cari pahala, bukan di ujung timur Kab. Aceh Utara, Sab- Mpd yang dikonfirmasi terpisah, ajang mencari piala,” tandas Walikota Munir dalam tu (7/11), terpaksa diliburkan kare- membenarkan ribuan murid dari sambutannya pada pembukaan MTQ tingkat kecama- na luapan air merembes hingga ke SDN 1 dan SDN 7 Tanah Jambo Aye tan di Kec. Banda Sakti, Jl. Gudang kota Lhokseumawe, dalam ruang. terpaksa diliburkan karena sekolah Sabtu (7/11) malam. Pantauan Waspada, sekolah da- mereka direndam banjir. Dengan mengutip sepotong hadist, Munir Usman sar yang terendam masing-masing “SDN 1 sempat dilakukan pro- menyebut, “Bacalah olehmu Al-Quran, karena sesung- SDN 1 dan SDN 7 Tanah Jambo Aye ses belajar untuk tiga kelas yakni guhnya ia (Al-Quranulkarim) akan datang pada hari berada di Desa Rawang Iteik dan kelas 4 sampai 6. Tapi proses bela- kiamat sebagai pemberi syafaat bagi orang yang mem- bersebelahan. Ketinggian air awal- jar tidak efektif. Para siswa tidak bacanya.” nya mencapai hingga selutut orang bisa konsentrasi karena kaki mere- MTQ diikuti 240 peserta dari semua tingkatan, seba- dewasa. Sejumlah rumah serta jalan ka kedinginan dan sebagian me- gai duta 16 gampong (desa), kecuali Desa Keude Aceh, utama ikut terendam, namun sam- ngeluh gatal-gatal, sehingga para karena satu dan lain hal tidak mengirim peserta, kata pai Sabtu (7/11) sekira pukul 11:00, murid dibolehkan pulang,” jelas kabag Humas Pemko, Sofian, S.Pd, Minggu kemarin. banjir mulai surut. mantan Kepala SMAN 1 Lang- Acara berlangsung 7 – 12 November 2009, kata ketua “Banjir seolah sudah menjadi kahan itu. panitia, Yuswardi Yunus, ketika menyampaikan laporan agenda rutin setiap musim peng- Terancam Mati panitia pada pembukaan MTQ tersebut.(b10) hujan. Ini akibat kawasan sekolah Di pihak lain, hujan lebat juga berada di kawasan dataran rendah merendam ratusan hektar padi diperparah minimnya saluran pem- pasca tanam di Desa Desa Buket Bantuan Rumah Duafa buangan,” kata Kepala SDN 7 Tanah Bate Badan, Buket Padang dan Jambo Aye Mansur, A.Pd didam- Ulee Glee Kec. Tanah Jambo Aye. Berbuntut Sengketa pingi sejumlah guru, seraya menje- Ketinggian air dalam sawah, men- PANTONLABU, Aceh Utara (Waspada): Bantuan enam laskan total murid SDN 7 sebanyak capai 1 meter lebih. Kondisi itu unit rumah duafa tahun 2009 di desa kota Pantonlabu, 637 orang dan semua terpaksa dili- dikhawatirkan membuat tanaman Kec. Tanah Jambo Aye, Aceh Utara berbuntut sengketa. burkan. padi terancam mati. Apalagi kon- Salah seorang kaum duafa (calon penerima ban- Kebijakan serupa dilakukan disinya masih labil lantaran baru tuan), Abdulgani, 49, warga Dusun III Desa kota Panton- Waspada/Musyawir Abdul Manan, SPd, Kepala SDN 1 selesai tanam. labu baru-baru ini mengadukan Sekretaris Desa (Sek- Banjir yang merendam SDN 1 dan SDN 7 Tanah Jambo Aye, Aceh Utara sejak Jumat (6/11) malam. Ribuan murid Tanah Jambo Aye. Manan mengaku “Banjir terjadi akibat saluran des) ke Polres Aceh Utara, di Lhoksukon, karena merasa kedua sekolah terpaksa diliburkan, Sabtu (7/11). tidak ada pilihan lain karena semua pembuang utama dari Desa Buket haknya beralih tangan kepada orang lain. ruang sekolah termasuk kantor de- Padang hingga Biram Cut ter- “Saya yakin punya hak satu unit rumah duafa, wan guru tergenang air. Total murid sumbat dan tidak pernah dibersih- karena pernah menandatangani satu berkas proposal, SDN 1 sebanyak 470 murid. kan. Kami sudah berulangkali me- Tolak Permohonan lengkap copy KTP dan copy kartu keluarga. Kendati “Pagi hari, anak-anak pergi se- nyampaikannya kepada pemerin- setelah bantuan dari rumah itu turun dari Provinsi Aceh, kolah seperti biasa, tapi kami pu- tah kabupaten via Muspika, tapi Sekdes mengatakan, dari realisasi enam unit rumah langkan lagi karena ruang belajar tak pernah ada tanggapan serius,” tersebut tidak ada hak saya di situ, sehingga persoalan- terendam air. Kebijakan ini sudah kata Kepala Desa Buket Batee Ba- nya saya adukan ke Polres,” kata Abdulgani di Panton- kami koordinasikan dengan Kepala dan, Ansari Zakaria.(cmus) labu, Minggu (8/11). Polisi Ciduk Orang Tua Bersamaan pengaduan Abdulgani ke Polres, kor- dinator monitoring dan investigasi Lembaga Sosial Masyarakat (LSM), MaTa, Amel awal Oktober 2009 me- ngaku pernah turun ke lokasi mempelajari per- sengketaan ini. “Saya mendapat penjelasan Sekdes Desa kota Hak Uji Material Pembuang Bayi BIREUEN (Waspada): Setelah berhasil menciduk kedua orang tua Pantonlabu, Mustafa Kamal. Pengadu (Abdulgani), salah tiga hari gentayangan ke segala pe- bayi. BANDA ACEH (Waspada): Gerakan tidak taat hukum melainkan juga gota DPRA dan DPRK seluruh Aceh losok, petugas Mapolsek Peusang- “Pasca ditemukan, tim langsung sangka. Proposalnya tidak dikabulkan di tingkat Provinsi Aceh, sehingga ia tidak punya jatah terhadap bantuan Anti Kourpsi (GeRAK) Aceh prilaku yang melukai hati rakyat,” mengembalikan dana TKI dan BOP an, Bireuen, Jumat (6/11) menjelang survey ke setiap tumah bersalin, rumah duafa tersebut,” jelas Amel mengutip penjelasan kata Isra. ke kas daerah secepatnya, serta men- petang menciduk kedua orang tua rumah saki, pukesmas dan dukun mendukung sikap Mahkamah Hingga pertengahan Oktober desak anggota DPRA dan seluruh pembuang bayi yang ditemukan M. berana tradisional, akhirnya kita Sekdes Desa kota Pantonlabu. Terkait Sekdes minta uang Rp15 juta kepada penga- Agung yang menolak permohonan 2009, imbuhnya, lebih dari 60% ang- DPRK di Aceh yang belum melunasi Ali, mahsiswa Unimus, Peusangan dapatkan informasi dari di sebuah du, menurut hasil investigasi LSM MaTa, Sekdes juga hak uji material mengenai gota dewan di Aceh belum mengem- tunggakan dana TKI dan BOP segera , di bawah pohon rambutan. desa kawasan Krueng Mane, Muara berstatus sebagai warga miskin yang ikut menerima balikan dana tersebut secara penuh. mengembalikannya ke kas daerah Kedua orang tua bayi yang telah Batu, Aceh Utara, ada ibu muda Perubahan Ketiga Atas Peraturan diberi namanya Rahmi Nova ada- baru-baru ini melahirkan,” katanya. jatah batuan rumah duafa, kendati ia tidak punya tanah Dari 17 institusi parlemen yang di- masing-masing, termasuk kepada pertapakan, sehingga jatahnya itu pernah ditawarkan Pemerintah RI No. 24 Tahun 2004, monitoring, disimpulkan lebih dari anggota dewan yang telah direcall lah, Gusmawar Musa, mengaku Sementara itu kedua tersangka kepada pengadu. Tentang Kedudukan dan Protokoler 60% belum mengembalikan kedua atau mengundurkan diri. warga Desa Keude Lapang, Gan- di depan Kapolsek Peusangan, me- Abdulgani tidak punya uang Rp15 juta, sehingga tunjangan itu. Malah di beberapa “Jika ada yang tidak mengemba- dapura, yang disebut-sebut ber- ngakui perbuatannya dan menga- dan Keuangan Pimpinan dan profesi sebagai agen buah-buahan takan melakukan itu karena malu sah-sah saja kalau jatah rumah duafa milik Sekdes dijual DPRK, tingkat pengembalian masih likan, harus diberi sanksi hukum pi- kepada orang lain, urai Amel sesuai hasil wawancara Anggota DPRD yang disampaikan di bawah 10%. dana. Karena pada prinsipnya, tung- dan orang tua perempuan Ruri Rus- kepada masyarakat walaupun me- kordinator monitoring dan investigasi LSM ini dengan Ketua DPRA priode 2004-2009, Selain itu, menurut Isra, jika MA gakan dana TKI, BOP Protokoler, Ko- , nita Sari binti Kasman, 21, mengaku reka sudah menikah Juli lalu. “Saya Sekdes Desa kota Pantonlabu.(b10) warga Desa Geudong-Geudong, malu dengan masyarakat karena Sayed Fuad Zakaria. menerima hak uji material terhadap misi dan Fraksi anggota DPRA/ Kota Juang yang disebut-sebut ma- saat nikah saya hamil lima bulan,” PP No. 21 Tahun 2007, maka lebih DPRK (yang sebelumnya sudah ba- hasiswa. kata tersangka perempuan yang Jalan Cot Tufah- dari 60% penerima dana TKI dan BOP baik di tingkat DPRA maupun nyak diungkap auditor BPK RI), bu- kan delik aduan,” sebut Isra seraya Kapolres Bireuen AKBP T. Sala- din, SH melalui Kapolsek Peusang- mengaku telah melakukan hu- bungan suami isteri sebelum me- Cot Mane Berkubang “Penolakan MA sangat tepat dan perlu diberi aspresiasi tinggi karena DPRK seluruh Aceh akan bergem- bira dan berpesta dengan uang rak- meminta pihak penyidik, baik kepo- lisan maupun kejaksaan secepatnya an, Ipda Benny Cahyadi, SIk, di Ma- polsek mengatakan, anggotanya reka menikah lebih kurang tiga kali, sehingga hamil.(b03) GANDAPURA (Waspada): Jalan menghubungkan dana Tunjangan Komunikasi Intensif yat yang telah mereka jarah. Padahal memproses anggota DPRA maupun sejumlah desa di Kec. Gandapura, Bireuen, beberapa tahun terakhir hancur. Seperti jalan Desa Cot Tufah (TKI) yang telah diterima 69 anggota DPRA wajib dikembalikan,” ungkap Ke- jelas, dana TKI dan BOP pada 2006 bukan hak mereka. DPRK di seluruh Aceh yang masih punya tunggakan keuangan kepada Kecelakaan Lalin, 3 Tewas hingga ke Desa Cot Mane. Hingga kini belum ada tanda- pala Divisi Kajian dan Advokasi Kebija- “Dengan dikeluarkannya putu- negara. tanda diperbaiki. kan Publik GeRAK Aceh, Isra Safril di san MA yang menolak hak uji materil GeRAK Aceh juga mendesak BIREUEN (Waspada): Kecela- dan jalan licin diguyur hujan, mo- Menurut informasi, jalan di desa mereka terutama Banda Aceh, Sabtu (7/11). kaan maut kembali terjadi di Bi- bil mendadak tergelincir hingga atas PP No. 21 Tahun 2007, maka ke- adanya transparansi di tubuh DPRA reuen, kali ini terjadi di ruas jalan menabrak pohon di pinggir jalan Desa Cot Tufah hingga Desa Cot Mane diperkirakan 2 Hasil monitoring media GeRAK dua Surat Edaran Mendagri sebe- dan DPRK di seluruh Aceh bersama kilometer, luput dari perhatian. Padahal jalan tersebut lintas Banda Aceh-Medan, Desa Cot sebelum terjun ke sawah,” jelasnya. Aceh, hingga kini tercatat sekitar 59 lumnya yaitu SE Mendagri No. 700/ perangkat Sekretariat-nya dalam Puuk, Kec. Gandapura, Jumat (6/ Kepala Puskesmas Gandapura merupakan jalur bagi sejumlah warga yang mayoritas Anggota DPRA dan sekitar 60% anggota 08/SJ tertanggal 5 Januari 2009 dan menyikapi persoalan pengembalian petani. 11) petang. dr. Zulkarnen Adam mengatakan, DPRK di seluruh Aceh belum mengem- SE Mendagri No. 555/3032/SJ ter- dana TKI dan BOP. Karena selama Mobil Suzuki Grand Vitara BK tiga korban diduga meninggal di Sementara warga Kemukiman Buket Rata dan Buket Antara juga telah lama mengeluhkan kondisi jalan yang balikan secara penuh (lunas) dana Tun- tanggal 18 Agustus 2009, dengan ini proses pengembalian dua dana 1618 NC yang membawa rombong- lokasi dengan kondisi luka parah sekarang sulit dilintasi, terutama jalan di kawasan Desa jangan Komunikasi Intensif (TKI) dan sendirinya tidak dapat lagi dijadikan itu terkesan sangat tertutup. “Kami an keluarga dari Idi, Kab. Aceh Ti- di kepala diduga akibat benturan Cot Teubee, Pante Sikumbong, Blang Guron, Damaka- dana Bantuan Penunjang Operasional alasan bagi anggota DPRA untuk minta anggota DPRA terpilih berka- mur tujuan Banda Aceh tergelincir keras. wan, Paya Seupat, Moen Jeurijak, Cot Rambat, Tanjong (BPO), dengan tunggakan melebihi Rp6 tidak mengembalikan dana TKI dan ca pada pengalaman anggota DPRA dan manabrak pohon mahoni di “Ketiga korban tiba di UGD raya, Paya Kareung, Pulo Gisa, Tanjong Bungoeng, Tan- miliar. “Padahal, masa tugas mereka BOP,” paparnya. priode lalu, yang telah mengambil pinggir jalan. Akibatnya tiga pe- meninggal dunia, sedangkan dua joeng Mesjid dan Desa Paloh Mei. “Jalan merupakan untuk priode 2004-2009 sudah habis!. Terkait itu, GeRAK Aceh meng- dana TKI dan BOP tahun 2006,” numpang tewas di lokasi. penumpang lainnya termasuk so- kebutuhan utama untuk kami sebagai petani,” kata Kondisi tersebut bukan hanya bentuk harapkan MA mendesak semua ang- demikian Isra.(b07) Tiga dari enam penumpang pir selamat, dan mengalami luka- Nasruddin warga Desa Balng Guron.(b03) yang tewas di lokasi seluruhnya luka,” sebutnya. warga Idi, Aceh Timur, yakni Fari- Sementara itu di tempat terpi- Polisi Amankan Pengunduran Diri Rektor dah, 55, Farina, 35, dan anaknya ya- itu Farhan, 2. Sedangkan korban luka-luka Nilawati, 45, Kaiyum, 55, sah, mobil Escudo BL 346 ZW ter- jungkal ke sawah di lintas nasional Medan-Banda Aceh, kawasan Desa Sindikat Pencuri Lembu PANTONLABU, Aceh Utara (Waspada): Kepolisian Unigha Dinilai Salah serta Azhari, 52, sopir mobil, dirawat di UGD Puskemas Gandapura. Kaiyum mengatakan, mobil Pulo Lawang, Kec. Jeumpa Bireuen, Jumat (6/11). Tidak ada korban jiwa. Informasi yang diperoleh, sektor Tanah Jambo Aye Aceh Utara membongkar sindi- SIGLI (Waspada): Pengangkatan diangkat menggantikan Ir. Yamin mengundurkan diri maka yayasan disopiri Azhari, berangkat dari Idi, Escudo yang dikemudikan Tarmizi, kat pencurian sapi yang diduga kuat memilki jaringan dan pengunduran diri Ir. Aidilov seba- Areubi (alm), mestinya dilakukan harus bertindak mengisi kekosong- Aceh Timur tujuan Banda Aceh Ju- 29, warga Kec. Jeunieb terjungkal antar kabupaten di Aceh. Dua tersangka termasuk pela- gai Rektor Universitas Jabal Ghafur melalui pemilihan baru rektor oleh an jabatan itu,” katanya. mat (6/11) sekira pukul 10.00. “Ba- akibat pecah ban depan.(b03) ku utama diamankan di Desa Buket Padang, Jumat (6/ (Unigha) Sigli, Kab. Pidie dinilai banyak senat Unigha. Tidak Akan Mentolerir 11) dinihari. Kapolres Aceh Utara Ajun Komisaris Besar Polisi kalangan salah, karena tidak melalui senat akademik. Namun karena alasan darurat maka Aidilov langsung ditunjuk pi- Pertemuan Pansus VI DPRK Pidie dengan rektorat Universitas Jabal Banjir Pidie Jaya Herman Sikumbang melalui Kapolsek Tanah Jambo Aye AKP Razali, di ruang kerjanya, Sabtu (7/11) men- jelaskan, tersangka masing-masing pelaku utama US Tetapi persoalan itu tidak perlu lagi dipikirkan dan sebaiknya dilupakan, hak yayasan menjabat rektor, pada- hal saat itu Aidilov menjabat rektor Ghafur (Unigha) Gle Gapui, Sigli, yang berlangsung hingga tengah Hancurkan Dua Bendungan bin AJ, 22, warga Buket Batee Badan dan Bah bin MN, karena sudah terjadi. Sehingga upaya dua (PR dua). “Ketika itu dengan ala- malam berjalan alot, berakhir tanpa SIGLI (Waspada): Paska banjir, Sebab dua saluran irigasi terse- 26, sopir pengangkut hasil curian, warga Desa Buket untuk memperbaiki kembali lembaga san darurat pihak yayasan lngsung hasil maksimal. Kamis (5/11), yang melanda Kab. but selain berfungsi memenuhi air Alue Ie Puteh Kec. Tanah Jambo Aye. Sedangkan tiga pendidikan perguruan tiggi tersebut meng SK kan Aidilov sebagai rektor,” Karenanya direncanakan kem- Pidie Jaya mengakibatkan irigasi sawah, juga berfungsi membagi lainnya kabur dan masuk daftar pencarian orang (DPO). tidak terkendala persoalan-persolan kata Hasballah Saad. bali digelar pertemuan segi lima un- Krueng Limeng, Kemukiman Ulee air untuk kebutuhan masyarakat “Bersama tersangka disita seekor lembu betina hasil seperti itu. Mestinya, ungkap dia, pengang- tuk menuntaskan kisruh yang terjadi Gle Tunong dan Irigasi Krueng Jeu- di sejumlah perkampungan. curian milik M Yusuf, 25, penduduk Buket Bate Badan. Wakil Ketua Yayasan Pembangunan katan rektor dilakukan melalui rapat, sejak lama dan berlarut-larut di per- langa Desa Blang Miro, Kec. Bandar Kepala Mukim Ulee Gle Tunong, Komplotan ini sudah lama kita intai, namun baru kali Kampus Jabal Ghafur, Dr. Hasballah melibatkan serta mendengar pan- guruan tinggi swasta tersebut, Senin Dua jebol Kec, Bandar Dua Drs. Tgk. Zainuddin ini ada bukti. Menurut informasi, jaringan mereka cukup Saad kepada Waspada, Minggu (8/11), dangan senat akademik. Setelah itu (9/11) hari ini. Sedangkan bendungan Krueng MM, mengungkapkan irigasi Krueng luas, sampai ke beberapa kota di Aceh. Bahkan disebut- menilai persoalan Unigha tak ubah ba- dapat diputuskan siapa yang diang- Setidaknya ada 16 tuntutan ma- Kiran yang dibangun pemerintah Jeulanga berfungsi dua jalur. Satu sebut melibatkan salah seorang toke lembu sebagai gai burung masuk jaring yang sulit dile- kat menjadi rektor. “Tetapi masalah hasiswa yang belum diakomodir da- Jepang paska tsunami Aceh ambruk jalur berfungsi memenuhi kebutu- penadah,” urai AKP Razali. pas. Termasuk dalam persoalan peng- inikan sudah berlalu, suka tidak suka lam pertemuan Pansus VI DPRK dan tak berbekas. Padahal bendungan han air penduduk dalam memper- Sesuai pengakuan korban dan tersangka, lanjut Ka- angkatan rektor dan pemberhen- ini sudah terjadi.” pihak Unigha. Di antaranya ada em- tersebut baru siap dibangun dua oleh air bersih dan MCK, sedangkan polsek, US bin AJ mencuri lembu M Yusuf dari kandang tiannya. Sekarang ketika Aidilov menya- pat hal yang dianggap sangat pen- bulan lalu. Akibatnya ribuan hektar satu jalur lainnya digunakan me- dekat rumah korban, Kamis (5/11) dinihari. Selanjutnya sawah roduktif terancam tidak bisa nyuplai air ke sawah-sawah. dibawa US ke gudang di Desa Buket Padang, desa te- Menurut mantan Menteri Negara takan mundur, maka jabatan rektor ting dan urgen untuk dibahas, yakni Hukum dan Ham itu, pengangkatan dan PR satu yang dirangkapnya tidak pihak yayasan memperjelas surat bercocok tanam, karena petani ke- Kabid Distribusi dan Ketaha- tangga Buket Batee Badan. Saat hendak diangkut sulitan mengairi sawah. nan Pangan pada Badan Ketahan dengan mobil L 300 hitam disopiri MN, kepergok korban Ir. Aidilov sebagai pejabat rektor yang ada lagi. Sementara PR dua sudah izin operasional kampus, akreditasi, Pengamatan Waspada, Jumat Pangan dan Penyuluhan (BPKP) yang memang sedang mencari hewan piaraannya itu. struktural dan tempat belajar. (6/11), selain warga petani kesulitan Pidie Jaya Zainuddin SP mengung- , “Ketika korban dan tersangka bertemu, salah se- orang tersangka salah tingkah seraya meminta korban Lab SMAN I Peusangan Pada pertemuan Jumat lalu hingga tengah malam, pihak rektorat mengairi sawah, rusaknya ben- dungan irigasi juga menyebabkan kapkan ribuan hektar sawah di Bandar Dua yang terkena imbas membawa pulang lembu tersebut jika memang itu mi- tidak mampu menjelaskan dan ribuan jiwa warga Bandar Dua, Pi- banjir perlu penanganan serius. liknya. Seusai dialog, tersangka menurunkan dan me- nambat lembu korban dekat jalan, sementara korban Selatan Tanpa Alat membuktikan sejumlah alasan yang ditanya Pansus VI, seperti tanda buk- die Jaya kesulitan memperoleh air bersih yang digunakan untuk Man- Karena dikhawatirkan sawah-sa- wah tersebut tidak dapat diman- sendiri bergegas melapor ke Mapolsek. Beberapa jam BIREUEN (Waspada): Kendati SMA sudah cukup,” terangnya seraya me- ti proses perizinan kampus dan akre- di dan Cuci Kakus (MCK). faatkan.(b20) kemudian, tepatnya Jumat (7/11) sekira pukul 00:20, Negeri I Peusangan Selatan Kabupaten nyebutkan, meski masih serba ke- ditasi yang dinyatakan pihak rektorat US dan MN berhasil kita tangkap dari rumah masing- Bireuen sudah memiliki gedung labora- kurangan SMA ini mampu me- sudah diurus. Namun ketika Pansus masing,” imbuh Kapolsek.(cmus) torium (Lab) yang bagus, namun hing- luluskan siswa mencapai 99 persen meminta keaslian dokumen peng- ga kini belum memiliki peralatannya pada ini. urusan, pihak rektorat tidak mampu guna mendukung praktikum siswa. Untuk praktikum multimedia, membuktikan, bahkan pihak rekto- Kepala SMA Negeri I Peusangan Se- lanjut dia, para siswa terpaksa me- rat mencoba memutarbalik fakta latan, Hanafiah, S.Pd didampingi Ca- ngeluarkan biaya menyewa kom- dengan alasan tidak rasional. mat setempat, Dahlan, SE kepada Was- puter di warung internet (warnet). Menurut Ketua Pansus VI DPRK pada menuturkan, ruang lab Fisika, “Mereka setiap Jumat didampingi Pidie, Drs. Sabirin kepada wartawan, Biologi, Kimia, dan ruang multimedia gurunya ke warnet, biayanya juga Sabtu (7/11), pihak rektorat Unigha yang dibangun NGO asal Jerman, RESA, mereka tanggung masing-masing,” tidak mampu menunjukkan bukti hingga kini belum dapat difungsikan. ucap Hanafiah. otentik dokumen pengurusan izin “Gedung dari bantuan sudah me- Sebelumnya, Hanafiah juga wah, tapi peralatannya tidak ada dan menyebutkan, selain peralatan lab, operasional dan akreditasi, bahkan tidak dapat digunakan juga,” ungkap SMA Negeri I Peusangan Selatan mereka mencoba mengelabui Pan- Hanafiah. Akibatnya, para siswa tidak juga masih kekuarangan buku. “Kita sus dengan berbagai argumen dan dapat melaksanakan praktikum seba- dibantu oleh RESA termasuk ruang teori. gaimana layaknya sekolah lain yang perpustakaan, ruang guru, lokal, tapi Pansus VI DPRK tidak akan men- memenuhi peralatan lengkap. bukunya yang masih sangat minim,” tolerir semua pernyataan rektorat Waspada/ Musyawir Dia menjelaskan, jika hal ini tidak keluhnya. sebelum memenuhi tuntutan maha- TERSANGKA: Aparat Polsek Tanah Jambo Aye, Aceh segera diatasi tentu akan mempenga- Dia menyebutkan, perpustakaan siswa yang selama ini merasa diper- Utara mengapit US dan BM (menunduk), tersangka ruhi kemampuan anak didik dalam SMA ini hanya memiliki delapan mainkan. Karena itu Pansus men- komplotan pencuri lembu yang ditangkap di Desa Buket melaksanakan praktikum di perguruan judul buku pelajaran kelas I, dimana desak rektorat memenuhi sejumlah Waspada/Muhammad Riza Padang, Jumat (6/11) dinihari. tinggi. “Kalau tenaga pengajar mata setiap judulnya hanya memiliki tuntutan mahasiswa, sebut Sa- BENDUNGAN JEBOL: Kondisi bendungan irigasi Krueng Limeng, Kec. pelajaran Fisika, Kimia dan Biologi sekira 80 eksemplar. (cb03 birin.(b20/b21) Bandar Dua, Kab. Pidie Jaya yang rusak akibat banjir, Kamis (5/11).
    • 22 Aceh WASPADA Senin 9 November 2009 Abdya Tak Butuh Tambahan CPNS BLANGPIDIE (Waspada): Kabupaten kebutuhan pegawai juga sedikit. “Sekali lagi Aceh Barat Daya kelihatannya tidak memer- saya katakan, saya baru di sini, jadi tolong lukan penambahan Calon Pegawai Negeri konfirmasi langsung pada Kepala BKD, be- Sipil (CPNS) tahun 2009. Buktinya, penerima- liau lebih mengerti masalah ini,” elaknya. an CPNS daerah tidak dibuka. Padahal kabu- Jufrizal juga mengakui, sedikit tidaknya paten lainnya di Provinsi Aceh semuanya tidak dibukanya peluang penerimaan CPNS membuka peluang bagi putra daerah untuk di Abdya, ada hubungannya dengan devisit jadi PNS. anggaran yang melanda daerah breuh sigeu- Beberapa kalangan yang menghubungi pai ini. “Tapi saya mengatakan ini kemung- wartawan Sabtu kemarin mengatakan, sangat kinan, paling tidak sedikit pasti ada hu- menyayangkan kebijakan yang dianggap bungannya dengan devisit anggaran,” tam- menghalangi putra daerah meraih masa de- bahnya. pan mereka, setelah bertahun-tahun menun- Sementara Kepala Badan Kepegawaian tut ilmu. “Ini penzaliman tersembunyi dilaku- Daerah (BKD) Kabupaten Abdya, Drs Nas- kan Pemkab Abdya terhadap rakyatnya,” ujar ruddin,M.Hum yang dihubungi juga terke- seorang honorer Setdakab Abdya yang me- san mengelak memberi keterangan. Soalnya ngaku sudah 5 tahun bekerja sebagai tenaga saat menduduki jabatan tersebut, kebijakan honor di kantor Setdakab. tidak menerima CPNS tahun 2009 sudah Pegawai honorer yang keberatan ditulis diambil jauh-jauh hari. “Kami hanya menja- identitasnya bersama dengan dua belas lankan kebijakan terdahulu, silakan tanya- rekannya itu meminta Pemkab Abdya mem- kan langsung pada Kepala BKD terdahulu,” pelajari kembali kebijakannya. “Kita juga kilahnya. ingin meraih masa depan, bukan hanya tena- Nasruddin hanya bisa menjelaskan ga honorer seumur hidup,” ucapnya. jumlah PNS di Kabupaten ini berkisar di Sementara Plt Setdakab Abdya Drs.Jufri- atas 3600 orang, jika dibandingkan dengan zal S Umar yang ditemui wartawan sehari jumlah penduduk sebanyak 121.000 orang, sebelumnya menjelaskan, pada dasarnya maka jumlah pegawainya memang sudah Kabupaten Abdya memiliki pegawai daerah lebih dari cukup. “Saran saya, sebaiknya sudah lumayan jumlahnya. Apalagi ditunjang tanyakan pada Pak Tantowi langsung,” kata dengan pegawai honorer yang banyak, se- mantan Kadis Pendidikan Abdya ini yang Waspada/Muhammad H. Ishak hingga untuk tahun ini dirasa tidak perlu sudah ditetapkan sebagai tersangka oleh PUTUS: Akibat banjir landa pantai timur Aceh, sejumlah jalan utama di beberapa desa hancur. Tanpak Ketua DPRK Aceh Timur, Tgk. Hasanuddin didampingi membuka penerimaan CPNS. “Tapi yang Kejari Blangpidie dalam kasus penyele- anggota DPRK dari Fraksi PA, Abdul Hamid, serius menerima aspirasi masyarakat terkait banjir di di Desa Seuneubok Teungoh, Kecamatan Darul Aman— pasti saya baru menduduki jabatan Plt Sekda wengan dana DAK 2007 dengan taksiran Idi Cut, Aceh Timur. Foto diambil, Sabtu (7/11). ini, jadi saya belum begitu faham dengan kerugian negara Rp1,8 miliar. Ribuan Bedengan Gabah Karam keadaannya,” ujarnya. Sayangnya sampai berita ini diturunkan, Kebutuhan pegawai pada suatu daerah mantan Kepala BKD Abdya Tantowi, S.Sos menurut dia, harus merujuk pada jumlah yang kini menjabat Asisten III Setdakab penduduk daerah. Bila penduduknya banyak, Abdya, belum dihubungi, karena tidak otomatis kebutuhan pegawai juga mening- berada di tempat, sedangkan ponselnya, kat, tetapi bila penduduknya sedikit maka tidak aktif. (b19) IDI, Aceh Timur (Waspada): rendah itu karam. pembuangan sama sekali ti- ada tanda-tanda akan dilaku- “Kita segera panggil instansi SMKN 2 Langsa 10 Besar Nominasi Guyuran hujan akhir pekan lalu mengakibatkan proses Meski ketinggian air belum ada tanda-tanda surut di se- jumlah desa di pedalaman dak ada, karena ditumbuhi rumbia. “Penyebab banjir ada- lah tok karena tidak ada lagi kan pengerukan sungai terse- but yang panjangnya menca- pai 10 kilometer lebih. “Kita terkait untuk segera dilakukan normalisasi sungai di Idi Cut yang mengakibatkan banjir Sekolah Mandiri Teknologi Indonesia belajar mengajar (PBM) macat. Selain itu, ribuan Aceh Timur, namun hingga kini belum ada laporan masya- sungai, tapi jika ini dibersihkan maka air akan lancar dan ban- telah usulkan, bahkan bupati sendiri telah berjanji, tapi setiap tahun ini,” sebutnya. Jika hal tersebut tidak di- rakat yang mengungsi. Ribuan jir tidak akan terjadi lagi,” sebut hingga kini belum juga ada lakukan, lanjut Tgk. Hasanud- LANGSA (Waspada): Sekolah Menengah yang lebih maksimal. bedengan (tempat warga yang rumahnya sedikit Jabar, tokoh pemuda Idi Cut. hasil,” sebut Isa. din, maka beberapa desa di Idi Kejuruan (SMK) Negeri 2 Langsa tercatat da- Kepala Dinas Pendidikan Kota Langsa persemaian padi—red) tegenang masih bertahan di Hal sama juga diungkap- Sementara Ketua DPRK Cut dan sekitarnya tidak akan lam 10 besar SMK terbaik sehingga kemudian Drs. Abdullah Gade, MPd menyambut milik petani gabah di rumahnya masing-masing. kan Geuchik Seuneubok Teu- Aceh Timur, Tgk. Hasanuddin dapat bercocok tanam. “Mas- masuk dalam daftar nominasi teknologi man- gembira atas terpilih dan masuknya SMKN Hal yang sama juga terjadi ngoh, M. Isa. Menurutnya, pi- didampingi, anggota DPRK yarakat disini seluruhnya sa- diri di Indonesia. Demikian Kepala SMK Ne- 2 Langsa dalam jajaran sekolah terbaik 10 sejumlah wilayah dalam di Kecamatan Julok dan Nu- haknya puluhan kali telah Aceh Timur, Tgk. Abdul Ha- wah tadah hujan, jika norma- geri 2 Langsa Drs. Makmur Lingga, MPD ke- besar nasional. Di satu sisi, kata Abdullah Kabupaten Aceh Timur, russalam serta Indra Mak- mengusulkan normalisasi alur mid, kepada Waspada di lokasi lisasi ini tidak dilakukan maka pada Waspada di Langsa, Sabtu (7/11). Gade, prestasi itu kabar menggembirakan, ikut karam. mur—Alue Ie Mirah. Banjir (sungai—red) yang menghu- mengatakan, pihaknya telah banjir berkepanjangan mem- Informasi menggembirakan itu diperoleh namun di sisi lain jelas sebuah tantangan masih menghantui wilayah itu bungkan beberapa desa disa- melihat langsung kondisi desa buat petani gabah menderita,” Makmur Lingga ketika dia mengikuti Rapat yang harus dibuktikan dan diwujudkan ke- pasca guyuran hujan lebat na, tetapi hingga kini belum yang terimbas banjir di Idi Cut. tandasnya. (cmad) Koordinasi (Rakor) SMK Sekolah Berstandar pada dunia pendidikan secara keseluruhan. Diperkirakan, jika hujan yang melanda wilayah terse- Internasional (SBI) selama seminggu di Ban- Diakuinya, SMKN 2 Langsa selama ini dung, Jawa Barat akhir Oktober lalu. Lingga mengakui, tidak tahu data 9 sekolah lainnya, telah mencatat berbagai prestasi yang sangat membanggakan. Beberapa prestasi terus mengguyur, maka dikha- watirkan banjir musim ini akan terus mengepung pantai timur but selama dua hari terakhir. Ekses yang paling mempri- hatinkan akibat banjir kali ini Dewan Soroti Dana namun dipastikan SMKN 2 Langsa menjadi nasional berhasil diperlihatkan anak didik. satu-satunya di Aceh, bahkan di Sumatera. Begitupun, Makmur Lingga mengatakan, Bahkan dalam beberapa even, siswa SMKN 2 Langsa berhasil menoreh penghargaan Aceh. Pengamatan Waspada, Sabtu (7/11) pagi, keting-gian air di beberapa jalan utama da- yakni, puluhan meter pagar permanen milik Masjid Baitul Baraqah di Desa Seuneubok Kompensasi TNGL Rp3 T sembilan SMK lainnya berasal dari Provinsi internasional. Sebab itu, SMKN 2 Langsa diberi lam Kecamatan Darul Aman— Teungoh, Idi Cut, rubuh. Selain DKI, Jabar, Jatim, Jateng dan Bali. “Yang pasti, kewenangan untuk melakukan uji kompetensi BLANGKEJEREN (Waspa- Sabtu (7/11) di gedung dewan but.Sedangkan hutan dan Idi Cut, mulai menurun. itu, lintasan jalan utama yang da): Dewan Perwakilan Rakyat setempat. TNGL itu sendiri tidak mampu dari kelima daerah ini ada SMK N 2 Langsa siswa di daerah Serambi Mekkah. Tetapi di areal persawahan menghubungkan puluhan yang masuk nominasi 10 besar,” katanya lebih Sebagai sekolah berstandar internasio- Kabupaten (DPRK) Gayo Lues “Kita harus berani menen- memberi mamfaat langsung air masih tergenang. Bahkan, desa di desa itu juga putus. Se- mengatakan, hendaknya pe- tang pegiat-pegiat lingkungan bagi masyarakat kita dalam lanjut. nal (SBI), SMKN 2 Langsa telah menjalin seperti di Desa Gampong Keu- hingga seluruh material jalan Menurut Kepala SMKN 2 Langsa itu, saat kerjasama dengan sejumlah lembaga pendi- giat-pegiat lingkungan tidak yang mendapat ratusan jutaan bentuk apapun,” tandasnya. de, Kumuning III, Kumuning berkumpul ke sawah. mengambil keuntungan dari dolar dari benua Amerika dan Amru mengajak delapan ini di Indonesia terdapat 8/764 SMK yang dikan asing sehingga sertifikat yang dike- IV dan beberapa desa lainnya Menurut informasi dari bertebar mulai dari Sabang sampai Marauke. luarkan kepada siswa yang mengikuti uji kawasan TNGL untuk mem- Eropa dengan menjual isu kabupaten yang daerah seba- di wilayah Idi Cut, air masih masyarakat, banjir terjadi kare- perkaya diri sendiri. lingkungan dan Taman Nasio- hagiannya masuk dalam ka- Oleh karena itu, masuknya SMKN 2 Langsa kompetensi, berlaku secara internasional tergenang dalam pekebunan, na tersumbatnya aliran sungai. dalam daftar nominasi 10 besar sekolah man- dalam bidang ketenagakerjaan. Puluhan “Kami mendengar dari nal Gunung Leuser (TNGL) wasan TNGL itu meliputi, sehingga membuat puluhan Bahkan, seperti di Desa Seu- karbon trade,perdagangan itu,” katanya. Aceh Tenggara, Aceh Selatan, diri teknologi di Indonesia, sebuah prestasi siswa lulusan SMKN 2 Langsa, saat ini se- rumah yang berada di dataran neubok Teungoh, saluran yang luar biasa. Makmur Lingga berjanji akan dang bekerja di luar negeri, khususnya ka- karbon, yang konon nilai kar- Dikatakannya, untuk Abdya, Singkil, Subulussalam, bon yang di produksi hutan itu mengurus hutan itu kabupa- Aceh Tengah dan Bener Me- terus meningkatkan kualitas dan perannya wasan Timur Tengah. (b26) Usut Dugaan Kasus Korupsi bila diuangkan senilai Rp3 tri- ten setempat juga masih riah serta Gayo Lues mendob- Hasil Pansus Proyek IDB Kejari Kutacane Bentuk Tim liun pertahun.Tidak pernah di- kompensisasikan terhadap masyarakat kita,” Demikian mampu dan tidak diperlukan campur tangan asing.Terlebih lagi pihak luar yang hanya rak penjajahan lingkungan itu. Dalam acara pengukuhan itu nampak hadir Ketua DPRK Tidak Dipublikasikan KUTACANE (Waspada): Kepala Kejaksaan Negeri Kuta- pemanggilan terhadap pim- pinan SKPD yang membi- Ketua DPRK setempat, HM. Amru yang baru saja dikukuh- ingin memperkaya diri sendiri. “Kondisi rakyat kita kian mela- Aceh Tenggara, Kapolres, Kas- dim 0113 Gayo Lues, bupati cane, Taufik Hidayat SH me- dangi Pemberdayaan Masya- kan Mahkamah Agung sebagai rat,banyak investor yang kece- dan para Kadis, Kabag, alim SIMEULUE (Waspada): Ketua Tim Panitia Begitupun, pihak Dewan setempat nyatakan, membentuk tim rakat, Kepegawaian Daerah Ketua DPRK Gayo Lues perio- wa karena di sekat-sekatnya ulama serta lapisan berbagai Khusus (Pansus) DPRK Simeulue, Rahmad usai menjelaskan laporan Pemegang Kuasa menindaklanjuti dugaan kasus dan Multi Chanel serta dugaan de 2009-2014 mendatang, hutan dan TNGL terse- masyarakat.(cb01) meninjau sejumlah proyek Islamic Develoment Pengguna Anggaran Proyek IDB di Si- korupsi yang diduga terjadi kasus korupsi lainnya, pihak Bank (IDB) di sana menyatakan sementara meulue, Drs. Kusmayadi MM. Bahkan ada waktu hasil Pansus perdana DPRK Simeulue priode 2004-2009 tidak dipublikasikan. Pernyataan ketua tim Pansus DPRK Si- yang menengarai laporan itu bohong. Dia menyatakan keengganan itu kemungkinan disebabkan banyak hal. pada sejumlah SKPK di Agara. Kesiapan itu disampaikan Kajari Kutacane, Taufik Hida- Kajari Kutacane, dalam waktu dekat akan membentuk tim. ”Saya sudah perintahkan Ling- Gubernur Diminta meulue untuk proyek IDB, dan sejumlah ga- lian C di sana, Rahmad, yang berlatar bela- Tak heran Sekretaris tim Pansus Marja- kub dan anggota Pansus M. Andi, Johan Jal- yat SH kepada Waspada, Jumat (6/11) menyikapi tindak lanjut pemanggilan terhadap sejum- ga sebagai pejabat sementara Kasi Intel Kejari Kutacane un- tuk membentuk tim itu.” Naturalisasi Sungai Langsa kang jurnalis ini mengejutkan publik. Ketika lah dan Asnawi serta Kamaria, Elidar Oes- lah kepala Satuan Kerja Pe- Setelah tim yang berang- LANGSA (Waspada): Gu- scape Development Centre air disaat adanya peningkatan dihubungi kembali Waspada, Minggu (8/11) man dan Aryani mengajukan sejumlah per- rangkat Kabupaten (SKPD) ke gotakan unsur dari beberapa bernur Aceh, Irwandi Yusuf, (ALDEC), Edi Syahputra, ST, volume air. pihaknya menyatakan pada prinsipnya tanyaan tentang kejanggalan dalam pelak- Kantor Kejaksaan beberapa Seksi, Kejari, kata Taufiq akan diminta untuk menaturalisa- di Langsa, Minggu (8/11). “Program naturalisasi akan sangat memahami tugas pers. sanaan proyek IDB di lapangan. bulan lalu. memanggil dan memeriksa sikan sungai Kota Langsa. Pa- Menurutnya, kondisi memberikan stabilitas ekosis- “Maafkan saya teman-teman dari pers. Koordinator pengawas semua proyek “Sampai hari ini, Kejaksa- oknum pimpinan SKPD mau- salnya, pasca proyek peluru- sungai Langsa cukup sensitif tem sungai Langsa dengan Saya sangat paham dengan tugas Jurnalis IDB di Simeulue Sri Hascaryo menyatakan an belum menjadikan satu pun pun pemimpin kegiatan yang san Krueng Langsa ternyata terhadap peningkatan volume berbagai fungsi kegunaannya, yang sangat-sangat mulia. Tapi saya maklum- seluruh pekerjaan di lapangan sudah sesuai berkas perkara korupsi dan telah menghadap di bagian memberikan dampak negatif air, khususnya pada musim seperti kawasan konservasi, kan kepada teman-teman semua, bahwa ke- dengan bestek dan kontrak kerja. Kecuali penetapan tersangka maupun Seksi Intel. terhadap ekosistem Daerah hujan dengan intensitas yang sumber air bersih, habitat be- putusan di lembaga DPRK bukanlah keputu- ada sebagian item yang kurang baik. Tapi yang dilimpahkan ke Penga- ”Bila dari hasil pe- Aliran Sungai (DAS) setempat. tinggi. Sebelum dilakukan pro- berapa satwa dan fauna,” san perorangan atau boleh oleh ketua saja. kata Sri Hascaryo karena proyek belum sele- dilan Negeri, terutama untuk meriksaan terbukti melakukan Hal itu juga sekaitan de- yek pelurusan Krueng Langsa sebut Edy. Tetapi mengacu kepada suara terbanyak. Jadi sai hal itu tidak bisa disebut sebagai suatu kasus yang muncul di tahun tindak pidana korupsi, berkas- ngan pelurusan bantaran su- disaat volume air meningkat, Ditambahkan, nantinya saya mohon pahami-lah posisi saya semen- kesalahan dan pihak kontraktor akan mem- 2009, kalau pun ada dilimpah- nya kita siapkan, dan kasusnya ngai telah mengakibat kecepa- masih bisa masyarakat me- dimana penataan Krueng tara ini,” ungkapnya dengan mengiba. perbaikinya.(cmr) kan, masih kasus lama,” tan- pun akan kita limpahkan ke tan debit tinggi di saat menga- nyeberang badan sungai terse- Langsa berpedoman kepada das Taufik Hidayat. Pengadilan Negeri Kutacane,” liri badan sungai dibanding- but tapi saat ini kecepatan de- aturan yang berlaku seperti Senjata AK-47 Ditemukan Untuk menindaklanjuti pungkas Taufik Hidayat.(cb01) kan dengan sebelumnya yang memiliki landscape (bentang- bit airnya memberikan danger signal (tanda bebahaya) bila UU tentang Tata Ruang, UU Nomor 23 tentang Pengelola- MADAT, Aceh Timur (Waspada): Senjata Melihat aneh, lalu dia meletakkannya Pelayanan Dokter Spesialis an alam) yang masih berkelok- kelok. m a s y a ra k a t i n g i n m e l e - watinya. an Lingkunag Hidup dan UU tentang Kehutanan. “Selanjut- api laras panjang jenis AK-47 semi otomatis kembali di tempat semula. Setelah diberita- buatan China di temukan saat membersih- hukan kepada rekannya yang sedang gotong Di RSUD Abdya Lumpuh “Karenanya, diminat di- minta kepada Pemerintah Dia mengharapkan, Peme- rintah Aceh segera mengem- nya program naturalisasi ini harus dilengkapi dengan do- kan parit jalan di Desa Seuneubok Pidie, Ke- royong, lalu dilaporkannya ke kepala desa camatan Madat, Kab. Aceh Timur, Provinsi setempat yang selanjutnya diteruskan ke BLANGPIDIE (Waspada): waktu lalu. Aceh agar melakukan Natura- balikan bentukan DAS Krueng kumen lingkungan seperti Aceh, Jumat (6/11) sekira pukul 16:00. Mapolsek Madat. Kemelut perseturuan seorang Bahkan permasalahan lisasi (pengembalian bentukan Langsa sesuai dengan river- AMDAL, dan UPL serta UKL Menurut informasi yang diperoleh dari Tak lama sejumlah personel polisi turun dokter spesialis dengan empat dirinya dengan empat anggota alami-red) sungai Langsa da- scape (bentukan alam su- untuk memberikan kelanjutan warga di lokasi pada hari itu menyebutkan, ke lokasi mengecek kebenarannya. Setelah anggota DPRK Aceh Barat DPRK Abdya yang terdiri dari lam mengatasi proses pengiki- ngai—red). Yakni berkelok-ke- terhadap pemanfaatan sum- penemuan senjata berawal ketika puluhan mendekat ke lokasi, ternyata benar temuan Daya, kelihatannya terus ber- Nasrullah.Us dan Lukman,SE san sepanjang DAS,” demikian lok yang berfungsi untuk ber daya alam,” tandasnya. warga di desa itu sedang membersihkan parit masyarakat tersebut merupakan senjata buntut panjang hingga ber- (Partai Demokrat), Musli- Manager Program Aceh Land- mengurangi kecepatan debit (cmad). jalan untuk kebersihan lingkungan menje- semi otomatis mirip AK-47 buatan China. dampak buruk terhadap pela- zar,MT (PAN), dan Arjuna lang turun sawah. Ketika itu polisi memperkirakan, senjata yanan kesehatan di RSUD (PKPB), saat ini sedang di- Di tengah kegiatan gotong royong terse- tersebut salah satu senjata sisa konflik. Abdya. Kondisi itu terjadi aki- tangani Polres Abdya. “Ya, me- but, tiba-tiba seorang warga, Muhammad, Kapolres Aceh Timur, AKBP Drs Ridwan bat tiga dari empat dokter spe- mang saya telah diminta pihak 45, petani setempat melihat besi panjang Usman kepada Waspada, Sabtu (7/11) sialis yang bertugas di sana, Polres Abdya memberikan ke- dicelah-celah rumput parit. Dianggap besi membenarkan penemuan senjata tersebut. kini hengkang dan tidak lagi terangan setelah para anggota biasa dia langsung mengambilnya. Saat dili- “Barang bukti telah kita amankan,” tandas memperpanjang kontrak DPRK, saya laporkan dalam hat mirip senjata api yang biasa digunakan perwira asal Montasik Aceh Besar itu. kerjanya. kaitan pencemaran nama baik aparat keamanan. (cmad/cmus). Dokter Spesialis yang telah saya di media,” ucapnya. meninggalkan Abdya sejak Menurut dia, hengkang- tanggal 1 November, di antara- nya dari RSUD Abdya karena nya Dr. Fauzi, Sp.B (spesialis merasa tidak “dihargai” dan bedah), Dr. Fuad, Sp.THT (spe- sikap dari para pengelola sialis THT ) dan Dr. Rizky, RSUD dinilai tidak netral, bah- Sp.OG (spesialis kandungan). kan disinyalir ada semacam Sedangkan spesialis penyakit usaha menyingkirkannya. dalam Dr. Rudi, Sp.PD, masih “Kita kasihan masyarakat, melanjutkan kontrak kerjanya sebagai pihak yang dirugikan,” hingga Desember mendatang. katanya. Hengkangnya para dokter Sementara Pinayungan spesialis tersebut dikemuka- Daulay, Pimpinan PT.Askes di kan Dr.Fauzi,Sp.B kepada War- Blangpidie yang nama perusa- tawan pada Kamis, pekanlalu. haan asuransinya ikut dibawa- Menurut Fauzi, tindakan itu bawa dalam kemelut itu, kepa- dilakukan sebagai bentuk si- da wartawan secara tegas me- Waspada/Muhammad H. Ishak kap “pembelaan korp” atas nyatakan pelayanan terhadap SENPI: Tampak Kapolres Aceh Timur, AKBP Drs Ridwan Usman memperlihatkan senpi perlakuan pihak dewan yang pemegang kartu ASKES, tidak rakitan Janis AK-47 semi otomatis yang temukan warga ddi parit jalan di Desa Seuneubok menuding dirinya telah mela- terpengaruh dengan heng- Pidie, Kecamatan Madat, Kab. Aceh Timur, Jumat (6/11) sore. kukan pemerasan terhadap kangnya para dokter spesialis pasien Jamkesmas beberapa tersebut.(b19)
    • WASPADA Senin 9 November 2009 Ekonomi & Bisnis 23 Inspirasi Bisnis Pemerintah Pangkas 4 Pengamat & Praktisi Manajemen Cahyo Pramono Promosi Tanpa Mulut PEREMPUAN itu mere- Kendala KUR tujuan yang akan dilewati. BOGOR (Waspada): Pe- “Sepanjang lima tahun uang yang mereka dapatkan wa mengatakan, selama ini ngut saja, mukanya jutek, Tanpa mulut merintah akan memangkas mendatang, tak kurang Rp100 melalui KUR dapat berkem- kendala KUR yang disalurkan lelah dan bosan. Tiap ada ta- Membiarkan tim promosi/penjualan mengandalkan empat kendala penghambat triliun dana KUR bakal dige- bang,” tuturnya. bank BUMN tidak semuanya mu yang datang, tanpa di- mulutnya adalah langkah yang kurang bijaksana. Tentu penyaluran Kredit Usaha lontorkan,” ujar Pras. Dua tahun lalu, lanjut Avi- memiliki jaringan kuat hingga minta secara otomatis dia harus ada media-media bantu yang memudahkan penjua- Rakyat (KUR) dalam lima ta- Dengan pemangkasan liani, yang banyak terjadi yakni mencapai ke pelosok desa. menyodorkan selembar kar- lan bahkan ketika seseorang tidak bisa mengucapkannya. hun ke depan. kendala tersebut, jelas Pras, para nasabah KUR tidak bisa “Bank yang menjadi pe- tu nama dengan ekspresi datar. Terlihat ada beberapa orang Buatlah media promosi yang membantu meringankan Hal ini disampaikan De- diharapkan dapat mengatasi mengelola keuangannya de- nyalur KUR utama memang yang berusaha bertanya kepadanya tetapi ia langsung menyi- beban mulut. Informatif, singkat, efktif dan mengundang. puti Bidang Kemiskinan, Ke- persoalan yang menghambat ngan baik sehingga menim- bank besar,” katanya dalam bukkan diri dengan menundukkan kepala. Apalagi informasi itu adalah informasi yang jamak ditanya. tenagakerjaan, dan UKM pelaksanaan KUR. Menurut bulkan kredit macet ataupun pesan singkat yang diterima. Pada pameran promosi yang cukup mahal ini, perem- Mudah menjawabnya dan berulang kali ditanyakan. Prasetijono Widjojo dalam ekonomi INDEF, jika tidak di- berhenti usaha. Selain itu Purbaya me- puan penjaga stand tadi tidak lagi memikirkan betapa pen- Dalam pengamatan saya, para penjual yang selalu acara temu media di Puncak, berikan sebuah pembinaan “Pangsa pasar KUR itu di- ngatakan, untuk di masa yang tingnya promosi dan penjualan produknya. Dia terjajah terjebak dalam menjawab pertanyaan rutin bukan tidak Bogor, Jumat (6/11) malam. kepada nasabah, KUR dapat berikan kepada masyarakat akan datang perlu juga diper- oleh rasa bosan dan lelah yang berlebihan. Betapa sebuah pintar, tetapi mereka kadang tidak menyadari betapa Pras menyatakan persoa- berpotensi menjadi kredit ber- dengan pinjaman Rp5 juta ke hatikan dampaknya bila sudah promosi yang kontra-produktif. berulang kali mereka menjawab pertanyaan yang sama lan penyaluran KUR itu an- masalah di tahun 2010. bawah, jika ada sebuah pem- mencapai Rp100 triliun akan Penasaran dengan pemandangan itu, saya mendekat dan mereka tidak menyadari arti penting pesan-pesan tara lain besaran bunga kre- Ekonom INDEF Aviliani binaan dari pemerintah maka mengganggu kinerja Bank dan menawarkan kopi panas dalam kemasan sekali pakai. tertulis itu. dit yang masih tinggi, sasaran mengatakan pembinaan me- mereka bisa meningkatkan Perkreditan Rakyat (BPR). Sesaat setelah saya ajak bercanda, si perempuan ini mulai Jangan heran ketika banyak penjual yang sulit senyum kredit, persyaratan penjami- rupakan hal yang sangat pen- pinjaman mereka dan me- “Ada baiknya BPR yang menampakkan senyum manisnya. Ternyata perempuan selama melayani pembeli karena kesalahan rutinitas nan yang ketat, dan terbatas- ting disamping permodalan. ngembangkan usaha mereka,” baik dipertimbangkan untuk pemilik senyum mempesona ini menjadi korban cara ber- tersebut. nya bank penyalur kredit “Pemerintah saat ini hanya jelasnya. dilibatkan dalam penyaluran promosi yang masih primitif. Membahas “tanpa mulut”, juga harus dilakukan di ma- yang rata-rata bank BUMN. concern di bidang permoda- Selain itu menurut Aviliani, KUR secara berangsur angsur,” Perempuan penjaga stand pameran ini merasa muak terial promosi/penjualan yang tertulis tersebut. Sampai “Persoalan penyaluran lan saja, namun pembinaan penting juga diberikan pembi- jelasnya. Purbaya menambah- setelah menjawab pertanyaan yang sama selama lebih dari sekarang masih banyak penjual yang harus berbicara men- KUR itu antara lain besaran kepada masyarakat masih naan mengenai peningkatan kan untuk soal suku bunga, 6 jam pameran. “Mbak, harganya berapa,” akunya sambil jelaskan brosur atau surat penawaran yang disampaikanya. bunga kredit yang masih kurang padahal ini merupakan kualitas produk sehingga tidak KUR sebaiknya diusahakan menyeruput kopi panasnya. Singkat cerita, saya iseng-iseng Betapa sebuah pekerjaan yang sia-sia. Informasi tertulis tinggi, sasaran kredit, persya- sebuah hal yang penting,” merugikan konsumen. Seperti agar tidak terlalu tinggi di atas menuliskan besar-besar sebuah harga di kertas HVS dengan yang dibuat tidak cukup menginformasikan segala-se- ratan penjaminan yang ketat, ujarnya. pedagang kaki lima yang men- bunga yang normal untuk pe- spidol tebal. Hanya Rp15.000 per kotak, lalu saya tunjukkan suatunya sehingga harus ada keterangan lain dari mulut dan terbatasnya bank penya- Aviliani menjelaskan, jual makanan, sebaiknya bisa rusahaan biasa. ke si penjaga stand tadi dan memberikan isyarat untuk si penjual. lur kredit yang rata-rata bank pembinaan tersebut hendak- dibina supaya menjual maka- Sebelumnya, Menko Kesra ditempelkan di kaca dekat pemajangan produknya. Hingga kini masih banyak pembuatan media promosi BUMN,” ujar Pras. nya diberikan kepada nasa- nan yang bersih dan sehat. Agung Laksono mengatakan Tawa yang renyah meledak dari mulut perempuan yang harus didampingi mulut si penjual untuk mejelaskan Pras menambahkan, pe- bah-nasabah secara berke- “Selain itu KUR juga harus pemerintah menargetkan pe- penjaga stand itu ketika tidak sampai 5 menit dari pemasa- makna gambar dan kondisi-kondisinya. Lagi-lagi gaya merintah memiliki kewaji- lanjutan. Baik bagi para debi- disalurkan kepada sektor per- nyaluran KUR hingga Rp100 ngan tulisan itu, ada seorang yang datang menghampiri penjualan yang paling primitiflah yang terjadi. ban untuk memangkas ken- tur baru maupun kepada de- tanian, selama ini masih do- triliun dalam waktu lima tahun kami tanpa berkata apa pun langsung menyodorkan uang Media promosi yang masih harus ditambah mulut itu, dala-kendala dalam penyalu- bitur lama. minan KUR di sektor perda- ke depan. Pemerintah menar- Rp15.000 dan memberikan isyarat meminta 1 kotak dengan biasanya terjadi karena kekurang mampuan dalam me- ran KUR tersebut agar pada “Salah satunya mereka gangan,” pungkasnya. getkan penyaluran KUR hing- jari telunjuknya. “Terimakasih,” itu saja kata si pembeli nyampaikan pesan melalui media tertulis, atau juga karena masa mendatang, penyalu- diberikan pembinaan bagai- Secara terpisah, Kepala ga Rp20 triliun dengan me- tadi begitu dia mendapatkan barangnya. ada potensi menipu yang diniatkan oleh si penjual. ran kredit usaha rakyat dapat mana cara mengelola ke- Ekonom Danareksa Research nganggarkan dana Rp 2 triliun Tawa itu terjadi setelah menyadari betapa tulisan harga Sangat mungkin penjual merencanakan kebusukan dilaksanakan sesuai target. uangannya, sehingga dengan Institute, Purbaya Yudhisade- per tahun.(dtc) yang sederhana tadi menjadi begitu sakti. Menghemat yang dengan sengaja tidak menginformasikan kekurangan tenaga, memudahkan informasi dan membedakan pembeli dan potensi kejelekkan produk atau sistem penjualannya. sebenarnya dan orang yang hanya ingin sekadar bertanya. Saya jadi teringat zaman dulu masih sekolah, sekali waktu sepulang les saya naik angkot. Saya duduk di depan di sam- Penjual yang seperti ini menunggu silap si pembeli saja. Jelas sebuah langkah yang tidak bisa ditolerir. Yang terakhir, memang diperlukan keterampilan untuk Hanya 60 Persen Koperasi ping sopir. Perjalanan dengan angkot ini menjadi melelahkan dan panjang. Tiap ada orang berdiri di tepi jalan, selalu saja sopir menjalankan ritual yang berulang. Ritual itu berupa: pasang lampu tanda ke kiri, klakson dua kali, minggir dan bisa menyampaikan sesuatu dengan media tulisan. Tetapi itu bukan sesuatu yang tidak mungkin. Hanya diperlukan kemauan belajar dan mencobanya. Toh itu untuk kebaikan anda sendiri. Aktif Di Sumut MEDAN (Waspada) : Da- kuat,” ujar Mardiana yang di Jl. Tritura No. 5 Medan, me- keras. mendekat ke orang yang berdiri di tepi jalan tadi dan mene- Saya jadi ingat sewaktu naik kereta api kelas ekonomi ri 8.540 koperasi di Sumatera hadir mewakili kepala Dinas nyatakan koperasi dapat ber- “Untuk itu dia berharap riakkan satu nama terminal sebagai tujuan trayeknya. sepanjang perjalanan tidak pernah sepi dengan penjual Utara, hanya 60 persen yang Koperasi&UKM Sumut. jalan baik jika ditopang oleh Koperasi Abdi Sukma dapat Tidak pernah angkot ini melaju kencang dengan gigi asongan. Sebuah romantisme kereta rakyat yang memberi- aktif sedangkan 40 persen Pihaknya mengharapkan sejumlah aspek pendukung. dikelola dengan baik dengan mesin di angka 4, karena tiap beberapa meter sopir ini me- kan kesempatan perputaran uang recehan demi perut yang lainnya ada yang lambat ber- agar koperasi jangan hanya “Yang pertama adalah ker- kerja keras pengurus, keju- ngulangi ritual yang sama. Pasang lampu tanda ke kiri, klak- sejengkal ini. Para pedagang asongan itu memiliki suara gerak dan ada juga yang tidak berorientasi usaha. “Jika ke- ja keras, kejujuran, kesabaran juran, kesabaran menghadapi son dua kali, minggir dan mendekat ke orang yang berdiri yang lantang dan sepertinya Mereka tidak perduli apapun, jalan atau hilang sama sekali. lembagaan kuat, usaha pasti menghadapi anggota, serta anggota, manajemen yang di tepi jalan tadi dan meneriakkan satu nama terminal walaupun seseorang sedang tertidur lelap pun mereka akan Kepala Bidang Kelemba- lancar, sebaliknya jika hanya manajemen yang baik dan lo- baik dan loyalitas,” lanjutnya sebagai tujuan trayeknya. tetap membangunkannya demi menawarkan produk gaan Dinas Koperasi dan berorientasi usaha, paling ber- yalitas pengurus bersama kembali. Merasa sebal dengan teriakan-teriakan sopir, saya sobek dagangannya. UKM Provinsi Sumatera Uta- tahan 2 tahun,” paparnya. Dia anggota,” ujarnya. Sementara Ketua Koperasi satu lembar kertas gambar saya dan dengan krayon saya Hingga suatu ketika ada seorang pemuda yang bisa tidur ra Mardiana di Medan, akhir mengakui saat ini banyak ko- Dengan demikian, lanjut- Abdi Sukma Bintoro Hadi tuliskan nama terminal yang sedari tadi diteriakkan lalu lelap tanpa diganggu oleh para pedagang songan karena pekan lalu, menyatakan kon- perasi yang tidak berkualitas. nya, koperasi yang bergerak menjelaskan, Koperasi Abdi saya tempelkan di kaca depan sebelah kiri. Anda tentu bisa ia menutupi kepala dan wajahnya dengan kertas karton disi itu terjadi dikarenakan “Kita berharap dengan di bidang jasa perdagangan, Sukma intinya bertujuan menebak kisah ini, selanjutnya pak sopir tidak lagi perlu berwarna kuning dengan tulisan spidol: “Saya tidak mau tidak profesionalnya penge- berdirinya koperasi-koperasi kontraktor dan bidang umum memberdayakan potensi pe- berteriak dan bahkan tidak harus memberhentikan angkot- beli apapun, jangan ganggu saya.” lolaan koperasi yang dija- yang baru agar dapat melihat yang baru berdiri ini dapat rekonomian khususnya usaha nya, dia hanya berusaha untuk membuat sedikit pelan lankan pengurusnya. kebelakang untuk memacu maju dan berkembang seperti kecil menengah di Sumatera sehingga calon penumpang bisa membaca dengan jelas Konsultasi dan pelatihan; tj@cahyopramono.com “Salah satu penyebabnya perkembangan usaha yang badan usaha lainnya. Utara. “Terkait arahan dari adalah karena koperasi terfo- diyakini dapat dijalankan de- Arif mencontohkan di an- Dinas Koperasi dan UKM kata kus pada usaha sehingga lu- ngan profesional,” lanjutnya tara kegagalan koperasi selama Bintoro pihaknya segera me- Sumut Siapkan Gema Pariwisata 2009 pa membenahi kelemba- gaannya. Padahal apapun usaha yang dikelola koperasi, kembali. Prof Arif Nasution dalam arahannya pada syukuran ber- ini adalah karena enggan be- kerja keras. Arif menilai pe- ngurus koperasi banyak yang lakukan restrukturisasi di or- ganisasi kepengurusan untuk memperkuat fungsi kelemba- MEDAN (Waspada): Su- kelembagaannya harus dirinya Koperasi Abdi Sukma masih kurang mau bekerja gaan,” ujarnya. (m38) mut sedang menyiapkan pa- meran dan atraksi budaya Su- mut Gempar (gema Pariwisa- ta) 2009 pada 12-15 Novem- Pebisnis Makanan Yakin 2010 Lebih Baik ber 2009 di Lapangan Merdeka MEDAN (Waspada) : La- ngusahanya,” ujarnya. alam terjadi di mana-mana, na- berusaha memberikan terbaik Medan. rangan masuk lima produk Dia menilai, prospek bisnis mun tidak pernah sulit mencari bagi masyarakat dimana varian Event yang diselenggara- impor melalui pelabuhan- makanan dan minuman ke konsumen. Sebab, makanan telah dikembangkan tidak kan Dinas Pariwisata dan Ke- pelabuhan laut di Indonesia, depannya tidak hanya stabil dan minuman adalah kebutu- hanya untuk menghilangkan budayaan Provinsi Sumut da- kecuali di lima pelabuhan ter- melainkan menunjukkan ang- han pokok bagi masyarakat,” rasa lapar namun banyak serat. lam rangka memperingati Hari tentu telah ditetapkan telah ka yang sangat bagus, karena ujarnya. “Tentunya hal ini sangat penting Pariwisata se-dunia 2009 men- menjadi keuntungan tersen- usaha ini tetap bertahan da- Namun yang terpenting, bagi tubuh yang menerima atau dapat dukungan penuh dari diri bagi pengusaha maka- lam situasi apapun. lanjutnya, adalah produk itu be- mengkonsumsi produk-pro- Pj Walikota Medan Rahudman nan dan minuman lokal. “Walaupun perekonomian nar-benar sehat dikonsumsi duk mie instan yang disajikan,” Harahap dan seluruh stake- Pasalnya, dengan adanya mengalami krisis dan bencana oleh masyarakat. Hal inilah, kita lanjutnya kembali. (m38) holder pariwisata di Sumatera pembatasan impor yang me- Utara. ngacu pada Permen Perin- Hal itu terungkap dalam technical meeting Sumut Gem- dustrian dan Perdagangan RI No. 44 tanggal 31 Oktober Bank SBI Dorong Ekspor par 2009 yang dihadiri lang- 2008 tidak hanya mengem- sung Asisten III Pemprovsu As- ril Naim, Kepala Dinas Pariwi- bangkan dunia usaha lokal melainkan dapat melakukan Komoditi Sumut ke India sata Sumut Nurlisa Ginting, Pj penetrasi pasar ke luar negeri. MEDAN (Waspada): Keha- Walikota Medan Rahudman Presiden Direktur Olaga- diran anak perusahaan bank Harahap dan Direktur Utama food, Djoesianto Law di Me- terbesar di India, State Bank Trans Kreasindo Production dan, Minggu (8/11) menyata- of India (SBI) Indonesia sejak Didit Mahadi Kadar selaku Waspada/Armin Nasution kan dengan adanya pemba- April 2009 untuk mendorong event organizer. PARIWISATA: Kepala Dinas Pariwisata (dua kiri), Pj Walikota Medan (tiga kiri) mengaku san impor memberikan ke- peningkatan ekspor komoditi Nurlisa mengatakan event siap untuk menyukseskan gema pariwisata yang digelar bulan ini. sempatan kita untuk bangkit dari Sumatera Utara ke India, ini bertujuan memperingati dan melakukan penetrasi kata pejabatnya. Hari Pariwisata se-Dunia 2009. seluruh kecamatan, jelasnya. Seperti sekarang, Rahud- menampilan potensi kebu- pasar secara besar-besaran. Hal itu tercermin dengan Selain itu mengembangkan ‘’Pemko Medan telah me- man mengaku telah melaku- dayaan dan pariwisata Su- “Dipastikan dengan ada- penyaluran kredit di SBI Indo- potensi budaya sekaligus des- lakukan berbagai terobosan kan komunikasi dengan peda- mut. Untuk itu, pihaknya te- nya undang-undang pemba- nesia Medan selama enam bu- tinasi berbagai tujuan objek untuk mencipatkan kondisi gang pusat makanan di Paga- lah mempersiapkan berba- tasan impor tersebut, Indo- lan pertama sejak pembu- pariwisata, jelasnya. Karena Medan yang aman dan tertib. ruyung dan di Jalan Pandu, gai kegiatan selama event nesia khususnya Sumatera kaannya mencapai Rp40 mi- selama event berlangsung di- Sehingga apapun yang men- agar dikelola serapi mungkin. berlangsung mulai dari kar- Utara tidak lagi dibanjiri oleh liar dengan fokus ke kredit tampilkan berbagai kebudaya- jadi kendala dan hambatan di Didit Mahadi Kadar me- naval budaya amazing North produk-produk dari luar ne- ekspor-impor, tambahnya. an multi etnis di Sumatera lapangan, saya komit dan kon- nambahkan Sumut Gempar Sumatera & parade mar- geri melainkan produk da- Presiden Direktur Bank Utara, lagu-lagu etnis budaya sisten untuk melakukan ber- 2009 dikonsep semeriah dan ching band yang diikuti seki- lam negeri yang siap diper- SBI Indonesia Rajiv Saran ber- Waspada/ist yang diharapkan mampu me- bagai upaya,” katanya. semarak mungkin dengan tar 6.000 personil.(m13) tanggungjawabkan oleh pe- bicara kepada wartawan di FOTO BERSAMA: Jajaran manajemen Bank SBI Indonesia ngairahkan pariwisata di Su- Medan, Kamis (5/11). Dia di- di antaranya, Presiden Direktur Rajiv Saran (tengah), direktur matera Utara. dampingi Direktur S Sathya- S Sathyamurthy (3 kanan). Bayu Wisnu Wardana (3 kiri) dan Event ini tentunya akan mampu mempercepat pening- Nutrend Gandeng Gapoktan Panen Bawang Merah murthy, Direktur Marketing Bayu Wisnu Wardhana dan Branch Manager Medan, Suhendro Tandean (2 kanan) foto bersama seusai customer gathering Dinner Swissbelhotel Medan, katan kunjungan turis domestik MEDAN (Waspada): PT yang esensial, dengan nutrisi dipandu leader-leader Nut- hasilkan. Karena manfaat Branch Manager Bank SBI In- Kamis (5/11) malam. dan internasional yang saat ini Nutrend Internasional salah pupuk ini diharapkan mampu rend ini akan dihadiri Bupati Herbafarm selain memper- donesia Medan, Suhendro terus menunjukkan grafik satu anak perusahaan PT Si- menyuburkan tanaman de- Cirebon, Dedi Supardi, Direk- baiki sifat kimia dan biologi Tandean di sela-sela customer yang telah diproses Bank SBI nesia merupa¬kan bagian dari peningkatan, kata Nurlisa. do Muncul yang bergerak di ngan baik serta membuat ta- tur Utama PT Sido Muncul Ir- tanah, juga membantu me- gathering dinner di Swiss- Indonesia di Medan mencapai bank terbesar di India, masya- ‘’Ini menjadi momen pen- bidang multi level marketing naman lebih tahan dalam ma- wan Hidayat, Direktur PT Nut- nyediakan hara esensial ta- belhotel Medan. Rp40 miliar dan simpanan rakat Medan bisa langsung ting untuk memajukan pari- (MLM) di desa Astanalang- sa kekeringan. Sehingga petani rend Internasional Irnez Hida- naman sehingga merang- Selama ini, ungkap Sat- pihak ketiga dalam bentuk de- menu¬karkan uangnya dari wisata Sumatera Utara. Pe- gar, Kecamatan Losari, Kabu- bawang merah di daerah Losa- yat, sejumlah pejabat terkait, sang pertumbuhan tana- hyamurthy, ekspor komoditi posito Rp25 miliar dengan 250 rupiah ke rupee atau dolar AS ningkatan arus wisatawan ke paten Cirebon bekerja sama ri mampu meningkatkan hasil 24 Gapoktan daerah Cirebon man, meningkatkan daya ta- Sumut harus melalui broker nasabah. ke rupee untuk dikirimkan ke- Sumatera Utara diharapkan ja- dengan gabungan kelompok pertaniannya. yang berjumlah ±1.000 petani, han terhadap serangan ha- di Singapura dan dari sana Dalam paparannya pada pada saudara, rekan atau relasi uh lebih baik lagi dibanding- tani (Gapoktan) setempat Pupuk cair bio organik member-member Nutrend ma dan penyakit dan pema- baru diekspor ke India karena gathering tersebut, Wisnu me- bisnisnya sehingga bisa lebih kan tahun lalu, mengingat se- dan member Nutrend panen Herbafarm diproduksi PT Sido dan salah satu ikon Kuku Bima kaian pupuk lebih efisien. terkendala L/C (letter of cre- maparkan selama ini bank- hemat biaya,” ujarnya. luruh stakeholder pariwisata raya bawang merah hasil pe- Muncul dan dipasarkan mela- Energi PT Sido Muncul Donny Direktur Utama PT Sido dit). bank di Indonesia untuk me- Di samping itu, sejak ter- Sumut ikut andil dan membe- makaian pupuk bio organik lui PT Nutrend Internasional Kesuma. Muncul Irwan Hidayat me- “Kehadiran kami di sini ngirimkan uang ke India tidak jadi krisis ekonomi yang me- rikan dukungannya untuk herbafarm keluaran Nutrend. secara MLM merupakan salah Diharapkan dengan panen ngatakan pupuk Herbafarm memangkas jalur tersebut di bisa langsung dalam bentuk landa Indonesia beberapa mensukseskan even ini,” ujar- Daerah Kabupaten Cire- satu produk terobosan PT Sido raya di Losari ini mampu me- ini diharapkannya bisa ber- mana ekspor komoditi dari Su- rupee karena tidak diperda- tahun lalu mengakibatkan ka- nya. bon kota pantai yang berada Muncul di bidang pertanian macu petani daerah lain ber- peran nyata terhadap petani mut bisa langsung ke India gangkan secara bebas di luar langan eksportir dan importir Rahudman menambah- di pesisir Laut Jawa sangat me- agar petani mendapatkan hasil peran aktif meningkatkan pola untuk membantu mening- karena sebagai bagian dari negeri. Indonesia terkendala mempe- kan evenT Sumut Gempar mungkinkan untuk pengem- yang maksimal, sehingga taraf tanam petani sehingga meng- katkan hasil budidaya tana- bank terbesar di India, kami “Biasanya bank-bank lain roleh L/C. Sebagai bagian dari membawa dampak efek luas bangan tanaman pangan, agro hidup dan kesejahteraan peta- hasilkan keuntungan yang me- mannya, sehingga hasilnya memiliki network yang besar,” harus menukarkan rupiah itu bank yang masuk rangking 50 luas terhadap pertumbuhan bisnis khususnya bawang ni meningkat. ningkat. Petani langsung meli- meningkat . Apalagi Herba- tambah Bayu Wisnu War- dalam bentuk dolar AS dan di dunia, SBI Indonesia akan ekonomi di Medan . Menyahu- merah. Pemakaian Herbafarm Panen raya bawang merah hat hasil pemakaian pupuk. farm ini merupakan pupuk dhana. dari dolar AS itu ditukar de- membantu para eksportir dan ti event ini, Pemko Medan sebagai pupuk bio organik cair hasil tanam petani Astana- Herbafarm secara lang- alami/organik yang diproses Hingga Oktober 2009 atau ngan rupee melalui bank-bank importir itu untuk kelancaran membantu kelancaran dan par- yang mengandung mikroba langgar, Losari dengan pema- sung dari awal pemakaian, dari produk samping PT Sido enam bulan sejak diresmikan, di India,” ujarnya. transaksi mereka termasuk da- tisipasi dengan melibatkan bermanfaat dan unsur hara kaian pupuk Herbafarm yang sampai produk yang telah di- Muncul.(rel) ungkap Sathyamurthy, kredit “Namun karena SBI Indo- lam memperoleh L/C.(m13)
    • 24 Liputan Khusus WASPADA Senin 9 November 2009 Yang Luar Biasa Di Sumbar Jalan Desa Ikut Diaspal Mulus Dan Mobil Dinas Tak Boleh Dibawa Pulang SEWAKTU memasuki nada memuji yang sama sama kawasan Sumatera Barat bertugas untuk mengantarkan setelah melakukan bantuan korban gempa di perjalanan panjang selama Sumbar. empat belas jam dari Saking keras dan kuatnya Medan, rasa nyaman dalam mutu jalan-jalan mulai dari kota kendaraan mulai terusik Padang sampai ke semua tajam. Keadaan badan jalan daerah kabupaten dan kota lain yang berlobang –lobang di Sumbar, boleh disebut tidak yang bagaikan kubangan satu titikpun yang terlihat retak kerbau telah mendadak mengaga digoyang gempa menurunkan kecepatan dahsyat akhir September lalu. mobil tahun tinggi buatan Kuatnya jalan-jalan di sana, Jepang itu dari persneling 4 terutama jalan Padang dan menjadi 2. Pariaman sampai ke desa desa yang telak terkena hantaman Lalu tanpa basa-basi salah gempa, cenderung disebut me- seorang rekan duduk berse- lebihi kuatnya rumah-rumah belahan dalam mobil yang semen yang nyatanya ambruk sama spontan menuding: inilah akibat tak tahan menerima keadaan jalan Sumatera Utara goncangan gempa. walau bukan, karena jalan pada “Peranan pemerintahan jalur lintas barat yang meng- Provinsi Sumatera Barat yang hubungkan Sumatera Utara dikomandoi Gubernur masih dengan Sumatera Barat terus tetap kuat dan sangat dihormati ke Pulau Jawa sudah berada di kepala daerah tingkat kabupaten kawasan Sumbar, tepatnya di dan kota,” kata Herri dari unsur kawasan Cubadak, Kecamatan pegawai kantor Gubernur di Rao, Kabupaten Pasaman. Padang ketika ditanyakan Entah kenapa jalan sepan- kenapa jalan-jalan di Sumbar jang 2 kilometer itu dibiarkan bisa bagus sampai pada jalan pemkab Pasaman kerusakan- desa terisolir. nya begitu parah yang nyaris Dia mengakui otonomi membuat sesama rekan dalam daerah juga berlaku di Sumbar, mobil tidak percaya terhadap namun hubungan pemerintah omongan orang yang menyebut Provinsi dan pemerintah kabu- semua jalan mulai dari kota paten dan kota tetap tidak beru- sampai ke pelosok desa sudah bah. Mulai dari imbauan, aja- diaspal mulus dengan mutu kan, intruksi Gubernur sangat atau kualitas aspal rata rata didengar dan dilaksanakan kelas I. penuh hati-hati dan disiplin Setelah melewati kawasan oleh setiap kepala daerah tingkat Rao, daerah Sumbar yang II dan kota, apakah itu bupati berpatasan dengan Sumut, ataupun Walikota. keyakinan yang tadinya nyaris “Jadi di sini tidak berlaku hilang mulai kembali muncul. cara sendiri-sendiri, setiap Memasuki jalan di kawasan bupati ataupun walikota mesti Rimbo Panti terus ke Lubuksi- melaksanakan pembangunan kaping, ibukota Pasaman, dan di daerah masing masing, begitulah seterusnya sampai termasuk dalam pembangunan Bukittinggi dan kota Padang, atau perbaikan jalan, mengacu benar benar terlihat mulusnya kepada ajakan, imbauan atau Waspada/Mohammad Faisal aspal jalan di ranah minang itu. instruksi Gubernur yang sangat Jalan Lintas Sumatera di kawasan wisata Lembah Anai yang terkenal dengan Airmancur di daerah Kabupaten Tanah Datar, Sumatera Barat terlihat begitu mulus dengan kereta api sedang Andaikata terjadi kerusakan menekankan kepada mutu melintas di atasnya. sebenarnya bisa saja diterima tinggi dari suatu pembangunan karena Sumbar itu, termasuk sehingga daya tahannya bisa “Kami melaksanakan pem- bangunan tetap dari itu ke itu. RI, tidak bisa menerima apabila kebijakan Gubsu Sumbar yang mobil itu tidak disalahgunakan ngunan, terutama jalan dan lain kawasan Pasaman, tercatat dipertanggungjawabkan dan bangunandi daerah ini tetap Sebagai orang yang menga- ada jalan kabupaten ataupun diberlakukan sejak setahun lalu pemakaiannya di luar jam lain termasuk pelarangan sebagai daerah paling kuat me- sekaligus sebagai upaya mema- berpedoman untuk kepen- ku tahu soal pembangunan di kota yang dibangunan atau adalah menyangkut tidak dinas.Dengan kebijakan itu, membawa kendaraan dinas ke nerima goncangan gempa ber- jukan daerah Sumbar secara tingan anak-cucu, sekali diba- Sumbar, dia juga merasa bangga diaspal apa adanya atau dengan diperbolehkan membawa mobil katanya, pengambilan kembali rumah usai jam dinas, adalah kekuatan 7,9 pada skala Richter. keseluruhan. ngun kalau boleh bisa tahan karena dana APBD tidak melulu mutu rendah, tetapi mesti me- dinas pulang ke rumah. Pada mobil mobil dinas itu tidak tidak lain sebagai pengaruh “Saya tak habis pikir kenapa Menurut Herri, andaikatan untuk selama-lamanya,” kata dialokasikan setiap tahun untuk ngacu kepada standar dengan usai jam dinas, semua mobil begitu sulit dari pejabat lama keharmonisan dan kekokohan semua jalan-jalan yang ada di Bupati ataupun Walikota tidak Herry sambil menyeburkan perbaikan jalan yang sama, mutu tinggi,” ujarnya dengan dinas di jajaran Kantor Gubsu untuk dialihkan pemakaiannya jalinan hubunganpemerintah Sumbar, tanpa kecuali jalan kecil lagi mendengarkan suara barangkali di daerah atau tetapi sudah bisa dianggarkan mengaku alasan itulah salah Sumbar mesti diparkir di pool ke pejabat baru apabila terjadi provinsi dan pemerintah dae- menuju daerah terisolir seperti Gubernur, bentuk dan kualitas provinsi lain tidak seperti kami untuk pembangunan sektor lain satunya jalan-jalan di daerah yang sudah ditentukan pada penggantian jabatan. rah. Sebagai Gubernur, Bupati menjelang memasuki Korong pembangunan di sini, termasuk di sini, yang pembangunannya atau pengaspalan jalan jalan ke- Sumbar bisa merata bagus kantor dinas masing-masing. Baik Herri ataupun Burha- dan Walikota tetap tunduk Ladang Rimbo, Sei Garingging, jalan-jalan negara, provinsi dan seperti jalan hanya ditargetkan cil di berbagai desa (kenegarian). sampai jalan desa terisolir. Kebijakan itu dimaksudkan, nuddin sama sama sependepat dengan berbagai kebijakan demi Pariaman, berada dalam kuali- jalan kabupaten tanpa kecuali untuk jangka satu atau dua “Pak Gubernur Gamawan Baharuddin dari Kantor kata Burhanuddin, selain untuk jika ada penilaian pihak luar memajukan Sumbar dan me- tas yang sama bagusnya,” kata jalan desa, jelas tidak akan seperti tahun dan kemudian kembali Fauzi yang kini telah diangkap Dinas Pengawasan Keuangan penghematan teknis tetapi juga tentang keberhasilan Sumbar makmurkan masyarakatnya. salah seorang rekan dengan ini mulus dan kuatnya. diberbaiki sehingga fokus pem- menjadi Menteri Dalam Negeri Daerah Sumbar juga mengakui sebagai upaya mencegah agar dalam berbagai bidang pemba- Ai iu drs a Y l Rasa Kebersamaan Warga Sumbar Menggalang Bantuan Peristiwa gempa berkekua- sikan tayangan tv untuk menge- tuan dari masyarakat setempat, dan Pariaman, dua daerah yang tan 7,9 pada skala richter pada tahui keadaan sebenarnya Anton mengaku pihaknya paling telak terkena gempa,” kata 30 September lalu, sekitar pukul pasca gempa,” kata Anton, mengumumkan melalui alat Anton, pemuda separoh baya 17:15Wib itu sudah merata dira- warga Batusangkar, Kabupaten pengeras suara di masjid yang yang mengaku setiap hari sakan goncongannya oleh se- Tanah Datar, ketika ditanyakan isinya meminta sumbangan bekerja sebagai supir angkot mua lapisan masyarakat Suma- reaksi masyarakat dalam ikhlas setiap warga untuk di kota Batusangkar. tera Barat. Walau kota Padang memberikan bantuan darurat menyediakan berupa makanan, Karena suasana gelap kare- dan Pariaman serta Pesisir Sela- pada awal ternjadinya gempa terutama nasi bungkus yang na listrik PLN mati akibat gem- tan yang paling parah terkena Rabu menjelang magrib pada mesti segera disediakan kendati pa, Anton bersama rekan-re- bencana dengan 135.000 30 September itu. mesti diambil dari jatah makan kan lainnya, dengan menggu- bangunan rusak parah dan Menurut Anton, setelah malam tanpa harus menunggu nakan lampu senter, menelusuri lebih seribu orang tewas dan mengetahui secara pasti bahwa berlama-lama, sebab tim gabu- tempat pemukiman sementara hilang, namun warga lain yang keadaan kota Padang dan Pa- ngan yang berasal dari pemuda warga yang rumahnya ambruk berada pada kabupaten dan kota riaman sangat parah dihantam setempat sudah siap berangkat sambil menyalurkan bantuan yang berbeda dan selamat dari gempa yang membuat sejumlah dengan sepeda motor pada nasi bungkus, mie instant dan amukan gempa telah menun- bangunan ambruk, termasuk malam menjelang isya itu mele- lain-lain yang bisa dijadikan jukkan rasa persaudaraan yang rumah tempat tinggal, dia wati jalan alternatif via kelok sebagai makanan pengganjal mendalam dengan spontan bersama rekan-rekan lain di Empat Puluh Empat (Manin- perut agar tidak lapar sambil memberikan bantuan darurat desa (Jorong)nya mengadakan jau), karena jalan lintas utama menunggu bantuan lainnya. pada sepanjang malam sampai pertemuan kilat dengan kepu- via Lembah Anai tertutup akibat “Alhamdulillah, kami dari pagi yang berlanjut beberapa tusan mesti segera berangkat longsor besar. tim gabungan kota Batusang- Waspada/Mohammad Faisal hari kemudian pasca gempa. ke Padang dan Pariaman untuk “Ratusan bahkan seribuan kar, khususnya yang berasal Petugas kebersihan aktif membersihkan tebaran sampah di pinggir Pantai Air Manis, Padang pasca gempa. “Begitu mengetahui semua memberikan bantuan darurat sepeda motor yang masing- dari Jorong Silabuk, Kenagarian bangunan, terutama rumah berupa bahan makanan seperti masing penuh dengan berbagai Parambahan, Kecamatan Lima dulian dan solidaritas menda- setelah terbuka jalan Padang- di Indonesia termasuk bantuan Sumbar menyatakan sangat warga, di daerah ini selamat, nasi bungkus, mie instant, atau bawaan logistik, terutama nasi Kaum, berhasil membagi- lam sesama warga minang yang panjang-Padang lewat Lembah negara asing,” sebutnya dengan berterima kasih sekali kepada kami langsung mengadakan apa saja yang bisa diberikan bungkus, berangkat dari Batu- bagikan bahan logistik pada saat berada di Sumbar, khususnya Anai. harapan kota Padang, Paria- pihak Harian Waspada melalui kontak telepon dengan kalangan kepada saudara-saudara yang sangkar yang di tengah jalan yang sangat darurat pada bebe- kota Padang dan Pariaman. “Sampai sekarang rasa man dan Pesisir Selatan serta Waspada Peduli Sumbar yang keluarga yang bermukim di kota terkena bencana. bergabung dengan tim bantuan rapa jam setelah gampa,” kata- Dan bantuan itu bukan senasib sepenanggungan masih