Your SlideShare is downloading. ×
Edisi 12 Nov Aceh
Upcoming SlideShare
Loading in...5

Thanks for flagging this SlideShare!

Oops! An error has occurred.

Saving this for later? Get the SlideShare app to save on your phone or tablet. Read anywhere, anytime – even offline.
Text the download link to your phone
Standard text messaging rates apply

Edisi 12 Nov Aceh


Published on

  • Be the first to comment

  • Be the first to like this

No Downloads
Total Views
On Slideshare
From Embeds
Number of Embeds
Embeds 0
No embeds

Report content
Flagged as inappropriate Flag as inappropriate
Flag as inappropriate

Select your reason for flagging this presentation as inappropriate.

No notes for slide


  • 1. WASPADA Jumat 13 November 2009 Nusantara 3 Kasus KPK-Polri Ancam Program 100 Hari JAKARTA (Waspada): Te- sebesar 58 persen, sedangkan III tidak terkesan mewakili Kedua, Partai Demokrat rumor negatif itu. muan riset Lingkaran Survei persepsi negatif terhadap kepentingan publik mengeks- menjadi satu-satunya partai Menurut Denny, seratus Indonesia (LSI-Network) presiden meningkat menjadi 64 plorasi Kapolri secara kritis. besar yang tidak ikut dalam hak hari pertama pemerintahan Divisi Isu Publik menyebut- persen dibandingkan pekan lalu Pertemuan Komisi III angket Bank Century. Fraksi baru, baik bagi DPR maupun kan, berlarutnya isu KPK- sebesar 53,85 persen. dengan sejumlah LSM yang partai lain sudah bersama presiden, seharusnya adalah Polri-Century membuat dua Riset dilaksanakan melalui dinilai ricuh juga dipersepsikan memperjuangkan hak angket periode “bulan madu”. Dalam lembaga politik tinggi negara, media analisis terhadap lima bahwa para pimpinan Komisi itu, seperti PDIP, Hanura dan periode ini dua lembaga politik Presiden dan DPR dipersep- koran nasional yaitu Kompas, III dianggap belum matang dan partai koalisi pemerintahan itu seharusnya mendapatkan sikan negatif oleh responden, Koran Tempo, Media Indonesia, mumpuni dalam menghadapi (PKS, PAN, PPP). kepercayaan publik yang tinggi. sehingga akan mengancam Republika dan Seputar Indo- politik tingkat tinggi masyarakat. Ketiga, rumor mengenai Namun katanya, seratus keefektifan program 100 hari nesia. Periode yang diriset Sementara persepsi negatif “pelemahan KPK” semakin hari pemerintahan baru teran- pemerintahan. tanggal 3–9 November 2009. terhadap presiden justru me- menguat dengan pernyataan cam berlalu tanpa perhatian Direktur Eksekutif LSI- Denny menyatakan, per- ningkat dari 53,8 persen menja- Wiliardi bahwa dia diminta publik yang positif. Apapun yang Network Divisi Publik, Denny sepsi negatif terhadap DPR di 64 persen karena beberapa bersaksi untuk menjaring dikerjakan pemerintahan baru JA dalam keterangan tertu- sebesar 58 persen dan persepsi alasan, pertama, presiden di- mantan Ketua KPK Antasari akan tertutup oleh persepsi lisnya, Kamis (12/11) menya- positifnya 36 persen terbentuk anggap lebih banyak memain- Azhar, sehingga presiden negatif yang sudah muncul takan, responden mempersep- oleh kasus pertemuan DPR Ko- kan wacana ketimbang ber- semakin tidak diuntungkan akibat isu kasus KPK-Polri- sikan negatif terhadap DPR misi III dengan Kapolri. Komisi tindak konkret dan cepat. dalam persepsi publik oleh Century.(ant/j03) Police Watch Kritik Pemeriksaan Wiliardi Polri Ingin Giring Opini Publik JAKARTA (Antara): Ketua Presidium Indonesia Police Watch JAKARTA (Antara): Polri Suhandoyo, mantan Kepala bunuhan Direktur PT Putra (IPW), Neta S. Pane menyayangkan pemeriksaan mantan Kapolres berupaya menggiring opini Pusat Penerangan Hukum Rajawali Banjaran Nasrudin Metro Jakarta Selatan Kombes Pol. Wiliardi Wizard usai memberi publik melalui penayangan salah Kejaksaan Agung. Zulkarnaen dengan tersangka keterangan dalam persidangan pembunuhan Direktur Putra satu pemeriksaan Wiliardi di Langkah Polri itu hanya Antasari di PN Jakarta Selatan, Rajawali Banjaran, Nasrudin Zulkarnain. dalam ruangan yang seharusnya akan memunculkan kelompok Selasa, Wiliardi mengakui “Seharusnya polisi tidak boleh memeriksa Wiliardi karena hanya layak ditampilkan di pendukung Antasari di satu sisi diminta pimpinan Polri untuk statusnya tahanan kejaksaan, bukan tahanan polisi. Itu wujud persidangan, kata mantan dan berujung pada instabilitas menyamakan BAP. Wiliardi arogansi Polri karena melakukan pemeriksaan terhadap seseorang pejabat kejaksaan agung di Ja- politik nasional. mengaku dipaksa pimpinan yang menjadi tahanan kejaksaan,” kata Neta di Jakarta, Kamis karta, Kamis (12/11). “Ini tentu berpengaruh Polri menjerat man-tan Ketua (12/11). “Penayangan pemeriksaan terhadap upaya menciptakan KPK Antasari Azhar. Dia mengatakan, pemeriksaan atas alumni Akpol 1984 itu Wiliardi dan Antasari justru situasi politik dan keamanan Kapolri Jenderal (Pol) Bam- merupakan bentuk intervensi terhadap independensi pengadilan. tidak efektif, hanya merupakan yang kurang kondusif yang bang Hendarso Danuri meng- Pada persidangan di Pengadilan Negeri (PN) Jakarta Selatan, langkah Polri membentuk opini dapat mengganggu program akui, polisi dalam posisi terjepit. Wiliardi yang tampil sebagai saksi menyatakan ada rekayasa dan publik mendukung langkah- seratus hari pemerintahan “Dengan kesaksian itu masya- tekanan dalam penyidikan kepolisian kepadanya. langkah Polri dalam kasus baru,” katanya. rakat mungkin kembali meng- Wiliardi juga menyebutkan Irjen Pol. Hadiatmoko, mantan Nasrudin Zulkarnaen,” kata Dalam sidang perkara pem- hujat Polri,” kata Bambang. Antara Wakil Kepala Badan Reserse Kriminal yang kini menjadi staf ahli PELAJAR ANTI KORUPSI: Sejumlah siswa menorehkan tanda tangan di atas kain putih sebagai Kapolri sebagai orang yang menekannya. Dia juga mengaku ditekan tanda dukungannya saat Deklarasi Anti Korupsi di SMA Negeri 13 Jakarta Utara, Kamis (12/11). Dalam salah satu deklarasinya, para siswa SMAN 13 sebagai generasi penerus bangsa menyatakan para pejabat Direktorat Reserse Kriminal Umum Polda Metro Jaya. Fenomena Gempa Bisa Diprediksi mendukung tegaknya hukum dan gerakan pemberantasan korupsi di semua institusi dan Akibatnya Divisi Profesi dan Pengamanan Polri (Propam) BANDUNG ( Waspada): Indonesia Timur sangat jarang. kepada para insinyur mengenai lembaga negara. memeriksa Wiliardi yang kini dititipkan di Rutan Mabes Polri Fenomena gempa yang terjadi Demikian Deputi Ilmu gempa yang akan muncul di oleh jaksa penuntut umum. di Sumatera dan Jawa sudah Pengetahuan Kebumian Lem- masa datang, gempa yang kira- Sementara, Hadiatmoko menyatakan siap hadir di persidangan dapat diidentifikasi sehingga baga Ilmu Pengetahuan Indo- kira akan muncul dan yang Menakertrans: Perlu Komitmen menjelaskan persoalan itu dan membantah telah menekanWiliardi sebab dia bukan penyidik dalam kasus ini. para pakar gempa, vulkanologi dan geologi dapat memberikan nesia (IPK-LIPI), Dr. Ir. Hery Harjono saat workshop bagi mulai diketahui,” katanya. Menurutnya, di Sumatera Tingkatkan Kesejahteraan “Yang menyidik itu pangkatnya Kompol, AKP dan Iptu. Saya kan tidak menjadi penyidik. Mana bisa saya menekan dia. Masa rekomendasi kepada para ahli bangunan dalam mengkons- wartawan bertema ‘Refleksi Gempa Jawa dan Sumatera’ di ada zona subduksi dimana ke- kuatan gempanya relatif besar. JAKARTA (Waspada): Men- persaingan global harus me- manajemen dan birokrasi (good untuk membuat BAP (berita acara pemeriksaan), sudah lewat truksi bangunan tahan gempa. Pusat Penelitian Geoteknologi Itu termasuk gempa Aceh 9,2 teri Tenaga Kerja dan Trans- miliki kemampuan menciptakan governance). Perbaikan dan bagi saya,” katanya. Sedangkan untuk wilayah In- LIPI di Bandung, kemarin. skala Richter, kemudian gempa migrasi (Menakertrans), Mu- nilai tambah yang dipengaruhi penataan sistem birokrasi pe- Namun Hadiatmoko mengaku sempat bertemu dengan donesia Timur masih sangat “Data gempa di Sumatera Nias 8,7 SR, terakhir gempa haimin Iskandar mengajak efisiensi, efektivitas, kualitas dan merintahan, manajemen peru- Wiliardi beberapa saat setelah ditangkap. “Saat itu dia belum sulit, mengingat selama ini dan Jawa relatif bagus dibanding Padang 7,9 SR. Bahkan BMKG seluruh instansi pemerintah, inovasi. sahaan dan sistem kemasyara- dimintai keterangan penyidik reserse, tapi masih diperiksa oleh belum banyak diketahui dan daerah-daerah lain di wilayah sekarang sudah mampu dunia usaha dan masyarakat Karena itu, pemerintah In- katan di antaranya meliputi de- Propam. Setelah dari Propam baru diperiksa oleh penyidik,” dideteksi pakar gempa. Apalagi timur. Untuk Sumatera kita su- menentukan kekuatan gempa berkomitmen meningkatkan donesia mengadakan Gerakan regulasi, debirokrasi, transpa- ujarnya. kejadian gempa di wilayah dah bisa memberikan masukan kurang dari lima menit.(dianw) mutu dan produktivitas agar Nasional Peningkatan Produk- ransi dan optimalisasi SDM. dapat meningkatkan kesejah- tivitas, suatu gerakan seluruh Ketiga, inovasi teknologi dan teraan, pendapatan nasional komponen bangsa untuk me- engineering yaitu perbaikan te- Pelajar Jayapura dan daya saing bangsa. ningkatkan produktivitas na- rus menerus dengan dukungan “Ada empat hal yang dapat sional secara terencana dan riset dan teknologi dengan Juara Film dilakukan yaitu, penanaman berkesinambungan, agar dapat memperhatikan pelestarian budaya produktif, perbaikan meningkatkan kesejahteraan, lingkungan dan pembangunan Dokumenter sistem manajemen dan biro- pendapatan nasional dan daya yang berkelanjutan. JAKARTA (Waspada): Upa- krasi, inovasi teknologi dan saing bangsa. Disamping itu juga pening- cara bakar batu di lembah engineering serta peningkatan “Maka perlu dilakukan be- katan kualitas sumber daya Balliemku karya pelajar SMPN sumber daya manusia,” ujarnya berapa hal yang mendasar yaitu, manusia yang dapat dilakukan 2 Jayapura menjadi pemenang di Jakarta, Kamis (12/11). penanaman budaya produktif dengan cara mengembangkan Kid Witness News (KWN) 2009 Di era globalisasi ini kata yang berpandangan hari ini standar kompetensi, pelaksa- bertema Negeriku, Budayaku menteri, timbul fenomena baru lebih baik dari hari kemarin dan naan pendidikan dan pelatihan, & Lingkungan Hidup. Film yakni peningkatan intensitas hari esok harus lebih baik dari rekognisi, sertifikasi profesi serta dokumenter berdurasi pendek persaingan antar negara. Setiap hari ini,” tandasnya. perbaikan gizi dan kese- itu menyisihkan 700 naskah yang negara yang ingin unggul dalam Selain itu, perbaikan sistem hatan.(j04) masuk babak penyisihan. Sebagai juara nasional, tim Polisi Bongkar Jaringan Pemalsu Uang dari provinsi paling timur itu selain mendapatkan piala dan BANDUNG (Antara): Sa- buat dan pengedar uang palsu nangkap tersangka lainnya. Saat piagam, juga mengikuti tuan Reskrim Polres Bandung itu berawal dari laporan masya- penggerebekan polisi mene- perayaan kontes regional di Timur, Jawa Barat membongkar rakat menyebutkan ada lemba- mukan sejumlah barang bukti Singapura Desember 2009. Tim jaringan pembuat dan pengedar ran uang yang meragukan bere- di antaranya satu set komputer, juga menjadi wakil di kejuaraan uang palsu bernilai jutaan dar di wilayah Bandung. “Berda- 13 catrige bekas, dua set catrige KWN tingkat global di Tokyo, rupiah. “Lima pelaku yang terli- sarkan laporan itu kami melaku- warna, satu set alat sablon, serta Jepang tahun depan. bat dalam jaringan itu ditangkap kan penyidikan dan menangkap uang palsu siap edar pecahan “Tujuan kami menstimulasi polisi melalui hasil penyelidikan,” tersangka, dan disita empat Rp20 ribu 16 lembar, Rp50 ribu kreativitas para siswa dan me- kata Kapolresta Bandung Timur, lembar uang palsu pecahan dua lembar dan Rp100 ribu satu munculkan kemampuan AKBP Viktor Manopo di Ban- Rp20 ribu,” ujar Kapolresta. lembar. Juga disita lembaran berkomunikasi di antara mereka. dung, Kamis (12/11). Polisi kemudian mengge- uang belum jadi, serta lima rim Ajang ini juga untuk mencip- Viktor menyebutkan, ter- rebek rumah yang dipakai men- kertas telor. Para tersangka dian- takan kerjasama di antara para ungkapnya komplotan pem- cetak uang tersebut, dan me- cam hukuman 15 tahun penjara. siswa dalam mengerjakan tugas di lapangan dan aktivitas lain terkait pembuatan film,” kata Semua Jenazah Korban Longsor Palopo Ditemukan Istiqlal Taufik, HRS Director PT Panasonic Global Indonesia SULSEL (Antara): 13 Jenazah sejak Minggu (8/11) telah dite- kan, karena yang pertama dite- (PGI), saat pengumuman korban tanah longsor di Kota mukan,” kata Wakil Ketua Tim mukan potongan kaki kanan. pemenang di Djakarta Theatre Palopo yang terjadi Minggu, Penanggulangan Bencana Kota Sementara jenazah Wira Club, Jakarta, Rabu (11/11). telah ditemukan tim gabungan Palopo, yang juga Komandan ditemukan warga di Kec. Tellu- Juri juga memutuskan 10 pertolongan dan pencarian Distrik Militer (Dandim) 1403 wanua pada siang hari di hulu karya terbaik lainnya. Sedang- (SAR) pada Rabu di sekitar Sawerigading, Letkol Dede sungai Bambalu. Jasad itu kan juara II diraih SMP Kristen kelurahan Battang Barat, Kota Indrazat, Rabu malam. terseret sekira 30 km dari lokasi Kalam Kudus Surakarta berjudul Palopo, Sulawesi Selatan. Dua jenazah itu ditemukan longsor. “Meski semua korban Kearifan Lokal Desa Pinggir “Dengan ditemukannya di dua tempat berbeda. Jasad telah ditemukan, namun upaya Kelurahan Telukan dan juara dua jenazah korban terakhir, Edi ditemukan tim Basarnas pencarian tim gabungan SAR III dimenangkan siswa SMPN Edi, 22 dan Wira, 5, oleh tim SAR Sulsel, Rabu siang di km 19 belum dihentikan, terutama Surakarta dengan karya dibantu warga, maka semua Kelurahan Battang. Namun pe- pencarian sisa tubuh Faizal,” berjudul Ibuku Seorang Buruh korban yang dinyatakan hilang nemuan jasad Edi mengenas- kata Dede Indrazat. Batik.(dianw) Perubahan Cuaca Picu Sakit Kepala MEDAN (Waspada): Dalam beberapa pekan terakhir, cuaca adalah sakit kepala akut yang sangat mengganggu aktivitas di Sumatera Utara khususnya Kota Medan selalu mengalami sehari-hari,” ujar seorang ahli kesehatan. perubahan. Cuaca panas dan hujan datang silih berganti. Perubahan cuaca bisa merubah kebiasaan pola hidup Terkadang ada mendung di siang hari dan berpeluang hujan termasuk ketidakmampuan tidur dan berdampak pada penyakit lokal di beberapa kawasan Sumut. seperti sakit kepala. Bahkan, banyak kasus sakit kepala yang Berdasarkan pengamatan Waspada selama sepakan, cuaca benar-benar bermasalah saat terjadi perubahan cuaca. di Kota Medan terlihat panas terik pada siang hari dan sedikit Menghadapi perubahan cuaca yang sulit diprediksi akhir- berawan. Padahal, sehari sebelumnya cuaca di Kota Medan akhir ini, ahli kesehatan tersebut menganjurkan agar masyarakat terlihat mendung dan terjadi hujan lokal. melakukan aktivitas olahraga secara teratur dan mengkonsumsi Pihak instansi terkait menyatakan, perubahan cuaca terjadi makanan bergizi untuk meningkatkan daya tahan tubuh. akibat angin Musim Timur Laut dari Laut China Selatan Bila terserang sakit kepalanya, dianjurkan agar beristirahat berhembus ke Sumatera Utara, sehingga kawasan Medan secukupnya atau dapat mengkonsumsi obat sakit kepala yang sering disirami hujan. dijual secara bebas. Kandungan paracetamol dalam obat sakit Sejumlah peneliti di negara-negara maju mengungkapkan, kepala, dipercaya bukan hanya efektif mengatasi sakit kepala, cuaca hangat dan perubahan tekanan atmosfir dapat memicu namun juga memiliki keunggulan yakni tidak mengakibat- terjadinya sakit kepala. Setiap kali temperatur naik 5 derajat kan iritasi lambung, sehingga bisa dikonsumsi sebelum Celsius —sekitar 9 derajat Fahrenheit— dapat meningkatkan makan. resiko sakit kepala parah sebesar hampir 8 persen dibandingkan Dalam memilih obat sakit kepala, selain memperhatikan dengan ketika cuaca lebih dingin. kandungan, juga harus memperhatikan dosis dan aturan Hal inilah yang tidak disadari oleh masyarakat. Aktivitas pakainya. Kandungan dan dosis yang pas akan mampu sehari-hari yang berlangsung di saat terjadinya perubahan mengatasi sakit kepala dan meminimalkan efek samping. Tidak cuaca, sangat berpotensi terserang berbagai macam penyakit, ada salahnya kita selalu menyediakan obat yang dipercaya terutama sakit kepala. untuk mengatasi sakit kepala, sehingga selalu siap di saat sakit “Ada beberapa jenis penyakit yang berpotensi menyerang kepala datang menyerang. Jika sakit kepala berlanjut , sebaiknya masyarakat di saat terjadi perubahan cuaca. Salah satunya berkonsultasi ke dokter.(m26)
  • 2. 4 Ekonomi & Bisnis WASPADA Jumat 13 November 2009 Ekonomi 2009 Tumbuh 4,3 Persen KUALA LUMPUR (Anta- 200 miliar dolar AS setahun. nilai ekonomi Indonesia me- da pertumbuhan kredit secara ra): Presiden Susilo Bambang Kepada para pengusaha ningkat pesat dan paling me- keseluruhan, namun jika dili- Yudhoyono optimis pertum- Malaysia, Presiden menawar- nonjol di Asean serta bertahan hat per sektor pertumbuhan buhan ekonomi Indonesi pa- kan sejumlah proyek kerjasa- dari terpaan krisis. kredit cukup bagus, terutama da 2009 mencapai 4,3 persen ma antara lain di bidang perta- Inflasi 4 persen kredit sektor listrik yang naik atau sesuai target APBN Pe- nian, pabrik pupuk dan gula, Sementara inflasi tahun ini 30 persen, pertanian 14 per- rubahan 2009, karena peme- pembangkit tenaga listrik serta diperkirakan di bawah 4 per- sen, pertambangan, komuni- rintah tengah mengintensif- industri manufaktur. sen karena dipengaruhi me- kasi dan pengangkutan sebe- kan pembangunan dan me- Undang investor lambatnya perekonomian sar 15 persen, kata Darmin. minimalkan dampak krisis “Saya undang investor Ma- akibat dampak krisis ekonomi Pjs Gubernur BI menam- ekonomi. laysia untuk kerjasama inves- global, demikian Pejabat Se- bahkan, walaupun pertumbu- “Memang jauh lebih ren- tasi dalam revitalisasi perta- mentara (Pjs) Gubernur BI han kredit masih lambat, sek- dah dari sebelum krisis tetapi nian industri, revitalisasi pab- Darmin Nasution dalam Rapat tor perbankan di Indonesia kami yakin akan terus tum- rik pupuk dan gula, serta ma- Kerja dengan Komisi XI DPR masih memiliki solid dan stabil buh sebelum 2014 hingga 7 nufaktur,” katanya. RI di Jakarta, Kamis (12/11). profitabilitasnya. persen,” kata Presiden dalam Presiden menjanjikan pula Menurut Darmin, pola Ini terlihat dari terjaganya pertemuan bisnis dengan se- perbaikan iklim investasi agar normal inflasi Indonesia bera- rasio kecukupan modal (CAR) kitar 200 kalangan bisnis Ma- lebih kondusif bagi kerjasama da pada kisaran 5-6 persen, se- per September 2009 sebesar laysia di Kuala Lumpur Con- ekonomi dan masuknya inves- dangkan laju inflasi tahun ka- 17,7 persen atau jauh dari ke- vention Center (KLCC) tor asing di Indonesia, antara lender Januari-Oktober sebe- tentuan minimum sebesar 8 Waspada/M. Ferdinan Sembiring Kamis. lain dengan terus menjaga sar 2,48 persen dan secara ta- persen dan rasio kredit ber- KESEPAHAMAN: Kepala Kejatisu Sutiyono (kiri) dan Pemimpin Wilayah BNI 01 M. Adil (kanan) saat menandatangani Presiden meyakini per- stabilitas politik, keamanan hunan (YoY) 2,57 persen. masalah (NPL) tetap terken- kesepahaman penanganan hukum bidang perdata dan tata usaha Negara (Datun) kepada Kejaksaan Tinggi Sumut. tumbuhan berkeadilan dan dan penegakan hukum, serta Darmin juga mengatakan dali pada 4,3 persen dsari batas didistribusikan secara adil, kebijakan ekonomi seperti soal melambatnya perekonomian maksimal 5 persen. akan bisa mengurangi ke- perijinan. Indonesia ini terlihat dari Darmin juga mengung- Soal Perdata Dan Datun miskinan, pengangguran “Percayalah Indonesia ber- lambatnya pertumbuhan kre- kapkan penurunan BI rate dan dan meningkatkan kesejah- komitmen penuh untuk me- dit perbankan nasional sampai imbauan bunga deposito se- BNI Teken MoU Dengan Kejatisu teraan masyarakat. Pemerintah juga akan memperkuat kemitraan de- lanjutkan reformasi dan men- jadi bagian dari upaya dunia mengatasi masalah masa ki- dengan akhir Oktober 2009 hanya 7 persen (YoY) diban- dingkan dengan tahun lalu besar 8 persen, belum diikuti turunnya bunga kredit bank. “Memang saya akui penuru- MEDAN ( Waspada): PT menyatakan, sebagai BUMN “Dengan piagam kerjasama (non litigasi) untuk dan atas ngan pihak swasta baik dari ni,” kata Yudhoyono. tumbuhnya kecil. nan bunga kredit lamban, tapi Bank Negara Indonesia (BNI) yang sebagian besar modalnya ini, kami berharap menjadi nama negara dan pemerintah. dalam dan luar negeri ter- Sementara itu, Ketua Pro- Hal itu membuat kredit beberapa bank sudah menu- Kantor Wilayah 01 Medan me- adalah milik Negara, maka di- landasan hukum bagi seluruh “Untuk itu, selaku perusa- utama untuk mengejar kebu- mosi hubungan Indonesia - sektor hanya tumbuh sebesar runkan bunganya hingga 10 nyerahkan penanganan hukum rasakan sangat perlu bantuan cabang dan unit BNI se Wilayah haan pemerintah apabila tuhan investasi sebesar 150- Malaysia Tun Musa Hitam me- 2 persen dan berpengaruh pa- persen,” ungkapnya. (dtc) bidang perdata dan tata usaha hukum dalam menjalankan 01 khususnya di Sumut,” menghadapi persoalan di bi- Negara (Datun) kepada Kejak- operasionalnya. Sebab, tak ja- jelasnya. dang perdata dan tata usaha saan Tinggi Sumut. Penyerahaan kuasa itu ter- tuang dalam nota kerjasama rang berbagai persoalan hukum mengiringi kegiatan yang dila- kukannya setiap hari Kepala Kejatisu Sutiyono menyatakan, PT BNI merupa- kan intitusi perbankan pertama negara, Kejaksaan dapat membantu menyelesaikan- nya. Tentunya dengan adanya Kembalian Uang Receh Pakai Permen Langgar UU BI (memorandum of understand- “Ini merupakan awal yang yang memberikan SKK dalam surat kuasa khusus dari ing) yang ditandatangani Ke- baik membuat kerjasama, bu- penanganan perkara Datun. PTPN,” jelasnya. jaksaan Tinggi Sumatera Utara kan artinya kami ada masalah. Dengan penambahan ini, maka Sedangkan untuk bantuan (Kejatisu) dan PT BNI Kanwil Namun seandainya ada masa- sudah 27 perusahaan BUMN hukum diluar pengadilan (non 01 Medan, Kamis (12/11) di ge- lah kita sudah ada payung hu- yang memberikan kuasa kepa- litigasi) dapat dilaksanakan MEDAN (Waspada): Pe- sehingga butuh perhatian nyidikan mengumpulkan buk- barang bukan makanan yang dung PT BNI Kanwil 01 Jln Pe- kum, untuk upaya advokasi dan da Kejatisu dalam mengawal dengan berbagai cara seperti ngusaha ritel yang melaku- serius. ti-bukti, bila ditemukan akan beredar dan diperdagangkan muda Medan. mediasi,” ucapnya. perkara di bidang Datun. negosiasi, mediasi, fasilitasi kan pengembalian permen Disamping melanggar atu- dilakukan penuntutan. di pasaran, sebut Radu. Dalam kesepahaman itu, PT Sejauh ini, pihaknya belum Dia menyatakan, sesuai de- atau arbitrase. “Sebab, tidak sebagai pengganti alat tukar ran BI tentang penyalahguna- Terkait banyaknya pelaku “Peraturan tentang itu efek- BNI memberikan surat kuasa mendapatkan kasus dari para ngan pasal 30 ayat 2 UU No 16 semua sengketa perdata dan rupiah kepada konsumen an alat tukar rupiah mengem- ritel melanggar, menurutnya tif tahun depan, 106 jenis barang khusus (SKK) kepada Kejatisu debitur atau kreditur yang nakal. tahun 2004 tentang Kejaksaan tata usaha harus diselesaikan saat membayar dikasir teran- balikan sisa uang pembayaran Dirjen Perdagangan Dalam tersebut sebagian besar elek- untuk penyelesaian berbagai Namun, perjanjian ini sebagai sudah diatur bahwa, di bidang melalui pengadilan, karena cam pidana karena telah me- konsumen diganti permen, Negeri telah beebrapa kali me- tronika kebutuhan rumah kasus perdata dan Datun di wi- bentuk upaya preventif dalam perdata dan tata usaha negara pada intinya penyelesaian langgar UU Bank Indonesia pelaku usaha ritel juga dapat manggil pelaku usaha, namun tangga dan kebutuhan hidup layah kerja BNI. penanganan persoalan-persoa- Kejaksaan dengan kuasa khusus yang sifatnya win win solution (BI) Nomor 23 Tahun 1999. dituntut UU Perlindungan alasannya hal itu terjadi akibat lainnya harus menggunakan Kepala Kantor PT BNI Wila- lan hukum yang terjadi diling- dapat bertindak baik didalam sangat diharapkan,” jelasnya. Pelanggaran UU BI tanpa Konsumen Nomor 8/1999, se- sulitnya mendapatkan uang bahasa nasional agar konsumen yah 01 Medan Muhammad Adil kungan PT BNI. (litigasi) dan diluar pengadilan (h05) delik aduan tersebut dapat butnya. pecahan bernilai kecil. tidak dirugikan,” katanya. dipidana enam bulan penja- Menurut UU Perlindu- Terhadap hal itu Bank In- Dalam kesempatan terse- ra atau denda Rp6 juta, demi- ngan Konsumen pelaku usaha donesia yang dihubungi telah but Kadisperindag Sumut Mudahkan Transaksi BBM, Bank kian dikatakan Direktur Di- rektorat Perlindungan Kon- sumen, Dirjen Perdagangan telah bertindak tidak setara dengan hak konsumen seba- gai pembeli, karena masyara- menyatakan kesiapan me- ngundang seluruh perbankan dan pelaku usaha ritel pada 26 Mohd Hasbi Nasution meng- imbau BPSK agar lebih proak- tif menjalankan fungsi dan Mandiri Luncurkan SOPP, e- TOLL Dalam Negeri, Radu M Sem- biring, Kamis (12/11). Menurut Radu disampai- kat tidak dapat menukar per- men tersebut kepada pelaku usaha menjadi rupiah, papar- Nopember agar tidak ada ala- san melakukan pengembalian permen karena uang pecahan tugasnya untuk melayani kon- sumen agar hak-hak masya- rakat dan keluarganya dapat MEDAN (Waspada): Guna Erika, Rustam Aji serta ratusan SOPP tidak lagi ke Pertamina prabayar contactless smart kan saat pelatihan motiva- nya. sulit didapat, katanya. terlindungi. Hadir dalam ke- efisiensi dan terjaminnya ke- pengusaha SPBU se Sumatera dalam menyelesaikan tran- card diterbitkan Bank Man- tor Badan Penyelesaian Namun pihaknya mengi- Sementara itu Direktorat sempatan itu Kadisperindag amanan pelaku usaha Stasiun Utara. saksi menyangkut pasokan diri bersama PT Jasa Marga Sengketa Konsumen (BPSK) ngatkan pelaku usaha ritel Perlindungan Konsumen De- Medan HT Basyrul Kamali, Pengisian Bahan Bakar Umum Dalam kesempatan itu bahan bakar minyak ke SPBU, dan lainnya. di Hotel Garuda Plaza, kasus agar segera mematuhi aturan, partemen Perdagangan RI anggota dan majelis hakim (SPBU) dan para pelanggan Marihot H Tambunan, menga- sehingga distribusi kepada Kartu tersebut dapat di- seperti itu masih sering ter- karena kasus tersebut tidak akan mengeluarkan peraturan BPSK Medan serta ratusan pe- dalam transaksi pelayanan ba- takan sistem on oline pemba- masyarakat luas guna meme- gunakan untuk pembayaran jadi terutama di kota-kota bersifat delik aduan sehingga tentang label harus berbahasa serta motivator BPSK tingkat han bakar, Bank Mandiri lun- yaran Pertamina (SOPP) untuk nuhi kebutuhan bahan bakar belanja di Indomaret dan besar seperti Jakarta, Medan petugas dapat melakukan pe- Indonesia terhadap 106 jenis nasional. (m40) curkan SOPP dan e-TOLL card. pelaku usaha SPBU tersebut akan lebih lancar, katanya. pembelian BBM diberbagai Hadir dalam acara pelun- dilakukan untuk memudah- Sambutan SPBU yang telah terpasang curan sekaligus sosialisai di Hotel Aryaduta Medan, Kamis kan transaksi guna suksesnya distribusi BBM di Sumut. Menurutnya sambutan pelaku usaha dalam tanya ja- mesin EDC Mandiri seperti SPBU Jalan Brigjen Katamso, Pemerintah Terima Rp15,5 M Dari TKI Sumut (12/11), Deputi Regional PT Sistem pembayaran mela- wab digelar PT Bank Mandiri SPBU Coco Pertamina Putri MEDAN ( Waspada): perlindungan 8.837 tenaga maan tersebut akan terus ber- sulit dipenuhi oleh para PJTKI Bank Mandiri Persero Kanwil lui internet banking yang da- tersebut sangat hangat sehing- Hijau serta di Kelambir Lima. Hingga Oktober 2009, pene- kerja Indonesia (TKI) asal Su- tambah dengan adanya po- akibat lemahnya kemampuan I Medan, Abdul Latif, Asissten pat dilakukan kapan saja ter- ga sebagian pengausaha telah Kartu prabayar untuk rimaan pemerintah dari jasa matera Utara yang telah dibe- tensi ekonomi di Malaysia calon TKI untuk menanggu- Vice President Bank Mandiri sebut disamping memudah- ada berminat untuk menda- BBM dan belanja kebutuhan remitensi dan penempatan rangkatkan BP3TKI tersebut yang diperkirakan akan terus langi biaya administrasi kebe- Marihot H Tambunan, dan kan juga terciptanya efisiensi patkan fasilitas SOPP Bank sehari-hari tersebut dapat perlindungan 8.837 tenaga telah mencapai Rp15,5 miliar tumbuh sehingga menujang rangkatan yang jumlahnya para staf. yang menghemat waktu se- Mandiri, ujarnya. diisi saldo bervariasi antara kerja Indonesia (TKI) asal Su- lebih, paparnya. pertumbuhan berbagai bi- antara Rp5 juta hingga Rp6,5 Dari PT Pertamina hadir singkat mungkin serta lebih Dalam kesempatan ter- Rp50 ribu, hingga Rp1 juta matera Utara yang telah di- Dari jasa pengiriman (re- dang industri negeri tersebut. juta. Ambasador Pemasaran Dan terjaminnya keamanan dan sebut PT Bank Mandiri juga bagi pelanggan dengan pem- berangkatkan BP3TKI men- mitensi) dana para TKI di luar Kebutuhan berbagai in- Sementara itu Malaysia Niaga Region I Sumatera, Ivan tidak berisiko, sebutnya. menjelaskan telah meluncur- bayaran ke Bank Mandiri ter- capai Rp15,5 miliar lebih. negeri kepada keluarganya dustri dan jasa di Malaysia ter- sangat menyukai pekerja In- Maltar, Humas Pertamina Fitri Pemakai jasa layanan kan e-TOLL card adalah kartu dekat, paparnya.(m40) Demikian hal tersebut hingga Oktober mencapai hadap tenaga kerja asal Indo- donesia yang masih satu bu- diungkapkan Kepala Balai Rp.14.082.419.700, dari pene- nesia khususnya dari Sumut daya, dan banyak persamaan Perikanan Sergai Terus Dikembangkan Pelayanan, Penempatan dan Perlindungan Tenaga Kerja Indonesia (BP3TKI) Sumut rimaan dana penempatan dan pembinaan yang dilakukan BP3TKI sebanyak Rp1.518.329. akan terus meningkat hingga Maret 2010 yang diperkirakan bakal mencapai di atas 5000 dan lebih menurut aturan sehingga tidak begitu sulit untuk melakukan penyesuai- PERBAUNGAN (Waspa- didampingi Wabup H. Soekir- payau atau tambak mencapai terbaik di Sumatera Utara. Sumadi M, kepada warta- 653, urainya. orang, ujarnya. an sehingga dapat dipeker- da): Potensi perikanan dan ke- man menegaskan, besarnya 400 ha. Selain itu, pada tahun wan, Rabu (11/11). Dalam kesempatan itu Su- Sementara itu jumlah per- jakan lebih cepat, sebutnya. lautan yang terdapat di berba- potensi perikanan baik perika- Luasnya areal budidaya 2010 akan dioperasikan satu Penerimaan pemerintah madi juga meyakinkan peneri- mintaan tersebut sepertinya (m40) gai wilayah Kabupaten Ser- nan tangkap, perikanan budi- perikanan ditambah panjang- Unit Pelaksana Teknis (UPT) dari para TKI yang diberang- dang Bedagai akan terus di- daya, perairan umum dan nya perairan pantai timur Su- Budidaya Air Payau di kawa- katkan ke luar negeri tersebut kembangkan pada masa-ma- sa mendatang dalam upaya pembangunan wilayah pesisir di Kabupaten Sergai merupa- matera yang terdapat di Sergai, apabila dikelola dan diman- san Pantai Klang Kecamatan Perbaungan. UPT ini diha- 2010 diperkirakan diperkira- kan akan terus mengalami Pasar Laptop Sumut Masih Besar menjadikan Sergai sebagai sa- kan modal besar bagi nelayan faatkan secara baik oleh para rapkan dapat menjadi tem- peningkatan seiring bertam- lahsatu daerah produsen ikan dan pembudidaya ikan di da- nelayan maupun pembudida- pat pelatihan bagi petani bahnya permintaan tenaga MEDAN (Waspada) : Ba- Plaza, Kamis (11/11). kan, pemerintah kota Medan terbesar khususnya ikan air erah ini untuk mengembang- ya ikan maka hasilnya akan pembudidaya ikan air payau kerja oleh Malaysia untuk nyaknya pemain baru sebagai “Oleh karenanya peluang menyambut baik kegiatan tawar dan ikan air payau (hasil kan sektor perikanan sebagai dapat meningkatkan kesejah- dengan komoditi ikan kera- sektor industri dan jasa, se- produsen laptop sepertinya untuk memperluas pasar bagi yang dilakukan oleh Apko- tambak). salahsatu sumber pendapatan teraan masyarakat di daerah pu, udang, kakap, rumput butnya. memberikan tanda pertum- perusahaan IT seperti laptop mindo. Hal itu dikemukakan Bu- bagi masyarakat Sergai. ini sekaligus juga dapat me- laut, kepiting dan lainnya, Dalam Oktober hingga buhan pasar notebook ini sa- juga masih sangat terbuka le- “Karena kegiatan ini ada- pati Sergai HT Erry Nuradi di Dikemukakan, potensi pe- ngurangi angka kemiskinan, ujar Erry Nuradi. Nopember tahun ini, pulu- ngat besar. Apalagi, nilai ru- bar. Sebagai kota terbesar ke lah selain membangun bisnis hadapan ratusan anggota ke- rikanan budidaya air tawar papar Erry Nuradi. Benih ikan yang diserah- han industri di berbagai tem- piah yang semakin menguat tiga di Indonesia, pertumbu- di kota Medan juga memaju- lompok pembudidaya ikan air yang terdapat di Kabupaten Untuk mendukung pe- kan itu meliputi 340 ribu ekor pat seperti Penang, Selangor, terhadap dolar AS. han dan kebutuhan akan pro- kan sumber daya manusia tawar pada acara penyerahan Sergai saat ini lebih 20.000 ha manfaatan potensi perikanan ikan gurame, 115 ribu ikan Perak, Seremban, Kuala Hal ini tidak hanya me- duk IT sangatlah besar,” ujar- (SDM) dengan pengenalan 455.000 ekor benih ikan dan meliputi kolam air tenang kata Erry Nuradi, Pemkab Ser- kerapu dan dialokasikan ke- Lumpur dan lainnya di Ma- mungkinkan konsumen men- nya. teknologi-teknologi baru. Ke temu ramah yang dilaksana- 6.908 ha, keramba 425 unit, gai melalui Dinas Perikanan pada 7 kelompok pembudi- laysia telah meminta 4000 dapatkan peluang harga mu- Hal ini, lanjutnya, tidak ha- depannya Pemko Medan ber- kan di areal Balai Benih Ikan kolam air deras, budidaya ikan dan Kelautan setiap tahunnya daya ikan, masing-masing TKI asal Sumut yang saat ini rah terhadap berbagai item nya untuk pebisnis, melainkan harap akan muncul kegiatan- (BBI) Pemkab Sergai di Desa di sawah 12.350 ha, kolam pe- telah dan akan terus melanjut- kelompok Kerapu Jaya Desa sedang diproses BP3TKI, produk juga semakin sema- juga untuk semua sektor ter- kegiatan seperti ini,” ujarnya Melati II Kecamatan Perbau- karangan/kolam pancing 744 kan pemberian bantuan sti- Kuala Lama, Kecamatan Pan- ujarnya. ngatnya produsen laptop un- masuk pendidikan. Untuk itu, Farid mengakui, tingkat ngan, Selasa (10/11). ha, pembenihan 75 ha, se- mulan kepada nelayan mau- tai Cermin dengan komoditi Permintaan kebutuhan tuk memproduksi produk- kegiatan pameran ini sangat penggunaan IT di masyarakat Bupati Erry Nuradi yang dangkan potensi budidaya air pun pembudidaya ikan di da- ikan kerapu, Kelompok Me- tenaga kerja asal Sumut ter- produk terbaru. diperlukan bagi masyarakat. saat ini masih tergolong ren- erah ini. kar Jaya Desa Pantai Cermin sebut diperkirakan akan Wakil Ketua Asosiasi Pe- “Selain mengenalkan tekno- dah. Umumnya teknologi IT Diungkapkan, sejak tahun Kiri (ikan kerapu), Kelompok terus berjalan hingga Maret ngusaha Komputer Indonesia logi terbaru, juga berguna masih didominasi oleh ma- Aceh Besar Sambut Forda UKM 2005 hingga 2009 perhatian Kakap Jaya Desa Pantai Cer- tahun depan, sehingga jum- (Apkomindo) Sumut, Adiyanto mendekatkan masyarakat de- syarakat perkotaan dan kelom- Pemkab Sergai untuk pem- min Kiri (ikan kerapu), Ke- lah TKI pada 2010 diperkira- menyatakan tahun lalu terca- ngan IT itu sendiri,” lanjutnya. pok mampu. Padahal seharus- KOTA JANTHO (Waspada): Pemerintah Kabupaten Aceh Walikota Medan diwakili nya teknologi bisa digunakan bangunan sektor perikanan lompok Timbul Jaya Desa kan akan melampaui jumlah tat penjualan sebesar 6 juta Besar menyambut baik rencana pembentukan Forum Daerah Asisten Bidang Kesejahteraan oleh siapa saja, tak terbatas Usaha Kecil dan Menengah (Forda UKM) di daerah itu. dan kelautan menjadi salah- Kota Pari Pantai Cermin (ikan 8.837 orang yang telah beker- unit laptop di Indonesia. “Jika satu prioritas utama, dibuk- kerapu), Kelompok Juvenil ja di negeri jiran saat ini, se- dibandingkan jumlah pen- Sosial, Farid Wajedi menyata- usia dan tempat. (m38) Hal itu diungkapkan Wakil Bupati Aceh Besar Anwar Ahmad usai menerima audiensi Panitia Persiapan Konferda I UKM tikan saat ini Pemkab Sergai Jaya Desa Pematang Gun- butnya. duduk yang berkisar 200 juta Aceh Besar di ruang kerjanya, Rabu (11/11). Anwar Ahmad menyebutkan keberadaan Forda UKM di telah memiliki Balai Benih Ikan (BBI) yang cukup besar tung Teluk Mengkudu (ikan kerapu), Kelompok Gurame Sementara itu penerima- an pemerintah dari jasa re- lebih, hal ini masih sangat ke- cil, ujarnya usai pembukaan Pungli Warnai Pendistribusian daerah itu sangat diharapkan dan bisa berperan aktif dalam dan bahkan termasuk yang Jaya, dll. (a07) mitensi dan penempatan Medan Comtech 2009 di Sun Kompor Gas Di T. Tiram membantu pemerintah setempat, terutama dalam membina para pengusaha kecil dan menengah. TANJUNGTIRAM (Waspada): Warga Desa Pematang Rambe, Valuta Asing Di Medan “Di daerah kita ini (Aceh Besar-red) cukup banyak pelaku Kec. Tanjungtiram, Batubara mempertanyakan kebijakan Harga Emas Di Medan Mata Uang Jual Beli oknum Kades Z yang diduga melakukan pungli untuk penguru- usaha kecil dan menengah yang membutuhkan pembinaan, sehingga pada akhirnya bisa mandiri dan hasil produksinya Jenis Kadar Harga Dolar AS 9.560 9.340 san mendapatkan kompor gas sebesar Rp20.000 per KK. bisa dikenal serta diminati, tidak hanya di daerah sendiri tetapi Dolar Australia 8.946 8.627 Sementara warga Desa Baganbaru dikenakan biaya melansir London Murni 99% Rp320.000 Franc Swiss 9.577 9.173 juga nasional dan internasional,” ungkapnya. ke beberapa dusun kondisi jalan rusak parah berlubang Rp2.000 London 97% Rp290.000 Poundsterling Inggris 15.894 15.447 Menurut wakil bupati, daerah dipimpinnya memiliki potensi Dolar Hongkong 1.271 1.170 sampai Rp10.000. Menurut salah seorang warga Pematang 24 Karat 90 s/d 93% Rp260.000 cukup besar untuk dikembangkan di bidang usaha kecil, kope- Yen Jepang 107,51 102,74 Rambe, Selasa (10/11) pengutipan untuk urusan ‘kompor elpiji’ Emas Putih 75 % Rp230.000 rasi dan usaha menengah. Karenanya, dia mengharapkan agar Dolar Singapura 6.931 6.693 dua kali, pertama saat pendaftaran dikenakan Rp10.000, kemu- 22 Karat 70% Rp165.000 Euro 14.366 13.952 Forda UKM terbentuk bisa bekerja maksimal dalam membantu dian dikenakan lagi ketika menerima kompor gas sebesar Rp10. Suasa 20 s/d 35% Rp100.500 Ringgit Malaysia 2.800 2.775 berbagai persoalan dan kendala dihadapi anggotanya.(b09) 000. Biaya pengurusan mendapatkan kompor Rp20.000. (a30)
  • 3. Luar Negeri 5 WASPADA Jumat 13 November 2009 Thaksin Kecam Thailand PHNOM PENH, Kamboja (AP): PM terguling mereka untuk berjiwa patriotisme yang salah. Thailand Thaksin Shinawatra menuduh para Mari kita doakan agar mereka suatu hari nanti pengecamnya sebagai orang yang berjiwa menerima kerjasama ini.” patriotisme yang salah dalam ceramahnya Kamis Setelah acara tersebut Thaksin terbang ke (12/11), menyusul kemarahan atas pengang- Siem Reap untuk bermain golf dan mengunjungi katannya sebagai penasehat ekonomi untuk kuil Angkor yang terkenal pada hari ketiga pemerintah Kamboja. kunjungannya ke Kamboja. Kedatangannya ke Berbicara di hadapan ratusan ahli ekonomi Kamboja membuat berang penguasa Thailand, Kamboja di ibukota Phnom Penh, Thaksin yang menuntut negara tetangganya itu meng- mengatakan banyak yang ingin ditawarkannya ekstradisinya untuk menjalani hukuman penjara untuk negara itu, dan berharap para pengecam dua tahun karena melanggar hukum konflik dinegaranyaakanmelihatkeuntungandarinegara kepentingan. tetangga yang stabil secara ekonomi. Pernyataan dari Kementrian Luar Negeri “Negara tetangga yang makmur berarti Kamboja Rabu mengatakan permintaan untuk memberi peluang lebih bagus bagi kita untuk menangkap Thaksin untuk diekstradisi tidak bangkit bersama,” kataThaksin.“Tentu saja, tidak akan dipenuhi karena kasus hukum terhadap semua orang memiliki pandangan seperti itu dirinya bermotif politik dan karenanya tidak sekarangini.Politikdalamnegerimerekamemaksa masuk dalam perjanjian ekstradisi negara itu.(m18) 350 Militan Taliban Mogok Makan Di Penjara Afghanistan KANDAHAR, Afghanistan (Antara/AFP): yang menyulut perkelahian. “Dia (prajurit itu) RatusangerilyawanTalibanyangditahandisebuah menghinakepemimpinanTaliban,sehinggaorang- penjara Afghanistan melakukan aksi mogok orang Taliban memukulinya, kemudian aparat- makan selama tiga hari untuk menuntut aparat penjara memukuli Taliban dengan parah perbaikan kondisi penahanan mereka, kata sehingga mereka dibawa ke rumah sakit,” katanya seorang pejabat dan seorang tahanan. dari sebuah lokasi yang dirahasiakan. Denganmenyebutparagerilyawanitusebagai Penjara Sarpoza adalah tempat penahanan ‘tahanan politik,’ToryalaiWesa, gubernur provinsi utamadikotaKandahar,ibukotaprovinsiKandahar Kandahar, Afghanistan selatan, mengatakan Rabu dan pusat spiritual militan meski pasukan (11/11), seluruh 350 orang Taliban yang ditahan pimpinan AS telah menggulingkan rezimTaliban di penjara Sarpoza menolak makan sejak Minggu. di Kabul pada 2001. Polisi setempat, aparat intelijen dan delegasi Taliban, yang memerintah Afghanistan sejak The Associated Press kementerian kehakiman mengunjungi penjara 1996, mengobarkan pemberontakan sejak BEREBUTAN INGIN Para petugas kepolisian mencegah seorang wartawan yang berusaha untuk membuat film Tatsuya Ichihashi — tersangka itu untuk mendengarkan tuntutan mereka dalam digulingkan dari kekuasaan di negara itu oleh utama pembunuhan seorang wanita Inggris yang mayatnya ditemukan di dalam bak mandi berisi pasir di apartemennya upaya yang gagal untuk mengakhiri aksi mogok invasi pimpinan AS pada 2001 karena menolak ABADIKAN TERSANGKA — yang berada di dalam mobil van poisi ketika meninggalkan Kantor Polisi Gyotoku di Ichikawa, di timur Tokyo, ketika makan itu, katanya. menyerahkan pemimpin Al-Qaeda Osama bin dia dikirimkan ke Kantor Jaksa Distrik Chiba Kamis (12/11). Ichihashi ditahan Selasa lalu setelah dilakukan perburuan “Sebuah delegasi gabungan yang mencakup Laden, yang dituduh bertanggung jawab atas PEMBUNUH selama dua tahun lebih. pemimpin agama, pejabat pemerintah Kandahar, serangan di wilayah Amerika yang menewaskan anggota dewan provinsi dan sesepuh suku sekitar 3.000 orang pada 11 September 2001. bersiap-siap melakukan pembicaraan dengan Terdapat lebih dari 100.000 prajurit interna- Dubes AS Menentang mereka untuk berusaha mengakhiri aksi mogok itu,” tambahnya. Salah seorang tahanan bernama Hafizullah mengatakan kepada AFP pemogok memiliki , empattuntutandanakanmenolakmakansampai tuntutan-tuntutan itu dipenuhi. sional, terutama dari AS, Inggris dan Kanada, yang ditempatkan di Afghanistan untuk mem- bantu pemerintah Presiden Hamid Karzai mengatasi pemberontakan yang dikobarkan sisa- sisa Taliban. Serangan-serangan Taliban terhadap aparat Pengiriman Pasukan AS ”Tuntutan-tuntut-an kami adalah kami keamanan Afghanistan serta pasukan asing diperlakukan dengan baik, tamu kami tidak meningkat dan puncak kekerasan terjadi hanya diperlakukan sewenang-wenang atau menjadi beberapa pekan menjelang pemilihan umum sasaran pengawasan, dan kami memperoleh presiden dan dewan provinsi pada 20 Agustus. makanan dan perawatan kesehatan yang lebih Lebihdari400prajuritasingtewassejakJanuari, baik,” katanya melalui telefon. yang menjadikan 2009 sebagai tahun paling Kawat Eikenberry juga me- mengambil alih tanggungjawab Jurubicara TalibanYousuf Ahmadi mengata- mematikanbagipasukaninternasionalsejakinvasi WASHINGTON (Antara/ kan, aksi mogok makan itu dilakukan akibat pimpinan AS pada 2001 dan membuat dukungan AFP):Dutabesar Amerika nyatakan kecemasannya me- ngenai sikap tak menentu Karzai, dalam menangani konflik. Pandangan-pandangan 1 Kg Logam Dikeluarkan penghinaan oleh seorang prajurit pro-pemerintah publik Barat terhadap perang itu merosot. menurut para pejabat AS yang Eikenberry ini bertolak-belakang Serikat untuk Afghanistan mengetahui memo tersebut, kata dengan pendapat komandan Dari Perut Seorang Pria Peru menulis memo kepada suratkabar tersebut. Korespondensi dikirimkan tertinggi militer AS dan NATO, Jend. Stanley McChrystal yang LIMA, Peru (Antara/AFP): Sungguh aneh peristiwa yang terjadi Hillary Imbau Myanmar Bebaskan Suu Kyi Washington yang sebelum Presiden Barack Obama memperingatkan, bahwa tanpa pada seorang pria Peru, sehingga mengejutkan para dokter! Beberapa MANILA, Filipina (Antara/Reuters): Amerika huru hara sebelum dihalau dari pintu gerbang menyatakan kekhawatiran menggelar sidang kabinet untuk bantuan puluhanribu tentara dokter di Peru utara telah mengeluarkan hampir satu kilogram Serikat Kamis (12/11) mengimbau lagi Myanmar misi itu, kata seorang juru foto AFP di lokasi itu. mengkritisi perang, Rabu, di tambahan AS dalam tempo 12 paku, koin dan potongan logam dari perut seorang pria, kata seorang agar membebaskan tanpa syarat ikon demokrasi Tidakadayangcederaseriusdalambentrokan mendalam atas kemungkinan Gedung Putih, yang membahas bulan mendatang, misi Afghani- ahli bedah yang mengoperasi pria itu, Rabu (11/11). Aung San Suu Kyi dan mengatakan, pemilu di tiu,katapolisi.Denganmeneriakkanslogan-slogan pengiriman ribuan tentara pendekatan yang dilakukan stan “tampaknya akan meng- “Pasien tersebut datang dengan keluhan sakit perut parah. Setelah negara itu tahun depan bisa diselenggarakan antiAmerika,paraanggotaLigaMahasiswaFilipina terhadap pemberontakan hasilkan kegagalan.” pemeriksaan, kami menemukan bahwa ada ratusan paku di dalam dengankredibeljikahanyaoposisiikutmengambil yang pro kiri membakar sebuah poster Uncle baru ke negara itu, kata berdarah di negara itu. Empat opsi dipaparkan di perutnya,” kata Carlos Delgado, ahli bedah di rumah sakit di kota bagian. Sam dan menuntut penarikan para penasehat Eikenberry ikut serta dalam meja perundingan di Situation kecil Cajamarca. “Kami meyakini bahwa penahanan Suu Kyi militer AS yang digelar di wilayah selatan negara media AS mengutip pejabat pertemuan kebijakan itu melalui Room Gedung Putih, yang juga Requelme Abanto Alvarado dibawa ke rumah sakit itu Jumat. selama beberapa tahun itu tidak berdasar, dan itu. Pasukan AS itu membantu pelatihan kontra senior AS. saluran video dari Kabul, kata the melibatkanMcChrystaldanMen- Setelah operasi selama dua jam, para dokter mengeluarkan 900 tidakditemukansatukesalahanpundaripemimpin teroris pada pasukan Filipina untuk memerangi Times. Suratkabar itu menam- teri Pertahanan Robert Gates, gram paku, koin dan potongan logam dari perut laki-laki tersebut, oposisi itu,” kata Menteri Luar Negeri AS Hillary gerilyawan Moro, tetapi kehadiran mereka di bahkan bahwa Obama mem- setelah para pejabat melaporkan serta satu pisau kecil. Clinton dalam konferensi pers di Manila, ibukota pulau Mindanao itu adalah satu “penghinaan Dubes Karl Eikenberry bahas laporan tersebut dengan- bahwapresidenbelummembuat “Saya tak pernah menghadapi kasus seperti ini,” kata ahli bedah Filipina. besar terhadap integritas dan kedaulatan nasional mengirimlaporankawatberisikan nya, menurut para pejabat yang keputusan. itu. “Saya telah mengoperasi banyak pasien, tapi begitu banyak benda Polisi Filipina membubarkan protes anti AS Filipina,” kata para pemrotes dalam sebuah detil penentangan kerasnya ter- minta tak disebut namanya. Dutabesar telah bertahun- di dalam satu perut, benar-benar bukan peristiwa biasa.” Alvarado dekat kedutaan besar AS di Manila, Rabu, sehari pernyataan. Filipina adalah bekas koloni AS. hadap pengiriman bala bantuan Dubes juga menyampaikan tahun berpengalaman dengan berada dalam kondisi stabil setelah operasi tersebut, kata Delgado. menjelang kedatangan Menteri Luar Negeri AS “Itu adalah bukti bahwa kita tetap berada sampai pemerintah Presiden Af- kecemasannya bahwa pengirim- militer Afghanistan, pernah Ditambahkannya, ia kini sedang diperiksa oleh para ahli kesehatan Hillary Clinton, kata para pejabat. Sekitar 70 dibawah perintah Amerika,” kata Sekjen Liga ghanistan Hamid Karzai me- an puluhanribu tentara tambah- menjabat dua kali tugas militer mental. mahasiswa terlibat bentrokan dengan polisi anti itu Terry Ridon. nunjukkan pihaknya bisa an ke negara yang porak poranda di negara itu dari 2005 sampai mengatasi korupsi yang tersebar akibat perang itu akan bisa 2007, ketika dia komandan luas yang memacu pemberon- meningkatkan kepercayaan Af- tertinggi AS di sana. takanTaliban, kata TheWashing- ghanistan terhadap pasukan Sebelumnya, dari 2002-2003 ton Post danNewYork Times Rabu keamanan AS, pada saat peme- dia memimpin latihan pasukan (11/11). rintah Obama menyeru Kabul keamanan Afghanistan. Korut: Korsel Bakal Hadapi Konsekwensi Mahal SEOUL, Korea Selatan (AP): kepadaAP Rabu bahwa seorang ton dengan tujuan menumbuh- Korea Utara Kamis (12/11) me- tentara Korut tewas dan tiga kan sentiment anti-Korut di ngancam Korea Selatan dengan lainnya cedera. kalangan pejabat Amerika. hukuman yang mahal terkait Kamis, suratkabar Minju Presiden AS Barack Obama bentrokan yang menyebabkan Joson yang dikelola pemerintah berencana mengirim utusan satu kapalnya rusak berat dan Korutmengingatkandalamtajuk- senior ke Pyongyang akhir tahun seorang tentaranya tewas. nya, Korsel akan menghadapi ini untuk melakukan pembicara- Angkatan Laut kedua negara ‘konsweksi yang mahal’ jika terus an langsung pertama antara Korea itu terlibat pertempuran melancarkan sikap permusuhan kedua negara. singkat di laut Selasa, pertama terhadap Korut. Tajuk tersebut, Menlu AS Hillary Rodham kali dalam tujuh tahun terakhir, yang disiarkan KCNA, tidak men- ClintonmengatakandiSingapura, di mana masing-masing menu- jelaskankonsweksiapayangbakal pertempuran itu tidak akan ding pihak lawan melakukan dihadapiKorseljikaterusmeman- membatalkan kunjungan utusan pelanggaran atas perbatasan laut cing kekisruhan dan menyalah- khusus AS Stephen Bosworth ke yang diperebutkan dan mele- kan Korut atas insiden maritime Pyongyang. paskan tembakan. itu. Korsel siaga penuh menyusul Para pejabat Korea Selatan Suratkabar utama Korut bentrokan tersebut untuk meng- (Korsel) mengklaimmenang,dan Rodong Sinmun mengeluarkan hadapi kemungkinan serangan mengatakan satu kapal Korea tajuk yang sama, menurut KCNA, balik. Media Korsel melaporkan Utara (Korut) rusak berat dalam menuding Korsel sebagai ‘hobi negara itu mengerahkan empat pertempuran dua menit itu. perang’ Minju Joson mengatakan . kapal penghancur dan kapal Mereka mengatakan satu kapal bentrokan tersebut terjadi dari perang dekat perbatasan laut – Korsel rusak ringan dan tidak ada rencana Korsel untuk mengga- tempat terjadinya dua pertem- korban di pihak mereka. Seorang galkan pembicaraan langsung puran sebelumnya di tahun 1999 tentara senior mengatakan antara Pyongyang danWashing- dan 2002.(m18) Kolombia Laporkan Ancaman Perang Chavez Ke DK PBB BOGOTA, Kolombia (An- pas pedagang obat bius dan Presiden Venezuela itu pernah tara/Reuters): Kolombia menga- pemberontakMarxisdiKolombia. menyebut mantan presiden AS jukan kepada Dewan Keamanan Dalam satu pidato di televisi, George W.Bush “setan”. PBB apa yang disebutnya ancam- Minggu, Chavez memerintahkan Tuduhmenuduhitumening- an perang dariVenezuela setelah militermempersiapkandiriuntuk kat belakangan ini, dan Kolombia Hugo Chavez, presiden negara perangsebagaijalanterbaikuntuk menuduh Chavez tidak mem- tetangganya itu, mengemukakan mempertahankan perdamaian. bantu memerangi pemberontak kepada militernya agar bersiap Kolombia menanggapi itu dalam yang berlindung di dalam per- untuk perang. sebuah surat ke Dewan Keaman- batasan Venezuela sementara Selama beberapa bulan, an PBB “tentang ancaman Ven- Chavez menyebut Kolombia Chavez mengatakan perjanjian ezuela untuk menggunakan ke- militer yang ditandatangani kuatan militer terhadap Kolom- sebagai “anjing peliharaan antara Bogota dan Washington bia,” kata sebuah pernyataan pemerintah” AS. Oktober lalu dapat menjadi jem- Kementerian Luar Negeri. “Siapkan diri anda untuk batan bagi serbuan AS terhadap “Pemerintah Kolombia perang,”kataChavezkepadapara Venezuela dari wilayah Kolom- meminta surat itu disebarkan ke komandan militernya dalam bia.AS dan Kolombia Rabu (11/ semua anggota Dewan Keaman- program regulernya di Sunday 11) membantah tuduhan itu dan an,” kata pernyataan itu. Penga- TV. “Jika anda menginginkan mengatakan kerja sama mereka duan resmi itu dapat membuat perdamaian anda harus siap bertujuan hanya untuk menum- Chavez semakin marah lagi. untuk perang.
  • 4. 6 Sport WASPADA Jumat 13 November 2009 Portugal Favorit Tanpa Ronaldo LISBON (Waspada): Benteng Seleccao akan diuji oleh ketajaman serangan Bosnia, Portugal tanpa Cristiano yangdalam10lagakualifikasitelah mencetak25gol.“Mereka(Bosnia) Ronaldo dalam playoff Piala punya tiga pemain yang dapat Dunia 2010 zona Eropa, tapi membuat gol,” jelas Queiroz. Dia pun menunjuk Edin mereka tetap favorit untuk Ezeko yang mencetak sembilan mengatasi Bosnia dan lolos gol di babak kualifikasi dan ber- peran atas sukses VfLWolfsburg ke Afrika Selatan. menjuarai Bundesliga dengan menyumbang 26 gol musim lalu. Rekan satu klub Dzeko, Simpang siur soal kesiapan Zvejzdan Misimovic yang ber- bintang Real Madrid itu akhirnya nomor punggung 10, pun tuntas setelah hasil tes medis merupakan pemain berkelas. menyimpulkan bahwa Ronaldo Sedangkan Zlatan Muslimovic tidak mungkin tampil dalam duel merupakan pemain produktif. AP leg pertama di Lisbon pada Sabtu BosniajugamasihpunyaMiralem Bintang Barcelona Lionel Messi dengan Trofeo Di Stefano 2009 pose bersama legenda sepakbola (14/11) dan leg kedua di Zenica Pjanic dari klub Lyon yang ahli Alfredo Di Stefano dan Diego Armando Maradona (kanan) di Madrid, Rabu (Kamis WIB). empat hari kemudian. tendangan bebas. Pelatih Bosnia Miroslav Dengan absennya Ronaldo, Seleccao mengandalkan winger ManchesterUnitedLuisNanidan Blazevic, pria cerdas berusia 74 tahun yang mengantar Kroasia Messi Menangkan Trofeo Di Stefano 2009 striker Atletico Simao Sabrosa, ke semifinal Piala Dunia 1998. MADRID (Waspada): Bintang Barcelona selama 30 hari dan mengajaknya bicara. Messi yang sama-sama tampil bagus Menurut Blazevic, timnya akan Lionel Messi kembali mendapat penghargaan juga punya kesempatan itu dan dia bisa melaku- dan mampu mencetak gol pada mengunci Portugal di lapangan pribadi tahun 2009 ini berupa Trofeo Di Stefano kannya,” beber Bilardo yang menjadi pelatih pertandingan sebelumnya. tengah. dari koran ternama Marca sebagai pemain terbaik ketika Tango menjuarai Piala Dunia 1986. Pelatih Carlos Queiroz juga Prakiraan Pemain: di Spanyol. “Sebelum berangkat ke Meksiko, saya punya berharapplaymaker Deco Souza Portugal: Eduardo; Miguel, Penilaian pemenang didasarkan atas prestasi masalah dengan Maradona. Saya selalu ditanya AP Ricardo Carvalho, Bruno Alves, dapat mengulang kecemer- Deco Souza melompat untuk menghindari sergapan kiper Hilario dalam sesi latihan tim Portu- pemain di La Liga Primera, Copa Del Rey dan mengapa dia menjadi starteratau memberinya langannya saat memperkuat Duda; Pepe, Deco Souca, Raul Piala Super Spanyol. Para juri yang ditunjukMarca ban kapten. Saya punya arsipnya dari koran,” gal di Stadion Luz, Lisbon, Kamis (Jumat WIB). Meireles; Nani, Simao Sabrosa, Chelsea akhir-akhir ini. Menurut merupakan pesepakbola legendaris seperti kenang Bilardo. Queiroz, pengalaman akan men- Liedson. Alfredo Di Stefano, JorgeValdano, Andoni Zubi- “Maradona kerap membicarakan Messi. Dia jadi faktor kunci untuk meme- memiliki naluri menyerang juga kandidat kuat untuk lolos Piala dan hanya kebobolan lima gol Bosnia: Kenan Hasagic; Emir zarreta, Fernando Hierro, Emilio Butragueno, salah satu pemain terbaik dunia dan kami harus nangiplayoff nanti. “Kami mesti sangat berambisi untuk meraih Dunia,” tegas pelatih Portugal di babak kualifikasi. Sebelumnya, Spahic, Sanel Jahic, Boris Pandza, Luis Aragones, Luis Suarez, Johan Cruyff dan membuatnya tampil dalam kondisi terbaik,” memanfaatkan pengalaman dan tiketbuatpertamakalinya.Apalagi Carlos Queiroz, seperti dikutip posisi Portugal terancam karena Safet Nadarevic; Elvir Rahimic, Zinedine Zidane. katanya lagi. kematangan kami,” tegasnya. jalan mereka kini sudah sangat dari Reuters, Kamis (12/11). tiga kali seri. Bek kanan Jose Zvjezdan Misimovic, Sejad Messi menerima penghargaan itu Rabu Messi merupakan kandidat penerima Bola Seleccao kini berada di dekat. Skuad Queiroz punya mo- Bosingwa cedera, namun Por- Salihovic, Miralem Pjanic; Edin malam waktu Spanyol atau Kamis (12/11) pagi Emas dan PemainTerbaik FIFA. Namun dia gagal peringkat 10 dunia, 32 tingkat di “Teorinya, kami punya mentum bagus setelah dapat tugal masih bisa mengandalkan Dzeko, Vedad Ibisevic. Wasit: WIB, diserahkan langsung oleh Di Stefano dengan tampil baik bersama Tango, sehingga Maradona atas Bosnia. Namun Bosnia yang kewajiban untuk menang. Kami memenangi tiga laga terakhirnya Paulo Ferreira dan Miguel. Martin Atkinson (Inggris). didampingi pelatih Argentina Diego Armando dikritik telah salah dalam memilih pemain dan Maradona. taktik. Tetapi Bilardo membela Maradona yang “Saya bangga berada di samping Maradona justru sempat bersitegang dengannya, sebelum dan Di Stefano dan sangat senang dengan apa Albiceleste akhirnya lolos ke Afsel 2010. Buktikan Yunani Berharga yang mereka berikan kepada saya,” ucap Messi, yang menyisihkan gelandang Barca Xavi Hernandez dan Andres Iniesta, serta striker “Argentina bermain baik selama 20 menit melawan Brazil, Ekuador dan Uruguay (tapi akhirnya kalah). Memang ada kalanya Argentina kukan sesi latihan pertamanya berhak maju ke putaran berikut- muda bagus dan berpengalaman Atletico Diego Forlan. tampil buruk, tim saya tahun 1986 juga sempat pada Rabu. Ukraina merupakan nya,” tegas pemain berusia 30 dan memiliki pelatih yang sudah Menurut Direktur Tehnik Tim Argentina kurang padu sebelum berangkat ke Meksiko. negarayangmenyebabkanYunani tahun itu. berpengalaman lama serta Carlos Bilardo, partisipasi Messi di Tim Tango “Kekompakanbisaditemukanmelaluipertan- gagal maju ke Germany 2006, se- “Kami menginginkan keme- memiliki disiplin. Saya yakin mirip fenomena Maradona pada 1986. Bersinar dingan. Para pemain tahu itu dan kini Maradona telah mereka menang di Athena. nangan dengan tidak kemasukan peluang kedua tim untuk lolos bersama El Barca, Messi miris di timnas, persis sedang mengupayakannya,” turur Bilardo, yang Ukraina yang semakin bagus, gol, tetapi bila hasil tanpa gol pun 50-50,” katanya lagi. (h01/uefa/ seperti Maradona saat jadi maskot di Napoli. membela kebijakan Maradona untuk tidak mendapatkan tempat di babak harapan kami masih tetap hidup. ant/rtr) “Tahun1986silam,sayafokuspadaMaradona melakukan latihan pagi hari. (h01/bb/goal/rtr) playoff, setelah menang 6-0 atas Merekadalamkondisiamatbagus Andorra di kualifikasi akhir Grup saat ini dan kami merasa amat 6. Sedangkan Hellas tembus setelah menang atas Latvia dan optimistis,” katanya menam- bahkan. Polisi Sempat Tahan Sanz Luksemburg di Grup 2. Di kubu Ukraina, pelatih MADRID (Antara/AFP): Polisi Spanyol ketiga’ yang tidak disebutkan namanya itu melelang Negeri Seribu Dewa itu men- Olexiy Mikhailichenko menge- sempat menahan mantan presiden klub Real sejumlah lukisan di balai lelang di Venesia. Sanz dapat semangat baru dengan luarkan bomber kurang penga- Madrid Lorenzo Sanz, yang dicurigai membawa diinterogasi polisi karena benda-benda seni itu kembalinya striker Angelos laman Andriy Voronin. Striker bendasenidariSpanyolkeItaliatanpakelengkapan dibawa ke luar negeri tanpa izin. AP Charisteas, gabung dengan berusia 30 tahun asal klub Liv- dokumen. “Saya tidak melakukan apa-apa dalam kasus Theofanis Gekas yang mencetak erpool kurang diperhatikan sejak Petugas menahan pria berusia 66 tahun pada ini. Ada yang mengurus prosedur untuk lelang ATHENA (Waspada): Pelatih dalamplayoffuntukmenentukan gol terbanyak dalam babak dia mengkritik Mikhailichenko Rabu siang di pusat kota Madrid dan membawa- ini,” dalih Sanz, Presiden Real Madrid pada 1995- Yunani Otto Rehhagel (foto), me- tempat ke Afrika Selatan. kualifikasi dengan 10 gol. Juga ada melalui media pasca melawan nya ke kantor polisi untuk diinterogasi beberapa 2000. Sanz biasa menggunakan uang pribadinya ngimbau para pemainnya agar “Kami sudah sampai pada bomber Celtic Giorgos Samaras Kosta Rika, Oktober lalu. jam dengan ditemani pengacaranya, lapor radio untuk mendatangkan pemain bintang ke Real, di membuktikan mereka berharga ujung perjalanan. Pada pertan- sebagai trisula di lini depan. Mikhailichenkomengatakan, Cadena Ser, Kamis (12/11). Dia kemudian dilepas antaranya penyerang Kroasia Davor Suker dan tanpa syarat jaminan. Kepada kantor berita Predrag Mijatoviv. Di tangannya, El Real menjuarai dan pantas mendapat tempat di dinganmendatanginilahkitaharus Hellas juga akan diperkuat Ukraina tidak akan melaju bila Europa Press Sanz mengata-kan bahwa ‘pihak Liga Champions 1998 dan 2000. putaran final Piala Dunia 2010. membuktikan bahwa kita pantas gelandang Panathinaikos Kostas cuma cari aman pada leg perta- Juara Eropa 2004 itu akan mendapat hadiah,” ucuap pelatih Katsouranis, yang menyatakan ma.“KamipergikeYunanidengan menjamu Ukraina di Stadion berusia 71 tahun dari Jerman itu, keyakinannya Yunani akan target menang. Bagi kami tidak OlympicAthena,sebelumbertan- seperti dilansir Reuters, Kamis terbang ke Afsel. “Dua tim amat ada bedanya pertandingan tan- dang ke Donetsk sebagai laga (12/11). bagus akan bertanding, tapi pada dang atau kandang,” tekadnya. kedua empat hari kemudian Anak-anak Hellas telah mela- akhirnya saya yakin kami akan “Yunani memiliki pemain Getafe Depak Espanyol MADRID (Antara/Reuters): Getafe maju ke putaran 16 besar Piala Raja Spanyol, Rabu (Kamis WIB), setelah menang agregat 3-1 atas Espanyol. Tim yang bermarkas di Madrid itu memimpin 2-0 pada leg pertama di kandang sendiri, lantas imbang 1-1 di Barcelona pada leg kedua. Hasil seri itu sudah cukup bagi Getafe untuk melewati Espanyol yang menyandang gelar juara 2006. Striker Roberto Soldado membuat Getafe memimpin lebih dahulu. Soldado melewati barisan bertahan Espanyol setelah mendapat bola panjang dari tendangan kiper Jordi Codina dan dengan dingin menjebloskan bola melewati Cristian Alvarez. Bomber asal Uruguay Ivan Alonso menyamakan kedudukan menit 37, setelah sebelumnya Codina menjinakkan gebrakannya hasil umpan lambung dari Shunsuke Nakamura. Pada pertandingan lainnya, finalis musim lalu Athletic Bilbao bermain imbang 2-2 lawan tim divisi dua Rayo Vallecano, sehingga Vallecano menang agregat 4-2. Racing Santander kalah 0-1 atas tim divisi dua Salamanca pada leg pertama, menang 4-1 pada leg kedua, sehingga angka agregat menjadi 4-2. Real Mallorca menang 1-0 atas Real Valladolid, untuk lolos ke babak 16 besar dengan keunggulan gol tandang dalam agregat 2-2. AP Bek Espanyol Ben Sahar (kiri) dibayangi dua pemain Getafe di Cornella-El Prat stadium, Rabu (Kamis WIB). Timnas Uji Rumput Stadion Kuwait SC KUWAIT CITY (Waspada): dan saat ini ada empat pemain rumah pada 18 November di Tim senior Indonesia akan dari Salmiya yang bermain di Jakarta. menguji rumput Stadion Kuwait Timnas Kuwait,” katanya. (h01/ant/afc) SC yang menjadi tempat laga Soal formasi pemain Indo- kualifikasi Piala Asia 2001 nesia, menurut Chandra, pelatih melawan tuan rumah Kuwait, BennyDollo(foto)akanmenurun- Hasil & Jadwal Grup B: Sabtu (14/11) malam ini. kan Markus Horizon, Ismed 19/01/09:OmanvsIndonesia 0-0 “KamihariinidanJumatakan Sofyan, CharisYulianto, Maman 05/03/09: Australia vs Kuwait 0-1 ujicoba rumput dan melaksana- Abdurahman, Isnan ali, Eka 28/01/09:KuwaitvsOman 0-1 kan latihan di Stadion Kuwait SC,” Ramdani, Syamsul Chaeruddin, Indonesia vs Australia 0-0 kata asisten manajer Timnas yang terbaik pada saat melawan Ponaryo Astaman, Boaz Sallosa 14/10/09:AustraliavsOman 1-0 Chandra Solehan dari Kuwait, Kuwait 14 November,” pinta ,MIlhamdanBambangPamung- 14/11/09:KuwaitvsIndonesia - Kamis (12/11). Chandra. kas. Oman vs Australia - Dia berharap, dukungan dan Soal satu-satunya ujicoba di Benny juga membawa Boaz 18/11/09:IndonesiavsKuwait - doa masyarakat Indonesia untuk Kuwait, Chandra menyatakan, Solossa dan pemain muda Rach- 06/01/10 : Kuwait vs Australia - hasilterbaikbagitimnaspadalaga hasil melawan klub lokal Salmiya mat Latief. “Untuk pemain peng- IndonesiavsOman - ketiga nanti. Indonesia sebelum- SC berkesudahan dengan skor ganti, Benny memasukkan Fir- 03/03/10: Australia vs Indonesia - nya bermain imbang 0-0 lawan 0-0, Selasa malam lalu. Menurut- man Utina, Hariono, TA Musafri, OmanvsKuwait - tuan rumah Oman dan tanpa gol nya, pelatih Salmiya dari Belgia Ridwan Saktiawan Sinaga,” saat menjamu Australia di Ja- dan dalam tim itu terdapat jelasnya. Klasemen Grup B: karta. delapanmantanpemainnasional Anak-anak Indonesia telah Australia 3 1 1 1 110 4 “Mohon doa dari masyarakat Kuwait. berada di Kuwait sejak Sabtu lalu. Oman 3 1 1 1 110 4 Indonesia.... Mudah-mudahan “Tahun ini Slamiya merupa- Setelah jadi tamu di Kuwait City, Kuwait 2 1 0 1 110 3 Tim Indonesia bisa memberikan kan klub peringkat tiga di Kuwait Timnas gantian sebagai tuan Indonesia 2 0 2 0 0 0 0 2
  • 5. WASPADA Jumat 13 November 2009 Sport 7 Persiraja Kurang ‘Membunuh’ BANDA ACEH Anwar ketika dihubungi jadikan gol. “Dari tujuh peluang, 2-3. Sawang, dan Samsul Bahri dan Waspada dari Banda Aceh, hanya dua yang menjadi gol,” Lalu, Persiraja menang 2-0 Esalan Pello Benson (tengah), (Waspada): Hasil positif yang Kamis(12/11)menyebutkan,pada jelasnya. atasWarta FC Medan dan dengan Abdul Musawir, Fahrizal Dila, dituai Persiraja selama prinsipnya dia ingin timnya lebih Padahal, dia ingin skuadnya skor sama juga mengalahkan Nanda Lubis, Syamsul Arifin, ujicoba di Medan tak produktif lagi. “Kemenangan lebih menggigit lagi dan tak cepat MedanUnited.Dalamlagakontra Zulkarnaen dan Amos Marakitas. dalam ujicoba belum menjadi puas dengan hasil yang sudah timPONSumut,NandaLubisdan PT Liga Indonesia sudah memuaskan sang arsitek. acuan. Itu akan membantu kami dikantongi dalam laga. “Karena kawan-kawan menang 3-0.“Ada mengumumkan tim-tim yang Pelatih Persiraja, Anwar untuk mencari formasi terbaik,” itu, kami masih mencari-cari satu laga melawan PSDS Deli Ser- akan bertanding pada kompetisi katanya. formasi tim yang terbaik untuk dang, setelah itu kita segera kem- LigaDivisiUtama2009/2010yang menginginkan timnya lebih Menurut mantan arsitek menghadapi kompetisi nanti,” bali ke Banda Aceh,” kata Anwar. akan digelar 25 November nanti. ganas dan ‘membunuh’ saat PSAP Sigli dan PSSB Bireuen ini, ujar Anwar. Dalam ujicoba itu, Persiraja LigaDivisiUtamainidibagidalam berada di depan gawang dalam tiga ujicoba yang sudah SejakRabu(4/11)lalu,Tarmizi memboyong Dicky Anggriawan, tiga grup, yakni grup barat, tengah mereka lakukan, dia mengaku Rasyid cs melakukan ujicoba Masykur, dan Edi Gunawan dantimurberdasarkansitusresmi lawan. Keinginan tersebut belum puas melihat kerja anak dengan sejumlah tim di Sumatra (kiper), Andrea, Hendra Saputra, Liga Indonesia. belum mampu dibuktikan buahnya di lapangan. Ketidak- Utara. Sampai kemarin, Azhari Rahmad, Kurniawan, Putra Persiraja serta dua timTanah Waspada/Muhammad Riza striker tim berjuluk Laskar puasannya, pada ketidakmam- cssudahmenjajaltigatimMedan, Habibi, Adriansyah, Fahrizal, Rencong lainnya, yakni PSAP dan GOL PSAP: Kiper Bank Sumut Surya Darma tidak mampu menahan tendangan gelandang PSAP puan para pemainnya dalam antara lain lawan Delima Putra Oktavianus Udam, dan Tarmizi PSSB bergabung di Grup 1 yang Sigli, Zainul, yang menyebabkan gol pertama bagi PSAP di Medan, Kamis (12/11) sore. Dalam Rencong itu. memanfaatkan peluang men- yang dimenangkan Musawir cs Rasyid serta Tong Mayega Ely juga diisi PSDS, PSMS, Semen pertandingan eksibisi ini, PSAP yang sebelumnya ditaklukkan PSMS Medan 3-1, sukses mempecundangi (pemain bawah). Padang, Persires Rengat, Persih Bank Sumut 2-1. Lalu Suryadi Kamaruddin, Tembilahan, Persita, Persikabo, PSAP Pecundangi Bank Sumut Fran/Pia Jumpa Hendra/Vita Erik Saputra, Azhari, Mukhlis Persipasi dan PS Banyuasin. (b05) MEDAN (Waspada): Bank memperkecilkekalahan2-1lewat sebagai striker. JAKARTA (Waspada): Ganda campuran lapis kedua Pelatnas Series ketiga setelah Denmark danPerancisitu,terusmemimpin Hendra/Vitayangpernahmenjadi senior mereka di Pelatnas. Pidie Jaya Selangkah Sumut menelan pil pahit setelah dipermalukan bonden julukan tendangan bebas. Skor ini bertahan sampai peluit panjang “Kamilihatdalamduaujicoba ini, kondisi pemain sudah Fran Kurniawan/Pia Zebadiah menumbangkan unggulan per- hingga 19-17. Lawan sempat menyamakan kedudukan 19-19 “Percaya diri sih pasti karena merekajuaraOlimpiade,tapikami Lagi Divisi II Laskar Aneuk Naggroe (The Lan) ditiupkan wasit. membaik dan anak-anak telah tama sekaligus juara Olimpiade sebelum Fran/Pia merebut game tidak mau puas sampai di sini. PSAP Sigli 2-1 di Lapangan Asisten pelatih PSAP Drs bermain maksimal. Kendati Beijing asal Korea LeeYong Dae/ pertama 21-19 dalam 15 menit. Besok kami akan berusaha main MEUREUDU (Waspada): PS Pidie Jaya selangkah lagi menembus Gaperta Kodam Bukit Barisan, Ridwandi kepada Waspada me- begitu kita juga masih punya Lee Hyo Jung pada putaran Setelah bergantian meraih bagusdantetapsemangat,karena Divisi II pasca menahan tuan rumah Persal Aceh Selatan 1-1 pada Medan, Kamis (12/11) sore. ngatakan, PSAP tidak menurun- kelemahan, yang nantinya akan kedua Hongkong Terbuka. angka pada awal game kedua, mereka juga pasti mau menang hari terakhir kompetisi Divisi III Liga Indonesia Grup III Wilayah Gol pertama PSAP tercipta kan tim inti lawan Bank Sumut. terus kita evaluasikan,” ujar Dalam duel di Queen Eliza- Fran/Pia melaju untuk memim- untuk mengejar poin menuju Sumatera Bagian Utara (Sumbagut) di Stadion Naga Tapaktuan, lewattendanganbebasgelandang Para pemain lapisan kedua Ridwandi. beth Stadium, Hongkong, Kamis pin 14-5 namun terkejar hingga Final Super Series,” tekad Fran. Kabupaten Aceh Selatan, Rabu sore. serangZainulpadamenit15babak diturunkan, karena menurutnya, Dia menyebutkan, kegunaan (12/11), Fran/Pia membukukan 18-18. Pemain asal Djarum Kudus Target menang untuk menjaga peluang lolos ke babak selanjutnya pertama. Unggul 1-0 PSAP terus itu dalam upaya melihat sejauh dari ujicoba ini untuk melihat kemenangan 21-19, 21-19 atas Ganda Korea peringkat satu DionysiunHayomRumbakajuga 16besartingkatnasional,membuatkeduatimlangsungmemperagakan melancarkanserangankebenteng mana kualitas mereka. sejauhmanakemampuanpemain ganda campuran peringkat satu dunia itu tampaknya ingin melanjutkanpenampilannyayang permainan menyerang. Hasilnya, pertandingan baru berjalan 22 Bank Sumut. Sedangkankekalahan1-3saat menerapkan hasil latihan.“Yang dunia itu dalam 34 menit. memaksakan game penentuan mengesankan dalam turnamen menit, Ikhsan yang mengawal gawang Pidie Jaya sudah dipaksa Sekira menit 30 usia melawan PSMS Medan, dia jelas kita akan terus memperbaiki Fran mengatakan, mengu- saat memimpin 19-18, namun berhadiah 250.000 dolar AS itu. memungutboladijalagawangnyasendiri,setelahgagalmengantisipasi pertandingan, IrfanYasin menge- mengaku, itu disebabkan masih kekuarangan tersebut dan selalu rangi kesalahan sendiri menjadi Fran/Pia merebut tiga poin ter- Sehari setelah mengalahkan tendangan Bustanul Khairil. coh kiper Surya Darma hingga kurangnya mental anak-anak meminta dukungan dari salah satu kunci kemenangan akhir untuk menutup pertan- unggulan delapan Boonsak Tersentak gol tuan rumah, Pidie Jaya terus berupaya kedudukan menjadi 2-0 bagi besutannya.Selainitujugakerena masyarakat,” katanya lagi. mereka. “Kuncinya kami tidak dingan dan memastikan tempat Ponsana dari Thailand, pemain mengimbangi. Demikian dilaporkan Manajer HYusri Abdullah SH anak-anak Sigli. belum bergabungnya dua legiun Jumat (13/11) sore ini, PSAP mau kalah dan mengurangi di perempatfinal. yang harus melalui babak yang juga Ketua Harian PS Pidie Jaya kepada Waspada dariTapaktuan, Skor bertahan hingga turun asing, Mousa Traure sebagai akan menantang PS Kuatra di kesalahan sendiri ... Pelatih Mas Pada babak delapan besar, kualifikasi itu membukukan Rabu (11/11) malam. minum. Menit 66 Bank Sumut gelandang serang dan Fredy Lapangan Pardede Medan. (b20) Sigit (Pamungkas) dan KakYanti mereka bertemu pasangan ung- tempat di perempatfinal dengan “Tim kesayangan masyarakat Pidie Jaya itu berhasil menjadi (Kusmiati) juga memberi gulan ketujuh Hendra Aprida Gu- mengalahkan HsiehYu Hsin dari runner up grup III di Tapaktuan, maka dipastikan lolos ke babak masukan,” ungkap Fran. nawan/VitaMarissayangmenang Taiwan 21-13, 21-9. 16 besar tingkat nasional dan selangkah lagi masuk Divisi II, “katanya. 16 Besar Kompetisi PSSI Aceh Tamiang Mereka mampu mengim- atas Chen Hung Ling/Chou Chia Pada perempatfinal, Hayom Manajemen PS Pidie Jaya patut berterima kasih atas doa dan bangi lawan pada awal duel dan Chi dari Taiwan 21-18, 21-15. akan menghadapi pemain China dukungan masyarakat Pidie Jaya. Bahkan, terima kasih yang tak Sei Liput, Bapor Pertamina Perempatfinal memimpin 11-10 saat jeda game pembuka. Pasangan yang baru tampil pada turnamen Super KemenanganatasjuaraOlim- piade diakui Fran meningkatkan percaya diri untuk menghadapi Bao Chunlai yang menang 21- 13, 17-21, 21-11 atas pemain tuan rumah Hu Yun. (h01/ant) terhingga disampaikan kepada Bupati Pidie Jaya Drs HM Gade Salam yang telah memberikan dukungan penuh, “ujar Yusri.(b21) KUALASIMPANG (Was- solo run menggiring bola menuju apapun hasilnya Persijaya sudah pada): Tim Sei Liput FC dari gawangPersijayayangdijagaAndi. kalah. Sei Liput FC mempersiap- Sudoku Kecamatan Kejuruan Muda dan Bapor Pertamina A Rantau me- laju ke perempatfinal kompetisi Warta pada menit 24 dengan cerdik melepaskan tembakan mendatar yang masuk di sudut kanWarta,Wawan, Reza, Taufik, M Pi’ie sebagai algojo. Empat ber- hasil menjaringkan gol, sehingga Prestasi Hebat Racer Yamaha Isi kotak kosong dengan angka 1 sampai 9. Tidak boleh ada PSSI Kabupaten Aceh Tamiang, rusuk kanan gawang Persijaya. Pi’ietidaklagimelakukantendang- MEDAN (Waspada): Racer terbuka (MP2) mampu menem- pembalap tercepat di kelas bebek pengulangan angka mendatar, menurun, maupun di dalam setelah meraih kemenangan atas Memasuki babak kedua, an karena Sei Liput sudah unggul yang membela tim Yamaha pati urutan keempat, sehingga 4 langkah 125 cc tune up pemula kotak 3x3 bergaris tebal. Tidak ada keterlibatan matematika, lawan-lawanya di Lapangan anak-anak Persijaya yang sudah dua gol. menuai prestasi hebat dalam mengantongi poin 13 dan total (MP4). Rekan satu timnya, Dani hanya membutuhkan pertimbangan dan logika. Sepakbola Tepi Sungai Tamiang ketinggalan berupaya menyama- Pada laga kedua, Tim Bapor ajang balapan Ten Mild Road poin 38. Di kelas ini andalan Ramadhani menempati urutan Tingkat kesulitan hari ini: sedang (***). Jawaban di kolom 8. kankedudukan.Menit64Wagiran APertaminaRantaumenjungkal- Race 2009 seri IV. Semua gelar Yamaha lainnya,Yogi Hermana, kedua, disusul Dolly Ardiansyah Kualasimpang, Kamis (12/11) berhasil memanfaatkan kemelut kan Apella FC Kualasimpang juara di kelas paling bergengsi merebut posisi ketiga. (SuzukiSunindo)beradadiurutan sore. Pada pertandingan 16 besar di mulut gawang Sei Liput, skor bertahan 1-1 saat bubaran dan denganangkatipis1-0dalamduel dipimpin wasit M Yusuf. Gol (terbuka) pada event berlabel kejurda itu didominasi para Pembalaplow profile itu me- ngaku, sukses besarnya di Kaban- ketiga. 7 6 8 9 yang menggunakan sistem gugur Sukses para pembalap tim dilanjutkan dengan adu penalti. tunggal Bapor Pertamina pembalap tim Garpu Tala. jahe tak terlepas dari peran klub itu, duel pertama antara Sei Liput FC versus Persijaya Rantau yang Persijaya menugaskan Aris diciptakan menit ketiga melalui Keperkasaan para pembalap Yamaha Andra selaku pembina- Yamaha itu menuai pujian dari para pembinanya. “Kami sangat 1 3 9 6 4 Susanto, Hadiyono, M Sidik ,M. kaki Dedi yang tendangannya tak dari tim Yamaha diawali ketika nya, para mekanik dan rekan- senang bahwa rekan-rekan setim dipimpin wasit Ismail berlansung seru. Nuri danYunus. Namun Aris Su- santo dan Nuri gagal menja- mampu dijinakkan kiper Rahma. Jum’at (13/11) ini pada laga Deri Irfandi turun pada kelas bebek 4 langkah 110 cc terbuka rekan satu timnya yang selalu memberi support saat perlom- kami, baik itu mekanik, para pembalap, maupun ofisial telah 5 6 Anak-anak Sei Liput unggul ringkan bola karena tendangan- pertama akan tampil Kadal (MP1). Pembalap bernomor start baan. “Tanpa mereka saya tidak lebih dahulu melalui serangan balik.Warta yang menerima nya dapat dihalau kiper Andi. Sedangkan M Yunus tidak lagi Karang Baru kontra PSAD, selanjutnya Marabunta Manyak 26 ini berhasil finis pertama mengatasi pembalap papan atas ada apa-apanya,” ungkap Deri di Medan, Kamis (12/11) bekerja dengan baik sehingga melahirkan prestasi yang mem- 5 3 1 4 7 umpan terobosan dari rekannya, melaksanakan tugasnya karena Payek melawan Raja Muda.(b24) Sumut lain Reza Pahlevi (Suzuki Di kelas bebek 4 langkah 110 banggakan,” ujar manajer tim Lindung Jaya IRC), Putra Suseno (NAD Medan), serta Johanes cc tune up pemula (MP3), pem- balap dari tim Yamaha Tran’s R a c i n g Ya m a h a Me d a n , Apmansyah Tanjung. 9 7 5 Aceh, Riau Sudah Pasti Lolos Tarigan (Suzuki 66 Motor). Lewatpenguasaanracingline Motor Racing juga merebut gelar tercepatmelaluiBobbyFPdengan , Soal keberhasilan Deri, ma- najer timYamaha Andra, Hendra 6 7 4 2 3 yang baik plus didukung perfor- mematahkan ambisi Dolly mengatakan, sangat terkesan BANDA ACEH (Waspada): Liga Remaja U-15 Grup A yang formasi 3-2-4-1,” ungkap mantan striker Persiraja Banda Aceh era ditopang empat pemain di posisi tengah, yakni Alfian Suri, Sofian, ma motor yang mumpuni, Deri Irfandi mampu meninggalkan Ardansyah (Suzuki Sunindo Rival Djarum Black), dan Rizki Hen- dengan kemampuan teknik yang dimiliki pembalapnya. “Penam- 7 4 parapesaingnyajauhdibelakang. darta (Pariama). pilannya cukup bagus dan punya digelar di Banda Aceh hanya diikuti dua klub. Menang atau 1990-an ini. Formasi yang dipakainya mengandalkan Citra Fitra Ridwan dan M Fajar. Mereka akan dibantu dua double stop- Deri akhirnya dinobatkan sebagai juara umum setelah pada GelarlainnyadiraihSuhendra Pramana Putra (Yamaha NGK masadepan.Sayasangatterkesan 4 7 3 8 5 kalah,keduanyasudahdipastikan sebagai penyerang tunggal per, Jamaluddin dan M Idris. (b05) dan sangat gembira. Kami sangat lolos ke babak perdelapanfinal. Pun begitu, duta Aceh diwakili lomba kelas bebek 4 langkah 125 Medan) yang berhasil menjadi sukadengansemangatjuangserta dia tidak mudah terintimidasi,” 2 8 7 6 PS Nagan Raya. tutur Hendra. (h09) Aceh masuk dalam Grup A bersama Sumatera Utara, Riau dan Jambi, namun hanya dua tim yang mewakili, yakni tuan rumah Aceh dan Riau. Putaran Liga Remaja U-15, sebelumnya terjadi beberapa perpindahanlokasipertandingan, mulai dari Provinsi Jambi, Suma- tera Utara, Pekan Baru, Bengkulu dan terakhir di Banda Aceh. Pelatih Tim Aceh U-15, Yusmahdi kepada Waspada, Kamis (12/11) menyebutkan, pihaknya menargetkan raih hasil maksimal dalam pertandingan yang sudah sama-sama pasti main di babak perdelapan final. “Meskibegitu,hasilmenangharus direbut untuk menjadi motivasi bagi anak-anak,” katanya. Menurutnya, Muhammad Idris cs sudah siap menjajal kekuatan lawan. “Anak-anak sudahsiapbermaincantikdengan 1 6 7 4 5 9 8 2 3 2 5 9 8 3 7 1 4 6 4 8 3 2 6 1 5 9 7 9 3 2 5 4 8 7 6 1 5 1 6 3 7 2 4 8 9 8 7 4 9 1 6 3 5 2 6 2 1 7 8 4 9 3 5 7 4 5 6 9 3 2 1 8 3 9 8 1 2 5 6 7 4
  • 6. WASPADA Jumat 13 November 2009 Medan Metropolitan 9 DPRD: Pertamina Belum Siap Konversi Minah Ke Gas MEDAN (Waspada): DPRD Medan menilai PT tempat. ‘’Sampai benar-benar Dia mendengar, sekarang nan, Pemko Medan hanya ter- Pertamina belum siap melaksanakan konversi masyarakat yakin mengguna- ini pendataan dilakukan oleh kena imbasnya saja dari pelak- kan gas lebih baik dari minah,’’ tujuh perusahaan konsultan sanaan konversi minah ke gas. minyak tanah (minah) ke gas. Berbagai program katanya. yang bekerjasama dengan ke- Kepada Pemko hanya diminta belum dilaksanakan yang berakibat pada Hal lainnya adalah masalah pala lingkungan. Kata Aripay, persetujuan saja untuk melak- penolakan masyarakat. pendataan. Menurut Aripai itu keliru. Harusnya, Pemko sanakan program ini. ‘’Posisi Tambunan, Pertamina harus Medan yang melakukan penda- Pemko jadi serba salah. Gak melibatkan Pemko dalam taan, baru kemudian konsultan disetujui diartikan menolak Ketua Komisi C DPRD Me- kan kebakaran akibat gas melakukan pendataan keluarga melakukan pemutahiran data program pemerintah. Disetujui, dan Aripay Tambunan, berbi- meledak. yang mendapat kompor gas dan tersebut. kena demo masyarakat,” kata cara kepada Waspada, Kamis Mengubah image masyara- elpiji 3 kg. Sekarang ini, kata Tambu- Tambunan. (m17) (12/11). Menurutnya ada dua kat, kata Tambunan, tidak gam- hal yang belum dilakukan perta- pang. Harus dengan sosialisasi mina secara maksimal, yakni sosialisasi dan pendataan pene- secara berkesinambungan. Aripay Tambunan, tidak Hanya 30 Persen Jalan Provinsi Waspada/Ist rima kompor gas. ‘’Pertamina mempersoalkan kalau yang setengah hati dalam melaksa- nakan program ini,” katanya. melakukan program konversi ini ke masyarakat adalah tujuh Masuk Kategori Baik HONDA C70: Beberapa produk Honda dari Honda C 70 sampai buatan tahun tinggi akan dipamerkan pada Acara Honda Fiesta di Lapangan Merdeka Medan pada 21 - 22 Nopember mendatang. Program paling utama un- perusahaan konsultan. Yang tuk konversi ini, menurut Aripay Tambunan, adalah sosialisasi. diketahui bahwa pelaksana program itu adalah Peramina. MEDAN (Waspada): Dari 2.752,41 km jalan provinsi di Sumut hanya 30 persen di butuhkan. “Untuk tahun angga- ran2009,DinasBinaMargahanya mendapat alokasi dana Rp493 mengatakan penanganan jalan provinsi harus dikerjakan mela- lui proyek multi years (berkelan- Honda Keluaran Pertama Harus diingat, katanya, yang ‘’Kita tidak mau tahu teknisnya dilakukan pemerintah adalah mengubah kebiasaan masyara- bagaimana. Itu terserah Perta- mina sebagai pelaksana pro- antaranya atau 825,72 km dalam kondisi baik. Menurut Dinas miliar lebih, sementara biaya yang dibutuhkan Rp846,630 jutan selama beberapa tahun), karena kemampuan APBD Su- Tampil Di Honda Fiesta Bina Marga Sumut, butuh dana miliar dengan target kondisi mut tiap tahunnya hanya meng- kat dari menggunakan minah gram ini,” katanya. minimal Rp9,513 triliun untuk jalan baik 35,24 persen, kondisi alokasikan anggaran ratusan MEDAN (Waspada): Seba- akan memanjakan pengunjung tor dengan teknologi canggih ke gas. Ini tidak gampang.’’ Tidak sulit melakukan so- memperbaiki seluruh kerusa- sedang 44,83 persen dan rusak miliar atau setengah triliun gai perayaan 25 juta unit pro- yang hadir, antara lain Parade antara lain, Honda Cub 70 yang Dari pengamatan di lapang- sialisasi kalau Pertamina sung- kan jalan dan jembatan tahun berat 19,93 persen,” katanya. rupiah. duksi Honda di Indonesia, maka 25 juta inspirasi, galeri inspirasi merupakan pelopor 4 tak di an, menurut Tambunan, sosiali- guh-sungguh. Cukup dengan anggaran 2014. Sedangkan untuk tahun ang- Selain itu juga, menurut CV Indako Trading Co selaku Honda, servis gratis, ragam kom- Indonesia, Honda CB sebagai sasi tentang manfaat menggu- mendatangi kelompok penga- Hal itu diungkapkan Kepala garan 2010, tambahnya, dana Analisman, perlu ada upaya dari main dealer Honda di Sumatera petisi bagi remaja dan games pelopor type sport di Indonesia, nakan gas elpiji sangat kurang jian ibu-ibu. Kemudian secara Dinas Bina Marga Sumut, Umar yang dialokasikan Rp551,547 Dinas Bina Marga Sumut mem- Utara akan menggelar acara seru dengan banyak hadiah ser- Supra X Injection sebagai pelo- dilakukan. Karena terbiasa berkesinambungan dilakukan akbar ‘Honda Fiesta’ pada 21 – ta aneka permainan gratis untuk por motor bebek type Injeksi per- Zunaidi Hasibuan dalam rapat miliar lebih, sementara yang buat terobosan mencari angga- 22 November 2009. keluarga. Tidak hanya sampai tama di Indonesia, Honda CS1 menggunakan kompor minyak sosialisasi massal dengan me- kerja dengan Komisi D bidang dibutuhkan Rp976,595 miliar. ran diluar dari APBD. Baik de- tanah membuat masyarakat ngumpulkan ibu-ibu di kelura- Acara yang akan berlang- di situ, pengunjung juga akan sebagai species bebek sport ter- pembangunan DPRD Sumut Dengan target kondisi jalan baik ngan ‘menjolok’ anggaran pusat sung di Lapangan Merdeka memperoleh hiburan berkelas baru di dunia, Honda Mega Pro enggan beralih ke gas. Apalagi han. Juga dengan membuat yang dipimpin Ketua Komisi, 45,37 persen, sedang 39,83 per- maupun melalui investasi, se- Medan ini akan menghadirkan dari band papan atas tanah air, sebagai pelopor segitiga kenya- di media beberapa kali diberita- spanduk-spandung di sejumlah Ajib Shah, di gedung dewan, sen rusak tingan dan rusak berat hingga jalan mantap yang di- galeri motor-motor yang bakal Nidji, dan didukung juga deng- manan untuk touring, sedang- Rabu (11/11). 14,80 persen. inginkan masyarakat dapat membuka memori dan meng- an penampilan dari Uma the kan Honda Tiger sebagai pelopor Besok IKMT Gelar Donor Darah Umar merincikan, kondisi jalan provinsi di Sumut, 388 km “Sehingga target untuk mencapai jalan mantap sesuai tercapai tidak harus menunggu sampai tahun 2014. inspirasi masyarakat, yaitu dari produksi pertama di Indonesia BeAT, Brathasena Blade, Irene the BeAT dan Julian Idol. lampu depan asimetris, dan ba- nyak lagi teknologi canggih lain- MEDAN (Waspada): Sabtu (14/11) besok, Ikatan Keluarga diantaranya masuk kategori ru- visi misi Bina Marga yang dipro- Dalam rapat itu, Komisi D yakni Honda C 70 dan Honda S90 Arifin Posmadi, General nya yang diciptakan Honda,” Muslim Taman Setia Budi Indah (IKMT) Masjid Al Musabbihin sak berat, 355,61 km rusak ri- gramkan belum tercapai dan juga membahas peran Pem- hingga produksi yang terbaru. Manager CV Indako Trading Co ungkap Arifin Posmadi, kemarin. Medan, menggelar donor darah sekaligus memperingati Hari ngan, dan 1182,99 km kondisi akan sulit terwujud jika hanya provsu dalam pembebasan Beberapa klub yang akan mengungkapkan dihadirkan- Sementara itu Leo Wijaya, Pahlawan di Polimas Tasbih Medan. Acara dimulai pukul 09:00- sedang. Hanya 825,72 km mengandalkan APBD, karena lahan eks HGU PTPN4 yang ter- ikut memeriahkan acara adalah nya motor tua dalam acara Hon- Marketing Manager CV Indako 12:00. Club Honda Cub 70 Medan, da Fiesta merupakan inspirasi Trading Co mengungkapkan sisanya yang berada dalam anggaran yang dibutuhkan kena proyek akses jalan menuju HSCC, HCBC, serta CCM, dima- bagi masyarakat. Dimana Hon- acara Honda Fiesta ini digelar Demikian disampaikan Ketua Pelaksana, H. Soemardi KH kondisi baik. Rp9,5 triliun lebih, sementara bandara Kuala Namu, karena na anggotanya memiliki hobby da selama hampir 40 tahun ber- sebagai bentuk terima kasih dan panitia dr. Syamsul A. Nasution, SpOG, dr. Asfawati, CakWiluyo Namun, kata Umar, selama APBD Sumut 2010 baru Rp3,7 hingga kini masih bermasalah, mengoleksi motor-motor tua. diri di Indonesia dengan banyak Honda kepada konsumennya dan Agus Hadiono, Ketua IKMT, Habib Nasution dan Sekretaris, ini perbaikan jalan provinsi triliun,” katanya. sehingga dikhawatirkan jalan “Acara seperti ini membe- cerita yang mengiringinya, baik atas kepercayaan yang telah di- Khairul Mahali, melalui siaran persnya yang diterima Waspada, tersebut terkendala alokasi ang- Menaggapi itu, anggota akses menuju bandara Kuala rikan kebanggaan bagi kami ka- itu perjuangan, kesenangan, berikan selama ini dan menja- Kamis (12/11). garan yang terbatas dan tidak Komisi D dari Fraksi PDI Per- Namu bisa terancam tidak ter- rena anggota dapat memamer- kebanggaan, serta tantangan. dikan Honda sebagai sepeda Soemardi menjelaskan, sebenarnya acara donor darah itu sesuai dengan biaya yang di juangan, Analisman Zalukhu laksana. (h11) kan koleksi mereka yang antik, Namun Honda mampu berta- motor pilihannya.” merupakan kegiatan rutin yang mereka adakan setiap tiga bulan klasik, juga original kendara- han, dan selalu konsisten de- “Kami sangat mengharap- sekali dan sudah berlangsung selama sembilan tahun. Kegiatan annya mulai dari sekrup sampai ngan komitmennya yaitu selalu kan hubungan antara Honda itu hasil kerjasama antara Hiwasbi, Arek-arek Suroboyo, serta warga masyarakat Kecamatan Medan Sunggal, khususnya Tanjung Serapan 100 Persen APBD aksesoris yang menempel,” ungkap Bambang, Humas Club berupaya memberikan yang terbaik untuk memenuhi kebu- dan konsumennya selalu terja- lin baik. Jutaan cerita telah men- Rejo. “Karena itu kita harapkan para pendonor terdahulu bisa Honda Cub 70 Medan. tuhan konsumennya, masya- ciptakan jutaan inspirasi, dan ikut kembali pada donor darah kali ini. Serta diharapkan bisa membawa teman-teman yang lain sebagai pendonor pemula,” Diprediksi Tidak Tercapai Acara yang berlangsung di 110 kota di Indonesia ini diisi rakat dan Indonesia. “Honda telah hadir dengan di acara Honda Fiesta, kita bisa saling berbagi,” ujar Leo Wijaya. katanya. dengan beragam acara menarik beragam produksi sepeda mo- (adv/m08) Begitupun, katanya, bahwa hanya orang-orang yang MEDAN (Waspada): Pem- nerja SKPD di jajaran Pemprov tuan kerja perangkat daerah provsu sejak awal tahun 2009 Sumut melemah. Sebab pihak- (SKPD) di jajaran Pemprov memenuhi syarat saja yang diperbolehkan mendonor. Serta satu jarum hanya akan digunakan untuk satu orang untuk mencegah kemungkinan tertular penyakit. “Maka tidak perlu takut sebagai telah mencanangkan besaran serapan anggaran belanja pada nya telah memprediksi kalau hingga bulan Desember men- Sumut untuk sungguh-sungguh dalam bekerja. Pembangunan Berjalan pendonor,” katanya. Pada kegiatan donor darah kali ini, panitia juga menyediakan pemeriksaan osteoporosis gratis. Mereka juga mengundang APBD mencapai seratusan per- sen. Namun hal itu diprediksi tidak bisa tercapai karena bebe- datang, serapan anggaran bisa mencapai lebih 90%. Ditanya serapan anggaran Dalam rapat itu terungkap kalau Pemprov Sumut ingin agar penilaian yang dikeluarkan Tetapi Belum Seimbang keluarga besar Masyarakat Pancasila Indonesia (MPI) dan rapa faktor. hingga bulan ini, Nainggolan Badan Pemeriksa Keuangan MEDAN (Waspada): Ang- menyebabkan terjadinya de- Dalam konteks lain, Rah- Pemerintahan Mahasiswa Fakultas Kedokteran Universitas Sekretaris Daerah Provsu RE mengatakan hingga tanggal 6 (BPK) atas anggaran 2008, bisa gota DPD/MPR RI, DR. H. Rah- gradasi terhadap makna hasil- mat mengemukakan, dikata- Sumatera Utara untuk bersama-sama mendonorkan darah untuk Nainggolan kepada para warta- November yang lalu sudah berubah lebih baik saat realisasi mat Shah, mengatakan, pem- hasil perjuangan para penda- kannya, semua elemen ma- meneladani jejak para pahlawan bangsa. (rel/h11) wan seusai rapat kerja Persiapan mencapai 52%. anggaran tahun 2009. bangunan di segala sektor berja- hulu kita. Pejuang-pejuang kita syarakat harus ikut mendo- dan Percepatan Pelaksanaan Kata Nainggolan, apa yang Hal yang samapun harus di- lan, akan tetapi belum seim- dulu berjuang merebut kemer- rong niat serta tekad Presiden APBD 2010 di Aula Martabe Kan- telah ditargetkan sejak awal alami pada APBD 2010. Kata bang dengan dampak dari pem- dekaan dan mempertahan- SBY untuk mengganyang Bulogsu Stop tor Gubernur, Rabu (11/11), me- tidak jauh meleset. Dia menga- Nainggolan dalam rapat itu, bangunan itu sendiri, antara lain jumlah rakyat tergolong kannya tanpa pamrih walau- pun mengorbankan jiwa dan segala bentuk mafia, terutama mafia hukum di negeri ini. Ca- ngatakan, situasi ekonomi men- kui kemungkinan hal itu bisa realisasi APBD 2010 harus bisa Raskin Ke Humbahas jadi pemicu yang menyebabkan menimbulkan sisa lebih peng- dilakukan tanggal 2 Januari nanti. miskin masih besar, pengang- guran terus bertambah dan raganya. “Lebih memprihatinkan ranya, sampaikan informasi dan fakta yang benar kepada beberapa satuan kerja perang- gunaan anggaran (SILPA), persis Untuk itu, dia meminta semua MEDAN (Waspada): Badan Urusan Logistik (Bulog) Divre kat daerah (SKPD) tidak bisa sama dengan tahun lalu. SKPD menyiapkan semua kebu- penyandang masalah sosial lagi yang terjadi saat ini, baik pihak yang berwenang dari Sumut telah mengambil tindakan tegas kepada Pemkab/Pemko merealisasikan anggaran belan- Tetapi dia tidak yakin SILPA tuhan teknis yang terkait hal itu. meningkat. di pemerintahan tingkat pusat berbagai tingkatannya hingga yang masih menunggak pembayaran beras miskin (Raskin). Ungkapan tersebut disam- hingga daerah, ada rekayasa ke presiden. ja masing-masing. dari tahun anggaran 2009 sama Dia meminta agar proses paikannya serangkaian Peri- yang dilakukan oleh oknum ‘’Justru itu mari kita tun- Tindakan tegas ini mengakibatkan 15.878 Rumah Tangga Sasaran (RTS) di Kabupaten Humbang Hasundutan (Humbahas) tidak “Faktor inflasi, misalnya. besarnya dengan anggaran ta- tender untuk banyak proyek ngatan Hari Pahlawan 10 No- untuk menutupi kebobrokan- jukkan kepada masyarakat, lagi menerima beras miskin terhitung sejak September 2009. Apalagi saat barang yang dibu- hun yang lalu. “Nanti di perte- yang dibiayai APBD 2010, sudah vember 2009, di Medan, Selasa nya dengan gaya seolah-olah bahwa kita bisa jadi teladan, Kepala Seksi Humas Bulog Divre Sumut Rusli menjelaskan, tuhkan ternyata mengalami ke- ngahan Desember bisa dipre- diawali di bulan November dan (10/11), melalui siaran pers dia itu pahlawan. Kalau keada- camkan bagaimana pengor- Rabu (11/11) penghentian penyaluran Raskin ini sesuai dengan naikan harga. Ini yang mem- diksikan berapa SILPA yang Desember tahun ini. Karena itu Humas Yayasan Rahmat M. an seperti ini terus dibiarkan, banan para pahlawan kita peraturan yang ada karena pembayaran raskin ke Bulog saat ini buat realisasi belanja tidak ter- kemungkinan timbul,” ujarnya. dia menekankan agar setiap Salim, SH. bagaimana generasi muda kita untuk bangsa dan negara ini harus lunas setelah penyaluran diberikan. capai,” ujarnya. Realisasi 2010 perangkat tender, seperti panitia Lebih lanjut dikatakannya, mewarisi hal-hal seperti ini dan dalam kita berkata, berpikir, dan Tindakan tegas ini diberlakukan untuk mencegah kerugian Tetapi, kata Nainggolan, bu- Dalam rapat kerja itu, Naing- tender dan sebagainya, diper- dampak dari kemajuan tekno- apa jadinya bangsa kita ke de- bertindak dalam mengisi pem- negara akibat penunggakan pembayaran Raskin dari Pemkab kan berarti hal itu membuat ki- golan menekankan setiap sa- siapkan sejak dini. (m19) logi dan informasi saat ini, telah pan,” ujarnya. bangunan,’’ tegasnya. (m34) terkait. Sebelumnya hutang Raskin Pemkab/Pemko kepada Bulog Sumut pernah menumpuk hingga mencapai Rp20 miliar. Utang ini akhirnya berangsur berkurang setelah Bulog meminta bantuan kejaksaan. Beras miskin yang disalurkan itu adalah uang pemerintah dan harus dibayar lunas untuk mencegah tunggakan, saat ini seluruh raskin yang disalurkan kepada pemerintah kabupaten dan kota harus segera dibayar setelah masa penyaluran selesai kalau tidak maka raskin bulan berikutnya akan distop, jelas Rusli. Namun, jelas Rusli, hingga saat ini masih ada beberapa daerah yang masih menunggak. Namun yang terparah terjadi di Kabupaten Humbahas daerah ini masih tersangkut hutang piutang raskin sejak Juli 2009. Akibat keputusan ini seluruh keluarga miskin di Humbahas tidak menerima beras murah sebagaimana keluarga miskin lainnya di daerah lain dengan harga Rp1.600 per kg. Padahal jumlah keluarga miskin di Humbahas tergolong paling tinggi mencapai 15.878 RTS. Dengan jumlah RTS yang sangat banyak itu, pemerintah menya- lurkan raskin ke daerah ini setiap bulannya mencapai 238 ton. Sementara daerah lain yang mengalami ketidaklancaran raskin selama tahun 2009 ini terjadi di Kabupaten Mandailing Natal dan Batubara. Penyaluran raskin di Kabapaten Mandailing Natal masih berkisar 72,60 % dan Batubara 79,73 %. Sedangkan daerah lain di Provinsi Sumut telah mencapai 91 %. Jumlah raskin yang telah disalurkan Bulog ke seluruh Pemkab/Pemko mencapai 141.337 ton dari rencana alokasi 154.724 ton. (m35) Hari Pahlawan Momentum Introspeksi MEDAN (Waspada): Gubsu Syamsul Arifin mengatakan, peringatan Hari Pahlawan 10 November diharapkan sebagai momentum untuk melakukan refleksi historis agar senantiasa dapat melakukan introspeksi dan memetik pelajaran serta hikmah dari setiap perjuangan bangsa. Selain itu, kata Gubsu melalui Sekda RE Nainggolan, kemarin, pada upacara memperingati Hari Pahlawan di lapangan upacara kantor gubernur, menyegarkan kembali tekad dan semangat untuk melanjutkan perjuangan demi tetap tegaknya kedaulatan negara, menjaga keutuhan wilayah nasional. “Jadikanlah nilai-nilai kepahlawanan sebagai milik bersama yang menjadi warisan yang perlu ditumbuhkan dan dilestarikan kepada setiap generasi,” ujarnya. Dengan semangat kepahlawanan, kata Gubsu, hendaknya saling bahu membahu memberikan sumbangan tenaga dan pimikiran demi tetapnya tegaknya NKRI. Dalam kondisi saat ini, lanjutnya, diperlukan kearifan dan kejernihan berpikir dari seluruh komponen bangsa. Masing-masing harus lebih mengutamakan persatuan dan kesatuan dari pada kepentingan pribadi atau golongan serta memiliki kerelaan berkorban untuk bangsa. “Situasi negara saat ini memerlukan keterpaduan dan peran serta segenap komponen bangsa untuk berjuang bersama mencari solusi dalam mengatasi kesulitan kebangsaan,” katanya. Sementara itu, berkaitan dengan Peringatan 10 November, Gubsu dan unsur Muspida Sumut melakukan ziarah di Makam Pahlawan Medan Jalan Sisingamangaraja Medan.(m19)
  • 7. 10 Medan Metropolitan WASPADA Jumat 13 November 2009 Pelamar CPNS Pemko 23.612 Orang MEDAN (Waspada): Kepala Badan bertambah besok (hari ini-red). jumlah surat lamaran yang sini bang,” kata Hardiansyah Kepegawaian Daerah Kota Medan, Lahum Lubis Soalnya, para pelamar CPNS masuk sepertinya pelamar lebih warga Jalan Sakti Lubis Medan terus berdatangan ke kantor Pos dominan ke Pemko Medan. salah seorang pelamar CPNS mengatakan, Jumat (13/11) merupakan batas Besar Medan. Namun, kantor Pos Besar terus untuk Pemko Medan. akhir pendaftaran Calon Pegawai Negeri Sipil Dari 23.612 surat lamaran melayani surat permohonan Selain itu, para pelamar bu- Pemerintah Kota Medan. yang masuk ke Pemko Medan, lamaran CPNS sampai batas kan saja memadati loket pengi- tambah Lahum, didominasi S1 yang ditentukan 13 November riman surat permohonan lama- “Besok (hari ini-red) batas Kamis (12/11). jurusan Guru dan Kesehatan (hari ini –red),” ucap Silalahi. ran CPNS, namun di tempat pe- akhir penerimaan pendaftaran Lahum menyebutkan, se- disusul DIII. Terkait untuk lokasi Sementara itu, pantauan ngumuman formasi CPNS juga surat lamaran CPNS untuk hari menjelang penutupan ujian, akan dilaksanakan di Waspada di lapangan terlihat masih padat. Mereka terus me- Pemko Medan. Sedangkan un- pendaftaran pelamaran CPNS, beberapa tempat yakni seperti proses pengiriman surat lama- nerus membeli formasi CPNS tuk nomor ujian, dipastikan jumlah surat lamaran yang su- gedung SMP, SMA dan bebe- ran permohonan CPNS berja- di depan kantor Pos Besar yang sebelum waktu ujian dimulai, dah masuk ke Pemko Medan rapa Perguruan Tinggi Swasta lan lancar walaupun terjadi an- dijajakan, walaupun waktu nomor tersebut sudah sampai,” sebanyak 23.612 lamaran. dan negeri di Kota Medan. trean panjang di loket pengiri- pendaftaran tinggal satu hari. Waspada/Surya Efendi ucap Lahum kepada Waspada, Jumlah ini kemungkinan akan Secara terpisah, Humas man. Seorang security di kantor DILANTIK: Seorang rohaniawan agama Islam mengangkat kitab suci Al Quran ketika melantik kantor Pos Besar Medan, Johny Animo masyarakat sangat Pos Besar Medan menjelaskan, Denni Ilham Panggabean (Ketua DPRD Medan), Ikrimah Hamidy (Wakil Ketua) dan Sabar Sitepu Silalahi, SE mengatakan, jumlah tinggi mengikuti CPNS pada padatnya kantor Pos tersebut (Wakil Ketua) dalam sidang Paripurna di gedung dewan tersebut, Kamis (12/11).Wakil Ketua lainnya Konsul Amerika Diskusi surat lamaran yang masuk ke kantor Pos Besar Medan sampai tahun ini. Para pelamar tidak pusing membuat lamaran, diakibatkan batas waktu pen- daftaran yang hanya tinggal satu August Napitupulu dari PDIP . Dengan Murid YPSA Kamis (12/11), mencapai 50 ribu lamaran. Dari jumlah itu, karena di loket pengiriman telah tertempel contoh pembuatan hari. “Setiap hari mulai pukul Pimpinan DPRD Medan Dilantik MEDAN (Waspada): Konsul Amerika Serikat untuk Sumatera yang paling banyak ke Pemko permohonan lamaran. Para 08:00 kantor ini sudah dipadati Stanley Harsha bersama dua stafnya Karim dan Hana Yurike Batubara mengunjungi siswa/i Yayasan Pendidikan Shafiyyatul Amaliyyah (YPSA), Senin (9/11). Medan yakni 23.612 lamaran, Pemprovsu 2.600, dan untuk Kabupaten/Kota lainnya seperti pelamar di masing-masing su- dut di depan kantor Pos Besar maupun di dalam ruangan si- masyarakat yang ingin melamar CPNS. Tapi sampai saat ini ma- sih berjalan lancar. Apalagi loket Pimpinan Komisi Menunggu SK Rombongan diterima Pembina YPSA Drs. H. Sofyan Raz, Ak, Tebing Tinggi dan Batubara buk menulis permohonannya. penerimaan surat lamaran MM, Ketua Umum Hj. Rahmawati Sofyan Raz, Kepala Departemen MEDAN (Waspada): Empat yang terjadi, yakni tentang sta- nan dewan saja. Harus juga sebanyak 16.376 lamaran. “Dari pada salah membuat terpisah dengan loket umum,” pimpinan DPRD Medan secara tus pimpinan komisi-komisi melibatkan fraksi-fraksi lainnya. Pendidikan Diky Setia Diningrat, MSi, Kabag Umum Amrizal, “Dari hasil penghitungan lamaran, kan lebih baik buat di pungkasnya. (h10) SH, Kepala SMA Daulat Siregar, MPd, Kepala SMP Rudi Sumarto, defenitif dilantik Ketua Penga- yang belum diakui Ketua Denni Kata Ikrimah, pimpinan SSi, Kepala SD Azhar Fauzi, SAg beserta guru-guru. dilan Negeri (PN) Medan Panu- Ilham Panggabean. dewan hanya mewakili empat Dalam kunjungan itu, Stanley selain menyempatkan diri berdiskusi dan memberikan motivasi belajar kepada siswa, juga memperkenalkan sistem pendidikan Amerika Serikat. Gubsu Minta Kopertis sunan Harahap, Kamis (12/11). Bagi internal dewan, pelantikan ini merupakan harapan untuk Secara defakto, pimpinan komisi-komisi telah terpilih beberapa waktu lalu. Namun fraksi. Sementara di DPRD Me- dan ada delapan fraksi. Dengan begitu pembahasan paling tidak Sementara staf Konsul Amerika Hana Yurike Batubara dalam kesempatan itu juga memperkenalkan pusat pendidikan Education USA. Menurutnya Education USA merupakan sentra untuk Umumkan UISU Yang Sah menyelesaikan konflik tentang pimpinan alat kelengkapan. Keempat orang yang dilan- Denni Ilham Panggabean, be- lum mengakuinya. Dia belum menerbitkan SK pimpinan harus melibatkan pimpinan fraksi. ‘’Jadi kalaupun nanti digelar rapat pimpinan dewan, memberikan informasi dan nasihat kepada siapa saja untuk melanjutkan pendidikannya di Amerika serikat. Program ini 6.000 Ijazah UISU Bermasalah tik dan diambil sumpahnya hari itu adalah Ketua Denni Ilham komisi. Kepada wartawan, ber- ulang kali dia menyebutkan saya akan minta untuk melibat- kan ketua fraksi,’’ kata Ikrimah. langsung disupport dari Departemen Luar Negeri Amerika Serikat. MEDAN (Waspada): Seba- Advokasi Ali Amran Tanjung, yang sah agar tidak terjadi ke- Panggabean (Partai Demokrat) pimpinan komisi belum ter- Tentang wacara pemilihan Dikatakannya, Education USA akan membantu para pelajar nyak 6.000 ijazah lulusan Uni- sejumlah dosen dan mahasiswa bingungan di masyarakat. dan tiga wakil ketua, yakni Ikri- bentuk. Setelah pelantikan kembali pimpinan komisi (ko- Indonesia memperoleh tuntunan langsung yang obyektif seputar versitas Islam Sumatera Utara saat melakukan pertemuan Dalam pertemuan dengan mah Hamidy (Partai Keadilan pimpinan defenitif akan rapat cok ulang), Ikrimah, mengata- kiat terbaik memilih perguruan tinggi di Amerika Serikat, mendaftar (UISU) bermasalah dan cacat dengan Gubernur Sumut Syam- Gubsu, Usman Pelly dan Rektor Sejahtera), August Napitupulu untuk membahas masalah ini. kan kurang sependapat. Ma- kuliah, membuat rencana finansial, mengajukan permohonan hukum akibat dari pembiaran sul Arifin di kantor Gubernur, UISU Usman memohon duku- (PDIP) dan Sabar Sitepu (Partai Denni, menginginkan pe- salahnya, secara defakto pim- visa, beasiswa, serta aspek lainnya. yang dilakukan pemerintah se- Kamis (12/11). ngan Gubsu untuk penyelesai- Golkar). Pelantikan dilaksana- netapan pimpinan alat keleng- pinan komisi-komisi telah Sementara Pembina YPSA Drs. Sofyan Raz, Ak, MM menyebut- lama ini terhadap penyelesaian Dalam pertemuan itu, Gub- an masalah UISU dengan me- kan dalam rapat paripurna isti- kapan dewan dilakukan atas terbentuk dan dipilih secara sah. kan, kehadiran Konsul Amerika Serikat merupakan bagian dari konflik UISU. su didampingi Asisten Kesejah- ngedepankan prinsip legalitas mewa di gedung DPRD Medan. dasar musyawarah dengan me- Tinggal dejurenya saja, yakni kerjasama antara YPSA dengan konsul sebelumnya Sean B. Stein, Setelah keluarnya putusan teraan Sosial Asrin Naim, Kepala dengan berpedoman kepada Suasana gedung dewan hari lihat proporsional. Tidak perlu berupa Surat Keputusan (SK) di mana YPSA yang saat ini telah menyandang Sekolah Berstandar hukum dari Mahkamah Agung Dinas Pendidikan Sumut Bah- ketentuan hukum yang berlaku. itu penuh dengan tamu dan dengan melakukan mekanis- dari pimpinan dewan. Internasional Mandiri. pengunjung yang ingin me- me voting. Acuannya adalah Pemilihan pimpinan ko- Pada kesempatan itu Sofyan juga meminta kepada siswa agar (MA) dan keluarnya surat Men- rumsyah, Kepala Dinas Info- Usman dan Rektor UISU diknas RI yang menetapkan kom Edi Sofyan. Sedangkan juga meminta Gubsu segera nyaksikan acara serimonial ter- DPR RI dan DPRD Sumut. misi, menurut Ikrimah, dila- memafaatkan program Education USA dan teknologi informasi sebut. Tempat yang disediakan ‘’Makanya setelah dilantik, kukan untuk menampung telekomunikasi pendidikan untuk menunjang dan menambah UISU yang diakui Pemerintah utusan dari Kopertis Wilayah I mengakhiri “pembiaran” terha- RI adalah Yayasan UISU Hj Sa- Sumut-NAD dihadiri oleh dap kasus UISU yang pada ak- di dalam ruangan tidak cukup. saya akan mengajak pimpi- aspirasi masyarakat. Komisi- wawasan siswa. (m43) nan defenitif rapat untuk komisi merupakan alat keleng- riani AS dengan rektor yang di- Sekretaris Pelaksana Sederhana hirnya dapat mencerderai rasa Begitu juga dengan lokasi parkir angkat oleh Yayasan UISU yang Sembiri dan Hasbullah Hadi, keadilan masyarakat di sam- kendaraan. Halaman DPRD membahas masalah ini,’’ kata- kapan dewan yang segera harus Valentino: Anak-anak sah, yakni Rektor Usman, UISU telah ditugaskan oleh Mendik- kepala bagian Akreditasi Koper- tis Wilayah I Sumut-NAD. ping juga menimbulkan keru- gian moril dan materil yang penuh. Sebagian tamu harus memarkirkan kendaraannya di nya beberapa waktu lalu. Wakil Ketua DPRD Medan dibentuk. Beda dengan alat kelengkapan dewan lainnya. Harus Tetap Bersekolah nas RI (dalam salah satu butiran suratnya) untuk mendata ulang Gubernur Sumut yang me- nerima laporan terkait penye- tidak sedikit bagi Yayasan UISU selaku badan hukum yang sah Jalan Imam Bonjol dan ‘num- pang’ di halaman DPRD Sumut. Ikrimah Hamidy, usai pelanti- kan mengatakan tidak sepen- Karena itu pimpinan komisi- komisi didahulukan. ‘’Setelah MEDAN (Waspada): “Sesusah apa pun kita anak-anak harus kembali ijazah-ijazah yang ber- lesaian konflik UISU mengata- dengan cara meminta Kapolda- Bagi internal dewan, acara dapat dengan Denni Pangga- pimpinan defenitif, tinggal tetap bersekolah atau mendapat pendidikan, baik formal maupun masalah. Namun di sisi lain pu- kan, masalah UISU telah selesai su segera mengambil tindakan hari itu sangat ditunggu-tung- bean. Katanya, masalah alat menerbitkan SK saja. Ngapain informal” demikian dikemukakan praktisi pendidikan dr Robert tusan hukum dan surat Men- secara hukum. Sedangkan ma- tegas terhadap pihak/orang- gu. Yakni sebagai momentum kelengkapan dewan tidak cu- lagi harus kocok ulang,’’ Valentino Tarigan, SPd pada wartawan di kantornya, kemarin. diknas tersebut tidak dipatuhi salah akademik yang tetap di- orang yang saat ini sedang men- untuk menyelesaikan konflik kup dibahas di tingkat pimpi- katanya. (m17) Hal senada juga telah disampaikan Pimpinan BT/BS BIMA dan pemerintah (Pemprovsu laksanakan oleh UISU kampus duduki atau menguasai aset- Indonesia yang berpusat di Jalan Bantam No 6 A Medan itu pada dan Kopertis Wilayah I Sumut- Jalan SM Raja adalah domain aset UISU. acara Pesta Tahun di Desa Gurusinga Kecamatan Berastagi,Tanah Karo, Minggu (25/10) dinihari. Hadir pada kegiatan yang berlangsung 24-25 Oktober 2009 itu, pemuka masyarakat, NAD). Ada kesan membiarkan UISU kampus Jalan SM Raja te- tap melaksanakan penerimaan atau wilayah tugas Kopertis Wi- layah I Sumut-NAD. “Kopertis harus bertindak Selain itu dimintakan juga kepada Gubsu agar Kopetis Wi- layah I Sumut-NAD hanya me- UMSU Dorong Dosen pengusaha yang berasal dari Tanah Karo, serta masyarakat luas. Katanya, Tanah Karo membutuhkan setidaknya tiga hal: pendidikan, pertanian, dan pariwisata. “Jadi kalau alam dirusak, mahasiswa baru dan mewisuda mahasiswa. Pemaparan ini disampai- cepat dan tegas, jika ada bentu- ran-benturan terkait dengan penyelesaian akademik UISU layani Yayasan UISU yang sah sesuai dengan surat Mendiknas RI No 131/MPN/DT/2009 dan Lakukan Penelitian bagaimana mungkin pertanian dan pariwisata akan berkembang. kan oleh pucuk pimpinan Yaya- segera lapor ke saya. Sedangkan dimintakan juga Gubsu segera MEDAN (Waspada): Jika narasumber Rektor H Bahdin litian dari pemerintah juga Lalu, kalau masyarakat tidak bisa bertani karena lahannya rusak, san UISU: Ketua PembinaYaya- menyangkut masalah keama- memerintahkan kepada selu- masih ada dosen Universitas Nur Tanjung, SE.MM, Wakil citra UMSU semakin ter- bagaimana mungkin akan menyekolahkan anak-anak?” tanyanya. san UISU Hj Sariani AS, Ketua nan akan segera dibawa ke rapat ruh jajaran birokrasi pemerinta- Menurut Velentino, tema Kerja Tahun ini: “Tingkatkan Rasa Muhammadiyah Sumatera Rektor I Drs H Armansyah MM, dongkrak dan ini sangat men- Umum Yayasan UISU Usman Muspida,” kata Gubsu yang han yang ada di wilayah Sumut Utara (UMSU) menganggap Wakil Rektor II H Suhrawardi dukung visi-misi UMSU untuk Peduli Desa dengan Persaudaraan dan Persatuan”, tepat sekali. Pelly dan Rektor UISU Usman, secara tegas memerintahkan agr melayaniYayasan UISU dan Karena hanya dengan hal itulah masyarakat Karo dapat memelihara bahwa melakukan penelitian K Lubis SH.SpN.MH dan Ketua menjadi Perguruan Tinggi Ketua Bidang Pengembangan Kopertis Wilayah I Sumut-NAD Pimpinan UISU yang sah sesuai itu hanya buang-buang waktu Pusat Penelitian dan Karya yang unggul. dan menjaga alamnya. Dengan peduli desa yang dimulai oleh Kampus, Zainuddin, Ketua segera mengumumkan UISU surat Mendiknas RI. (m29) rasa persaudaraan serta persatuan di mana tercermin dari Kerja dan tenaga serta memusingkan Ilmiah (PPKI) UMSU Drs Ardial, Kepala PPKI UMSU, Drs Tahun ini masyarakat Karo dapat berkembang. “Jangan kita mau kepala saja, anggapan itu keliru M.Si. Ardial MSi mengutarakan, dari dipecah belah dan diadu domba. Yang saya bingung pecah belah yang dilakukan penjajah dulu, sekarang kok dilakukan oleh sesama kita untuk memecah-belah,” tegasnya. Bupati Batubara Imbau dan harus diganti dengan ko- mitmen jika ingin lebih sejahte- ra harus melakukan penelitian. Bahdin mengatakan, dunia ini maju berkat adanya peneliti- an seperti bidang komunikasi tahun 2005 hingga 2009 dosen UMSU yang memperoleh hibah kompetisi sebanyak 130 Dari Kerja Tahun ini tergambar betapa sesungguhnya sikap dasar masyarakat Karo adalah tolong-menolong (guyub). Semua kegiatan Pesta Tahun ini diurus oleh rakyat secara bersama-sama. Calhaj Daftar Ulang Sebab dewasa ini pemerin- tah melalui Ditjen Dikti Depdik- mulai dari menggunakan tele- pon engkol hingga putar/pijit orang. Tahun 2010 ini diharap- kan lebih banyak lagi dosen nas menyediakan anggaran un- angka sampai ke handphone melakukan penelitian dan “Harapan saya, sikap tolong-menolong ini jangan hanya berlaku MEDAN (Waspada): Bupati Diakuinya, lebih kurang 30 Empat jamaah yang tertun- tuk penelitian dosen melalui yang semakin hari semakin pihaknya menganjurkan para saat Kerja Tahun saja, juga teraplikasi dalam kehidupan sehari- Kabupaten Batubara berharap persen jamaah asal Kabupaten da berangkat sebelumnya, hibah kompetisi. “Alhamdulillah canggih. Begitu juga bidang dosen segera membuat propo- hari. Terlebih-lebih dalam membantu saudara-saudara kita yang jamaah calon haji yang masuk Batubara berusia lanjut antara diberangkatkan dengan Kloter pada tahun 2009 ini dosen transportasi bila dahulu mela- sal penelitian untuk diajukan sedang sakit dan kesulitan ekonomi, supaya anak-anaknya tetap daftar tunggu (waiting list) asal 55 hingga 84 tahun. Begitupun 17 yakni Nurhayati Saragih binti daerah Barubara segera men- masih lebih banyak jamaah Firman Saragih, 52, eks Kloter UMSU berhasil mendapatkan kukan ibadah haji naik kapal ke Ditjen Dikti Depdiknas. bersekolah,” harapnya. (m08) hibah kompetisi lebih baik dari laut memakan waktu berbulan- Wakil Rektor I UMSU, Drs daftarkan kembali untuk be- berusia muda, kata OK Arya. 15 Medan. Fatimah Raihana rangkat musim haji mendatang. Dia mengimbau para jama- Harahap binti M. Khatib Hara- Perguruan Tinggi Swasta (PTS) bulan pergi dan pulang, namun H Armansyah, MM mengata- Sekarang yang sudah terdaf- ah agar apa yang telah diperoleh hap, 51, eks Kloter 12 Deliser- lain”, ujar Rektor UMSU, H Bah- sekarang dengan pesawat udara kan, kegiatan ini bertujuan un- tar untuk musim haji 2010 men- selama pelaksanaan ibadah haji dang. Idris bin Salaman Ibrahim, din Nur Tanjung, SE MM pada yang semakin hari semakin tuk meningkatkan mutu kua- capai 230 orang bahkan diperki- di tanah suci dapat diterapkan 68, eks Kloter 11 dan Amir Hasan kegiatan sosialisasi hasil pene- cepat terbangnya hanya perlu litas proposal penelitian guna rakan akan bertambah, kata setibanya kembali di tanah air, Lubis bin Arifin, 64, asal Medan. litian 2009 bertempat di aula 8 jam saja dari Medan ke Saudi menghadapi hibah kompetisi Bupati Kabupaten Batubara Drs mudah-mudahan menjadi haji Dua orang jamaah batal lantai 5 gedung fakultas eko- Arabia. 2010. OK Arya saat melepas 453 mabrur bermanfaat bagi ma- berangkat/mengundurkan diri nomi UMSU kampus utama Jl Lanjut Bahdin, dengan ba- Pada kesempatan itu Wakil jamaah Kloter 17 di Embarkasi syarakat. yaitu Parlindungan Daulay bin Kapten Mukhtar Basri Medan, nyaknya dosen UMSU mem- Rektor II UMSU, H Suhrawardi Medan, Kamis (12/11). Hadir pada pelepasan ja- Marasaddin Daulay, 52 asal Rabu (11/11). peroleh hibah kompetisi dalam K Lubis SH.SpN.MH me- Sementara jamaah asal Ba- maah Kloter 17 gabungan anta- Medan dan Nurlita Koes binti Kegiatan tersebut dihadiri penelitian, dampaknya sangat nyajikan mater i seputar tubara sudah diberangkatkan ra lain Walikota Tanjung Balai Vilian Simbolon, 56 asal Medan. para dekan dan dosen tetap di menggembirakan karena selain peningkatan kualitas proposal dengan Kloter 10 dan Kloter 17. dr H. Sutrisno Hadi dan Wakil Penerbangan haji Garuda lingkungan UMSU dengan mendapatkan anggaran pene- penelitian. (m29) Mereka berasal dari kalangan Walikota Dr H. Thamrin Mun- Indonesia bertolak dari Embar- petani, nelayan dan sebagian the bersama PPIH Embarkasi kasi Medan menuju Jeddah pegawai negeri. Medan. pukul 15:55. (m32m36) Kepala Sekolah Muhammadiyah Niat Haji Sejak Menjabat Kapolsek Se-Sumut Ikuti Diklat Waspada/Ist KHAIRUL Bahri (foto) Berapa banyak orang yang MEDAN (Waspada): Seba- jaran bagi peserta didik yang yakni Peranan Perguruan Mu- SAMBUTAN: dr Rober t Valentino Tarigan sedang yang pernah menjabat Kapol- mampu tapi tidak punya nyak 60 Kepala Sekolah Tingkat terkait dengan UU No.14 tahun hammadiyah Sumut dalam menyampaikan kata sambutan kepada masyarakat Desa sek Medan Teladan dan Si- kesempatan. Seperti saya SMP dan SMA Muhammadiyah 2005 tentang Guru dan Dosen. Pembangunan Sumber Daya Gurusinga Kec Berastagi Tanah Karo. pada acara Pesta Tahun, biru-biru serta saat ini dulu, tentu saja dari segi se-Sumatera Utara ikuti pen- Menurut Hosen yang juga Manusia, Siswa dan Perkem- Minggu (25/10) dinihari. bertugas di Poldasu, mengaku finansial saya mampu karena didikan dan latihan (diklat) yang anggota DPRD Sumut dari PPP bangan Muhammadiyah, Seko- niatnya menunaikan ibadah mempunyai penghasilan. digelar Majelis Pendidikan Da- ini, dalam UU tersebut para gu- lah Muhammadiyah dalam sar dan Menengah (Dikdas- ru dituntut profesional dengan Peluang dan Tantangan, Mu- Hari Ini Calhaj haji sejak menjabat sebagai Kapolsek. Namun, doa dan Tetapi kesempatan itu belum juga datang dari Allah, agar men) PW Muhammadiyah memiliki kualifikasi akademik, hammadiyah Multi Kultural. Sumut. kompetensi dan sertifikat pen- Judul tulisan untuk pelajar Take Off Jam 13:00 harapannya itu baru terkabul setelah dia pindah tugas. saya termasuk orang yang dipanggil memenuhi rukun Ketua Majelis Dikdasmen didik, sehingga berfungsi me- SMP sederajat, yakni “Sekolah- MEDAN (Waspada): Hari Jumat (13/11) ini, calon jamaah haji “Allah lebih tahu, kenapa Islam kelima. “Karena itu, PW Muhmmadiyah Sumut, HA ningkatkan mutu pendidikan ku Idolaku, Menuju Sekolah asal Embarkasi Medan yang bergabung di kloter 18 akan take dia memanggil saya ke tanah saya ingin ibadah ini mampu Hosen Hutagalung, di kantor nasional. Favorit”, “Gaul Yes, Prestasi Oke, off jam 13:00 dan mendarat di Bandara King Abdul Azis Arab Saudi suci saat ini. Selain tidak ter- saya lakukan dengan sem- PWM Sumut Jalan SM Raja Dijelaskannya, kegiatan Islam Wajib (Mengukir Prestasi saat Maghrib. lalu sibuk dengan pekerjaan, purna, sehingga saat kembali Medan, Rabu (11/11) mengata- untuk memeriahkan gebyar yang Islami di Era Globalisasi)”, Demikian Sekretaris Panitia Pelaksana Ibadah Haji (PPIH) saya lebih banyak waktu untuk memper- nanti menjadi haji yang mabrur,” kata kan, kegiatan tersebut dirangkai muktamar dan Milad Muham- dan “Sekolah Muhammadiyah Embarkasi Medan Drs H Abdul Rahman melalui Bidang dalam ilmu agama dan haji. Seperti di- Khairul Bahri yang akrab disapa Keong. dalam memeriahkan gebyar madiyah satu abad ini, sebe- Mampu atau Tidak (Prestasi Penerangan dan Bimbingan Pusat Informasi Haji Drs H Sazli, sampaikan pembimbing di kelompok ibadah Apa yang didambakan setelah kembali? muktamar dan Milad Muham- lumnya juga diadakan berbagai Unggul)”. Kamis (12/11). haji yang saya ikuti, bahwa pelaksanaan Dia ingin menjadi panutan di tengah madiyah satu abad. ajang perlombaan melibatkan Sedangkan judul tulisan Untuk itu diimbau agar seluruh jamaah yang akan berangkat Hosen Hutagalung yang guru dan siswa Muhamma- untuk pelajar SMA sederajat, sudah memasuki Aula Madinatul Haj pukul 10:00, sehingga prosesi ibadah ini memerlukan kekuatan fisik dan masyarakat, terutama rekan-rekan seprofesi paham ilmunya, maka saya sadar bahwa agar mereka bertekad untuk menunaikan didampingi Sekretaris panitia diyah se-Sumut, seperti ajang “Sekolah Muhammadiyah kegiatan untuk pelepasan keberangkatan sebelum pukul 12:00 M Soleh Tanjung, ST menjelas- perlombaan yang telah digelar Perlukah (Mengungkap Potensi sudah selesai. ilmu itu harus dipelajari. Nah, waktu yang rukun Islam kelima. Apalagi usia masih cocok untuk belajar ilmu manasik ini setelah muda dan punya penghasilan, tentu lebih kan, diklat guru-guru Muham- antara lain penulisan karya dan Kelemahan Muhamma- “Jamaah diharapkan langsung menggunakan pakaian ihram, madiyah ini berlangsung se- ilmiah, pemilihan guru terlama diyah)”, “Aku Siswa Sekolah atau menyiapkannya dalam tas yang mudah diambil. Apalagi tidak jadi Kapolsek lagi,” katanya saat ditemui mudah berangkat. Tetapi harus segera di Asrama Haji Pangkalan Masyhur Medan, diniatkan dan ada upaya untuk mencapai- lama 6 hari yang pembukaan- mengajar di Muhammadiyah, Muhammadiyah, So What Gitu para jamaah akan melewati proses pemeriksaan di imigrasi nya dimulai Selasa (17/11), pemilihan sekolah Muham- Loh (Mengukir Prestasi di Seko- mencapai 4 sampai 5 jam lamanya. Jika belum mengenakan ihram Kamis (12/11). nya, misalkan dengan membuat tabungan Dia menambahkan, kesempatan yang haji, memperbanyak amalan-amalan soleh, sedangkan penutupan Minggu madiyah terpencil sekaligus lah Muhammadiyah)” dan dibandara itulah mereka lakukan terus berniat umroh, mereka diperkirakan tiba di Makkah Sabtu dinihari,” kata Sazli. diberikan Allah untuk berangkat tahun ini belajar ikhlas dengan menerima sesuatu yang (22/11), di aula kampus UMSU penyeleksian gurunya. “Muhammadiyah di Mataku”. Dia menambahkan, berdasarkan data dari Sitem komputerisasi akan dimanfaatkan demikian rupa. Allah diluar keinginan kita. “Perbanyak berharap Jalan Mukhtar Basri Medan. Pada lomba tulisan ilmiah, Penutupan gebyar mukta- haji (Siskohat), suasana di Masjidil Haram sudah penuh dengan telah mengabulkan harapan dan pintanya kepada Allah dan saling berbagi untuk Diklat ini, bertujuan sebagai katanya, pesertanya terdiri dari mar ini, lanjut Hosen, dihadiri manusia yang ditaksir mencapai 2,5 juta orang. Sedangkan, jamaah untuk bisa menunaikan rukun Islam kelima. mereka yang memerlukan pertolongan,” pengembangan dan wawasan pelajar SMP dan SMA Muham- Gubernur Sumatera Utara H haji asal Indonesia, hingga Kamis (12/11), sudah 150.000 orang Tentu saja, lanjutnya, kesempatan yang paparnya yang ingin berangkat haji bersama pendidikan para guru terhadap madiyah, sedangkan kalangan Syamsul Arifin SE sekaligus tiba di Arab Saudi. Puncak seluruh kelompok terbang asal Indonesia diberikan Allah ini tidak akan disia-siakan. istrinya, Safira Hani Nasution. (m36) kebijakan pemerintah dalam tenaga pendidik, ada empat pengumuman pemenang akan berakhir tanggal 17 Nopember mendatang, katanya. (m36) peningkatan proses pembela- judul tulisan yang ditawarkan, perlombaan. (m41)
  • 8. WASPADA Jumat 13 November 2009 Medan Metropolitan 11 Empat Tersangka Pembunuh Tuan Tanah Diringkus Dua Di Antaranya Ditembak MEDAN (Waspada): Reskrim Poltabes Medan itu, Iwan Fok terpaksa ditembak korban menghubungi pihak Hotmin Bakara, 23, anak bung- meringkus empat pelaku penculikan disertai bagian kaki kirinya karena keluarganya untuk meminta su Hasiolan Bakara, yang meli- memberikan perlawanan. uang Rp2 miliar sebagai tebu- hat mayat membusuk itu di pembunuhan terhadap tuan tanah, Hasiolan Baru jual tanah san. Karena pihak keluarga tidak ruang jenazah RS. Pirngadi Bakara, 80, warga Jalan Tegal Sari Dusun IX, Desa Dijelaskan Kasat Reskrim, ada uang, para tersangka kemu- Medan, Kamis. Lau Dendang, Kamis (12/11). Dua diantaranya kejadian penculikan dan pem- dian menganiaya korban hing- “Polisi memberi tahu kami, bunuhan tersebut berawal, ga tidak berdaya. tadi pagi. Polisi mengatakan Ha- terpaksa ditembak karena berusaha melarikan Sabtu (31/10) dinihari, para ter- Setelah itu korban ditinggal siolan Bakara sudah tewas dan diri. sangka dengan mengendarai sebentar oleh pelaku di salah saat ini sudah berada di Ruang mobil Avanza BK 1565 JQ satu tempat dekat penangkaran Jenazah RSUPM. Makanya Keempat tersangka dibekuk pelaku mendapat informasi datang ke rumah korban yang burung walet. Setelah ditinggal kami datang kemari,” ujarnya. dari kediamannya masing-ma- dari masyarakat tentang keber- baru saja menjual tanahnya. beberapa menit, tersangka Bus- Tapi, lanjutnya, setelah kami sing yakni Yudi, 24, warga Jalan adaan tersangka M Tupon yang Setelah itu, para tersangka taman kembali menghampiri lihat dengan seksama mayat Waspada/Rudi Arman Hamparan Perak, Bustaman, sedang berada di rumahnya. yang mengaku angota Polri ma- korban dengan tujuan untuk yang membusuk itu, kami tidak Dua penculik dan pembunuh Hasiolan Bakara yang ditembak kakinya tersangka Bustaman 29, ditembak kakinya, warga Berdasarkan laporan itu, suk ke dalam dan menodong meminta uang, namun korban yakin itu adalah bapak. “Karena dan Iwan Fok sedang mendapatkan perawatan medis di RSU Bhayangkara, Kamis (12/11). Komplek Perumahan Labuhan polisi langsung menuju kedia- korban pakai senpi dan meng- dilihat telah tewas sehingga para kami mengenal betul ciri-ciri- Deli, M Tupon, 26 dan Iwan Fok, man tersangka dan meringkus gasak uang Rp 9 juta serta surat pelaku langsung kabur. nya, pokoknya kami yakin itu 23, ditembak kakinya, warga M Tupon. Setelah itu, dilakukan tanah. Lalu kedua tangan kor- Tidak Akui Mayat bukan bapak,” pungkas Hotmin Jalan Tegal Sari, Desa Lau pengembangan dan akhirnya ban diikat dan dimasukan ke Pihak keluarga tidak me- tanpa memberikan kejelasan Saksi Ahli: Dendang. membekuk tersangka Busta- dalam mobil yang dirental pela- ngakui mayat yang membusuk yang pasti ciri-ciri korban. Kapoltabes Medan, Kom- bes Pol Drs. Imam Margono, didampingi Kasat Reskrim, man. Namun, saat hendak di- tangkap tersangka Bustaman melakukan perlawanan sehing- ku. Sementara, istri korban ber- nama Rosmawati dana anaknya itu sebagai Hasiolan Bakkara, korban penculikan disertai Mengenai siapa mayat itu, dia sekali lagi menegaskan bah- Menguasai Barang Bersama tidak bisa berbuat apa-apa pembunuhan, yang ditemukan, wa itu bukan bapaknya.“Pokok- Kompol Gidion Arif Setiyawan, kepada wartawan mengatakan, penangkapannya terhadap ga polisi melumpuhkannya pakai timah panas. Dari pengakuan kedua ter- karena takut. Setelah itu korban dibawa Kamis (12/11) sekira pukul 3.00, di Desa Melati Kebun Coklat, nya itu bukan bapak,” tegasnya. Terkait berita masalah pe- Perbuatan Melawan Hukum ke kawasan Perbaungan. Ter- Perbaungan Serdang Bedagai. nemuan mayat Hasiolan Bakara para tersangka berawal petugas sangka itu, petugas kembali sangka kemudian menyuruh Seperti yang diungkapkan baca di halaman 17.(m39/cmai) MEDAN (Waspada): Me- wa ToniWijaya sudah bisa dika- mempelajari duduk permasala- yang sudah dua pekan melaku- menangkap tersangka Iwan Fok nguasai barang milik bersama tegorikan suatu perbuatan han dari BAP saksi pelapor dan kan pengejaran terhadap para dan Yudi. Dalam penangkapan merupakan perbuatan mela- pidana penggelapan. terlapor. Kasus Dugaan Korupsi Drainase wan hukum, kata Dr Mahmud Menurut saksi ahli, meski- Seperti diberitakan, JPU Ibu Hamil Dan Muliadi, SH, MHum saat diha- pun barang sudah dikembali- menjerat terdakwa Toni Wijaya Anaknya Terbakar Mantan Camat Ditahan dirkan sebagai saksi ahli dalam sidang lanjutan perkara dugaan kan sebagian dan sisanya tetap ditahan atau dikuasai maka dengan pasal 372 KHUP karena diduga menggelapkan 480 surat penggelapan ratusan dokumen perbuatan itu adalah perbuatan berharga milik PT CPL. MEDAN (Waspada): Seorang wanita hamil dan anaknya MEDAN (Waspada): Setelah kan penyidikan lebih menda- nya kemungkinan camat lain milik PT Citra Pratama Lestari tindak pidana penggelapan. Sebagian besar dari ratusan mengalami luka bakar akibat rumah kontrakannya terbakar di mantan Camat Medan Perjua- lam guna mengumpulkan buk- menyusul SH ke dalam Rutan (CPL) oleh terdakwa ToniWijaya “Tidak ada alasan, mena- surat yang digelapkan terdakwa Jalan Parangras Dalam, Kel. Kwala Bekala, Kec. Medan Johor, Rabu ngan, SH ditahan dalam kasus ti-bukti yang akurat untuk me- atau adanya tersangka baru, yah bos Kompleks Asia Mega Mas, han barang orang lain bahkan di antaranya sertifikat tanah (11/11) sekira pk 19:00. Korban luka bakar tersebut dirawat di dugaan penyelewengan dana nuntaskan kasus dugaan ko- semua itu tidak tertutup ke- Kamis (12/11). meskipun pemilik barang itu seluas78 Ha di Pekan Sunggal Klinik Medica Jalan Jamin Ginting Medan. normalisasi drainase Rp180 ju- rupsi penyalahgunaan keuang- mungkinan sepanjang alat buk- Di samping itu, dosen Fa- memiliki utang sekalipun. milik PT CPL dan sejumlah su- Informasi yang diperoleh di lokasi kebakaran menyebutkan, ta, tidak tertutup kemungkinan an negara,” tambah Saragih. ti kuat ada,” pungkas Tarigan. kultas Hukum USU tersebut Sebab, utang piutang masuk ke rat jual beli lainnya. sekira pk 19:00, penghuni rumah Lisna br Tarigan, 35, dan putranya camat lain menyusul. Kasi Penkum/Humas Keja- Jelasnya, lanjut Tarigan, tim berpendapat, penyalahgunaan ranah perdata. Sedangkan kua- Peristiwa itu terjadi 25 Juni Joice Peranginangin, 3, berada di dalam rumah. Tiba-tiba saja, “Tim Pidana Khusus Kejati- tisu Edi Irsan Tarigan menam- akan menggali keterangan se- su sudah menahan dia setelah bahkan, Kamis (12/11), dalam banyak mungkin dari peme- kepercayaan juga merupakan sai barang orang lain perbuatan 2008, modusnya terdakwa yang arus listrik PLN padam. perbuatan melawan hukum pidana,” pungkas saksi ahli. merupakan salah seorang Ko- Masih dalam suasana gelap, Lisna memasang lilin dan lebih dulu ditetapkan sebagai kasus ini tersangka sudah me- riksaan tersangka SH yang tersangka,” kata Asisten Tindak ngembalikan uang sebesar masuh terus dilakukan. “Kalau atau penggelapan. Dalam kasus Saksi ahli berpendapat, misaris di PT CPL meminjam meletakkannya di dalam kamar putranya. Tak lama ke luar dari dalam kamar, api lilin menyambar genset yang letaknya tak jauh Pidana Khusus (Pidsus) Kejati- Rp180 juta, tapi karena pena- nanti dari keterangan tersangka ini, menurut saksi ahli, meski perbuatan terdakwa dalam sertifikat ke pihak kepada salah dari lilin tersebut. Diduga genset mengalami kebocoran sehingga su, Erbindo Saragih menjawab nganannya sudah tahap penyi- muncul nama baru atau alat delik formilnya tidak menim- kasus sudah termasuk tindak satu pimpinan di perusahaan api langsung membesar. Waspada. dikan dan sesuai ketentuan UU bukti baru, pasti ditindaklanjuti, bulkan kerugian akibat pengua- pidana penggelapan. “Saya me- itu. Melihat api di dalam kamar, sang ibu berusaha menyelamatkan Menurut Saragih, kasus ini korupsi pengembalian uang sampai tuntas,” tandas Tarigan. saan dokumen, tapi unsur tin- nyimpulkan demikian sesuai Namun, sampai batas wak- putranya Joice. Joice mengalami luka bakar pada bagian punggung merupakan pengembangan tidak menggugurkan perbuatan Sebelumnya dalam kasus dak pidana penggelapannya dengan fakta-fakta dari kete- tu yang dijanjikan, terdakwa sedangkan Lisna br Tarigan yang sedang hamil tiga bulan penyidikan yang dilakukan tim pidana. ini, tim Pidsus Kejatisu mena- terpenuhi. rangan saksi-saksi yang dirang- belum juga mengembalikan su- mengalami luka bakar pada bagian tangan dan kakinya. Pidsus terkait kasus dugaan Menjawab Waspada, Tari- han Kepala Sub Dinas Pekerjaan “Menguasai barang walau- kum penyidik dalam Berita rat-surat berharga yang dipin- Para tetangga yang mengetahui kebakaran tersebut berusaha korupsi dana proyek drainase gan mengatakan, tim jaksa Umum (PU) Kota Medan Ir pun pelaku memiliki hak atas Acara Pemeriksaan (BAP), dan jamnya, malah terkesan ingin memadamkan api sebisanya, termasuk membongkar pipa air senilai Rp3 miliar dari anggaran penyidik yang diberikan Parlaungan Lubis, 48. Perka- barang itu, tapi orang lain juga fakta-fakta di BAP yang diserah- menguasai surat berharga itu. leading di depan rumah korban. Setelah mobil Dinas Pencegah APBD tahun 2007 sebesar Rp10 kewenangan menangani kasus ranya sudah divonis di Penga- memiliki hak sama, maka tin- kan penyidik, sudah saya Keberatan dengan perbuatan Dan Pemadan Kebakaran tiba, api akhirnya berhasil dipadamkan. miliar. tersebut hingga saat ini terus dilan Negeri Medan beberapa dakannya itu sudah tergolong pelajari,” katanya. ToniWijaya, pihak PT CPL lang- Kepala lingkungan setempat, Terima Tarigan mengatakan, “Tim masih terus melaku- melakukan penyidikan. “Ada- waktu lalu. (h05) unsur pidana penggelapan,” Selain Mahmud Muliadi, sung melaporkan kasus itu ke penghuni rumah yang mengalami luka bakar selanjutnya dibawa katanya. JPU juga menghadirkan saksi Poltabes Medan sesuai STBL/ warga ke Klinik Medica. Sedangkan suami korban, A Peranginangin, yang saat kejadian itu tak berada di rumah terlihat histeris saat meli- Kasus FBI Menjawab Jaksa Penuntut ahli bidang pidana Dr Marlina, 502/II/2009 tertanggal 24 Feb- Umum (JPU) Oktario Hutapea, SH, MHum. Atas keterangan ruari 2009. Dalam perkara itu, hat istrinya yang sedang hamil tiga bulan menderita luka bakar. Kapolsekta Delitua, AKPYoris Marzuki, menduga asal api diduga dari mesin genset yang terbakar karena lilin. “Korban belum bisa dimintai keterangannya karena masih dirawat akibat menderita Empat Terdakwa SH terkait kasus ini, saksi ahli berpendapat perbuatan terdak- saksi ahli, terdakwa keberatan dengan alasan saksi ahli tidak terdakwa ditahan di Rutan Tan- jung Gusta Medan. (h05) luka bakar,” sebut Yoris Marzuki seraya mengimbau warga agar lebih berhati-hati menghidupkan mesin genset, terlebih-lebih listrik PLN sering mati secara tiba-tiba. Dituntut 78 Bulan Penyalahguna Narkoba Sebab, tambahYoris, kebakaran sering terjadi saat listrik padam, seperti yang terjadi baru-baru ini di kawasan Pajak Melati yang merenggut nyawa tiga orang. (cat) MEDAN (Waspada): Empat dikenakan sebesar Rp50 juta. (pledoi) dari pihak terdakwa. Bukan Aib Keluarga terdakwa kasus dugaan korupsi Sementara terdakwa Sirajuddin Dalam dakwaan, JPU dana Festival Budaya Islam (FBI) Gayo tidak dihukum membayar menyebutkan, Pemko Medan MEDAN (Waspada): Penya- keliru. Seperti, penyalahguna menjadi penyalah guna nar- lahguna narkoba bukan sebagai narkoba hanya berasal dari koba. “Bekas-bekas anggota Tersangka Penganiyaan dituntut berbeda di Pengadilan Negeri Medan, Kamis (12/11). uang pengganti karena telah mengembalikan uangnya. telah mengalokasikan anggaran untuk kegiatan Festival Budaya aib dalam keluarga. Begitu bu- kan sampah di masyarakat, teta- golongan ekonomi menengah ke atas, penyalahguna narkoba DPR, Brimob, dan polisi sendiri pun ada yang berobat ke Diringkus Mantan Kepala Dinas Pariwisata Medan Syarifuddin JPU Ahmad P Hasibuan menyatakan, para terdakwa Islam (FBI) sebesar Rp7,5 miliar. Namun, pada pelaksanaannya, pi ini merupakan bencana na- sional yang harus ditanggulangi dianggap sebagai pelaku keja- hatan bukan korban, dan pe- yayasan rehabilitasi yang saya pimpin,” kata Ketua Yayasan MEDAN (Waspada): Tim Pemburu Preman (TPP) Polsekta dituntut dua tahun penjara dan terbukti secara sah dan meya- terjadi perubahan (addendum) bersama-sama oleh seluruh nyalahgunaan narkoba hanya Sibolangit Center itu. Percut Sei Tuan dan Poltabes Medan, meringkus pelaku denda Rp50 juta subsider enam kinkan bersalah sebagaimana menjadi Rp5,2 miliar. lapisan masyarakat, bukan berasal dari golongan broken Peraturan sekolah keliru penganiayaan terhadap Hermansyah, 26, warga Perumnas bulan.Selainitudiwajibkanmem- diatur dan diancam pasal 2 dan Dalam pelaksanaan kegia- hanya merupakan tanggung home. Kata Lubis, disiplin yang Mandala, dalam penyergapan di Desa Cinta Damai, Kec. Percut bayar uang pengganti Rp101 pasal 3 ayat 1 jo pasal 18 UU RI tan senilai Rp5,2 miliar tersebut jawab pemerintah. Lubis menegaskan, masalah kaku dari sekolah dapat men- Seituan, Selasa (10/11) siang. juta. Jika tidak dilakukan maka No 31 Tahun 1999 jo UU RI No terjadi penggelembungan harga “Kalau masyarakat meng- narkoba ini masalah serius. ciptakan korban baru penya- Tersangka RST, 35, warga Jalan Dusun I, Desa Cinta Damai, akan ditambah hukuman 6 20 tahun 2001, dan pasal 55 jo sejumlah item yang men- anggap penyalahguna narkoba Untuk itu, lanjutnya, kepada lahguna narkoba. Dia mencon- Kec. Percut Seituan diboyong ke Mapolsekta Percut Seituan untuk bulan. ayat 1 ke 1. dukung kegiatan seperti biaya adalah aib keluarga, maka ma- pihak keluarga jika ada salah tohkan, disiplin yang tidak mempertanggung jawabkan perbuatannya. Tiga terdakwa lainnya yakni “Meminta majelis menja- cetak undangan, biaya tiket salah untuk menanggulangi seorang anggota keluarganya memperbolehkan murid ma- Kapoltabes Medan, Kombes Imam Margono, melalui Direktur CV Green Production tuhi hukuman penjara dua ta- pesawat, biaya konsumsi, biaya tentang bahaya narkoba tak akan menjadi penyalahguna nar- suk saat terlambat datang ada Kapolsekta Percut Seituan, AKP Jumainur, yang dikonfirmasi Yohanes, Pemegang Kuasa CV hun kepada terdakwa Syarifud- perjalanan dinas, biaya sewa berhasil, malah pasar peredaran koba, jangan malu-malu untuk contoh disiplin yang kaku. wartawan mengatakan, peristiwa penganiayaan itu terjadi, Rabu Green Production Sirajuddin din, dan hukuman penjara satu tenda, panggung, dan lain- narkoba semakin merebak,” ka- mengirimkan anaknya ke pusat “Saat murid terlambat, (28/10) sekira pukul 22:30, di Desa Cinta Damai. Gayo, dan Pelaksana Teknis To- tahun enam bulan kepada lainnya. ta praktisi dan pengamat masa- rehabilitasi. pintu atau pagar sekolah sudah Antara korban dengan tersangka terjadi ribut mulut di lokasi ras Sulaiman dituntut hukuman ketiga terdakwa lainnya,” pinta Perbuatan keempat ter- lah narkoba HM Kamaluddin “Kita harus selamatkan dia ditutup. Tapi si anak tidak kejadian. Setelah itu dilanjutkan dengan perkelahian. Tersangka masing-masing 1 tahun 6 bulan. JPU di hadapan majelis hakim dakwa yang dilakukan secara Lubis dalam acara Forum Sila- segera dan masukkan ke pusat langsung pulang ke rumah yang merasa terdesak kemudian mengambil sepotong kayu yang turahim Media Massa Antinar- rehabilitasi,” katanya kepada karena takut dimarahi orang ada di lokasi. Ketiganya diminta mem- diketuai Yuffery F Rangka. melawan hukum telah me- bayar denda Rp50 juta subsider Usai pembacaan tuntutan ngakibatkan kerugian Negara koba di Asean International Waspada usai acara tersebut. tua, saat itulah si anak pergi Selanjutnya dengan menggunakan kayu itu, tersangka Hotel, Senin (9/11). Menurut Lubis, bukan ha- entah ke mana-mana dan melakukan penganiayaan hingga kepala korban bocor dan banyak enam bulan kurungan. Sedang- JPU, majelis menunda persi- sebesar Rp701 juta. Hal ini Menurut Lubis, banyak pan- nya remaja yang banyak men- berpeluang besar menjadi mengeluarkan darah. Melihat korban tidak berdaya, tersangka kan untuk uang pengganti Yo- dangan hingga pekan depan diperkuat perhitungan BPKP dangan masyarakat terhadap jadi penyalahguna narkoba, tapi penyalahguna narkoba,” kabur. (m39) hanes dan Toras Sulaiman dengan agenda pembelaan Sumut. (h05) penyalahgunaan narkoba yang seperti ada juga orang-orang tua ujarnya. (cmai) Nasib Si Penjual Sate Keliling Biaya Nikah Rp350.000-Rp400.000 MEDAN (Waspada):Walau- Pak, saya bayar Rp 250.000,” ujar langan bawah seperti tukang TUBUHNYA yang kurus bungi keluarga saya yang di kitpun saya bayar,”ujar pemuda nya di RSUP HAM.“Kalau nggak diperoleh Waspada, biaya pun tidak ada pemberlakuan warga tadi. Wah, kalau cuma becak, pedagang kecil, ujarnya. hanya bisa direbahkannya Pekanbaru dan di Jakarta, tapi berdarah Minang ini. ada yang bantu saya nggak tahu perawatannya dari sejak 20 tarif secara resmi ternyata biaya segitu bapak ke KUA saja, ujar Masyarakat memaklumi di tempat tidur di Ruang mereka seperti tak peduli. Setiap Dia berharap sekali Dinas nasib saya seperti apa di sini. Oktober hingga 11 November pencatatan nikah di Kota Me- tuan kadhi menolak dibayar jika sang tuan kadhi mendapat Rindu B lantai III RSUP H. saya nelpon pasti dimatikan- Sosial, dermawan dan saudagar Saya mohon bantuan dari para sudah mencapai Rp6 juta dan berkisar antara Rp350.000 Rp250.000. biaya lebih karena biasanya dia Adam Malik Medan. Tak nya,” tuturnya memulai pem- Minang yang di Medan mem- dermawan,” tuturnya sembari lebih. s/d Rp400.000. Lho, tadi Bapak bilang cuma harus datang di pagi hari ke ada yang bisa dilakukannya, bicaraannya kepada wartawan, bantunya dalam membiayai meneteskan air mata. Berdasarkan pengakuan Rp30.000. Warga pun bertanya, tempat pengantin yang akan seorang kadhi kepada seorang berapa sebenarnya biayanya. nikah dan di sana pun dia mem- kecuali hanya duduk dan Rabu (11/11). perawatan dan pengoperasian- Sementara informasi yang *Mursal AI warga, biaya nikah menjadi Lalu tuan kadhi bercerita sudah berikan nasehat. Tetapi kalau berbaring. Untuk buang air Syahril sendiri tidak tahu sebesar itu karena adanya ‘bagi- merupakan hal yang lumrah di setiap ada warga yang menikah kecil dan besar saja dilaku- kenapa saudaranya tidak begitu bagi’ sesama petugas, seperti Kota Medan biaya nikah berki- Kepling harus dapat Rp50.000 kannya di tempat tidur de- memperhatikannya. “Ibu saya kepala lingkungan mendapat sar antara Rp350.000 s/d dan petugas KUA sampai ngan menggunakan pispot. Sulis tinggal di Pekanbaru Rp50.000,, untuk petugas di Rp400.000 tak terkecuali bagi Rp150.000, itu namanya sudah Mirisnya lagi, selama dalam bersama abang, ayah saya kantor urusan agama (KUA) tukang becak sekalipun. Tuan berlebihan, kata warga. perawatan di rumah sakit, Lintau sudah meninggal. Saya Rp150.000,- dan sisanya adalah kadhi itu menambahkan biaya “Mungkin gara-gara biaya tak ada satupun keluarga nggak tahu apa salah saya untuk tuan kadhi sendiri. nikah yang paling murah di nikah yang mahal itulah yang yang datang menjenguk dan hingga mereka tak peduli, kalau Menurut keterangan warga, Kota Medan ini adalah di Bela- menyebabkan banyak orang ni- menanggung pembiaya- saya ada salah saya mohon semula dengan bekal kelengka- wan, itupun mungkin karena kah tanpa melalui KUA sehingga annya. maaf,” ujarnya. pan surat untuk nikah anaknya di sana masyarakatnya adalah akhirnya pemerintah menikah- Dia adalah Syahril, 42, Sy a h r i l m e n u t u rk a n , dia mendatangi satu kantor kaum nelayan. kan kembali mereka secara mas- warga Jalan Rakyat Lorong dirinya jatuh kejurang yang KUA namun atas saran seorang Menurutnya, biaya menjadi sal demi tertibnya administrasi Meninjau, korban kecelaka- dalamnya sekitar 4 meter dari petugas di sana dianjurkan agar sebesar itu karena harus dibagi- kependudukan. Sudah saatnya an jatuh dari kereta di Bras- ruas jalan bersama tokenya dia berurusan saja dengan tuan bagi lagi yakni untuk kepala pemerintah menertibkan pungli tagi, Tanah Karo, Sumatera Udin saat hendak ke Berastagi. kadhi sesuai dengan wilayah. lingkungan Rp50.000,- untuk yang sepertinya sudah menjadi Utara, sehingga tulang kaki Kejadian itu pada 18 Oktober. Keesokan harinya warga terse- petugas di KUA Rp150.000,- lumrah tersebut sehingga paha dan tulang keringnya “Saya ditolong warga kemudian but bersama anak lelakinya “Saya ini bukan PNS Pak jadi menyebabkan masyarakat yang yang akan menikah datang ke penghasilan yang diharapkan berkepentingan menjadi tidak sebelah kanan patah. Sudah dilarikan di rumah sakit ini, rumah tuan kadhi dimaksud. cuma dari kerjaan ini,” ujarnya. berdaya sama sekali,” ujar salah hampir tiga minggu dia untunglah ada kawan-kawan Dalam pertemuan itu se- Kalangan masyarakat yang seorang warga.. dirawat, hanya ditemani saya yang berbaik hati menjagai mula tuan kadhi tersebut me- pernah menikahkan keluarga Di tempat terpisah Kasi oleh kawan-kawannya yang saya di sini,” jelasnya pemuda meriksa kelengkapan surat. atau anaknya membenarkan Urusan Agama Islam (Urais) merasa iba dengannya. Bu- lajang ini dengan lirih. Kemudian dia menyodorkan harga antara Rp350.000 s/d Kandepag Medan Drs Impun kan tak ada usaha untuk Yang lebih menyedihkan surat jadwal nikah yang harus Rp400.000 tersebut sudah ber- Siregar mengatakan biaya resmi memberi kabar kepada hatinya, hampir setiap hari pe- ditandatangani oleh warga. Se- laku umum. Bahkan ada tuan memang hanya Rp.30.000 un- abang dan adiknya di Pe- rawat menanya kepada dirinya sudah menandatangani jadwal, kadhi yang mematok sampai tuk kekas negara. Tetapi bagi kanbaru dan di Jakarta, tapi tentang biaya perawatannya. warga pun bertanya, berapa Rp500.000. “Memang semakin masyarakat yang ingin mem- memang saudaranya ku- “Saya bingung mau menja- biayanya Pak? Tuan kadhi men- parah saja pungli di kota ini, ma- beri lebih tentu tidak ada masa- rang peduli dengan nasib si wab apa, uang saya sepeser pun jawab, soal biaya itu pengertian sak biaya nikah mengimbangi lah. “Itu sesuai keikhlasan ma- tukang sate keliling ini. tak ada. Saya tak punya saudara Waspada/Mursal AI saja kalau buku nikah cuma biaya pengurusan paspor,” ujar syarakat, karena umumnya “Dengan menggunakan di sini. Tapi meskipun mereka DIGANTUNG: Kaki kanan Syahril terpaksa digantung dengan alat Skeletal Traksi (alat untuk Rp30.000. warga tersebut. Mungkin bagi tuan kadhi tidak mendapatkan handphone kawan, saya menagih,tapi saya tetap dirawat meluruskan kaki yang patah atau cedera-red) di Ruang Rindu B Lantai III RSUP H. Adam Malik Mendengar penjelasan dari mereka yang berkemampuan, gaji dari pemerintah, sementara mencoba untuk menghu- di sini, walaupun belum sedi- Medan. Foto direkam Rabu (11/11). tuan kadhi, warga itu menge- biaya sebesar itu tidak menjadi mereka bertugas secara ikhlas luarkan uang Rp250.000. “Ini masalah tetapi bagaimana ka- beramal.” (m05/m36)
  • 9. 12 Opini WASPADA Jumat 13 November 2009 Kok Berpindah Ke Lain Hati…..? (Soal Ujian Masuk CPNS 2009) ngan masyarakatnya sendiri, karena ada pembuat soal juga dirahasiakan”. Mes- anggapan penyelenggaraan tersebut kipun pernyataan ini diikuti dengan ko- Oleh Usman Effendi Sitorus syarat dengan permainan yang tidak Fair. mentar miring “ alah, itu kan kata dia, Anehnya, meskipun dua tahun be- mana mungkin kita kosong-kosong, apa lakangan USU dianggap berhasil me- kata dunia”,setidaknya pernyataan yang “S ebab, tim seleksi di USU kit lain seperti panas tinggi dan de- nyelenggarakan seleksi ujian masuk sudah menjadi milik publik harus di- ( pembuat naskah, pe- mam berdarah, maka mau tidak mau CPNS , yang keberhasilan dapat dilihat tangkap sebagai bentuk kesungguhan meriksaan lembar ja- sebagaian besar korban demam pe- dari beberapa komentar kepala daerah USU untuk melahirkan sebuah proses waban ujian dan peme- nerimaan CPNS banyak mendatangi dan tokoh masyarakat yang cukup puas penerimaan CPNS yang menjunjung ringkatan hasil ujian ) memang tidak dokter spesialis , dokter umum , man- dengan penyelenggaraan ujian masuk tinggi nilai-nilai kejujuran yang berda- bisa dipengaruhi.” Di pihak USU sen- tri/bidan bahkan ada yang menda- CPNS yang transparan, akuntabiltas sarkan kepada asas kemampuan dan diri, rektor sudah membuat sistemnya tangi dukun dan orang-orang yang serta bersih dari KKN beberapa tahun kelayakan. TAJUK RENCANA tidak bisa main-main”,” mungkin ka- rena tidak bisa kompromi, maka ba- dianggap pintar. Itu semua dilakukan agar temperatur suhu tubuh tidak se- yang lalu, tahun ini kok malah berpindah kelain hati, pertanyaannya ada apa ? apa Sekali lagi kita semakin heran, kok masih mau berpindah kelain hati?, nyak daerah yang tidak mau bekerja- makin tinggi. ada? bukan kah selama ini kita banyak men- sama dengan USU” ( Jhon Tafbu Ri- Hampir sama dengan prinsip eko- Untuk menjawab pertanyaan terse- dengar, salah satu penyebab buruknya tonga, Dekan FE USU, Analisa Senin nomi, kemasan ikut menentukan harga but, sebaiknya kita menyimak komentar kinerja para abdi negara yang terhimpun SBY Tak Perlu Ragu 9 November 2009) “Selama soal masih berada USU,dari mulai pembuatan hingga penggandaan suatu barang, maka pasaran pengobat- an demam juga bergerak tidak menentu hampir sama dengan pergerakan harga yang disampaikan oleh dua tokoh di atas. Pertama, apa yang dikatakan Bang Jhon Tafbu Ritonga,” mungkin karena tidak di Korpri karena proses penerimaanya yang tidak bersih, sehingga muncul anekdot hari pertama kerja sebagai PNS Ganti Kapolri, Jakgung soal, kami menjamin kerahasiaan dan keamanannya tidak sampai bocor. Salah satu hal yang dilakukan demi keraha- saham di Bursa Efek Jakarta, ada yang menawarkan satu pintu, ada yang me- nyuguhkan the full service, dan ada yang bisa kompromi, maka banyak daerah yang tidak mau bekerjasama dengan USU”. yang dipikirkan bukan “optimalisasi pelayanan melainkan optimalisasi pengembalian modal”. B siaan soal, tim perumus dan pembuat menyodorkan materai sebagai bentuk Meskipun maksud “kompromi” Ketiga, dari sekian banyak kabu- erita tiga pimpinan KPK merasa dizalimi kini mulai terungkap soal juga dirahasiakan””USU dipercaya pertanggung jawaban. Akibatnya de- yang disampaikan Bang Jhon hanya dia- paten/ kota yang menerima CPNS ta- kebenarannya. Adanya dugaan atau upaya mengkriminalisasi KPK pun pemerintahan Provinsi Sumatera Utara, mam semakin tinggi, dan bahkan ada lah yang tahu pasti maksudnya, namun hun 2009, hanya lima daerah kabupaten semakin mengental sebagaimana disinyalir Ketua Tim-8 (Pencari Fakta) ditambah lima daerah yakni Kabupaten informasi, demam sudah memakan secara implisit kita dapat menangkap, /kota yakni Deliserdang, Labuhanbatu, Adnan Buyung Nasution kemarin. Deliserdang, Labuhanbatu, Tapanuli korban jiwa. ujian penerimaan CPNS kali sangat sya- Tapanuli Selatan, Humbang Hasundut- Proses penegakan hukum kasus Bibit Samad Rianto dan Chandra Selatan, Humbang Hasundutan,Kota rat dengan permintaan dari daerah an, Kota Tebingtinggi dan ditambah M Hamzah belum selesai, kini terungkap kasus rekayasa terhadap Antasari Azhar Tebingtinggi” ( Sukaria Sinulingga, Pem- Pengobatan Alternatif kabupaten/ kota yang menerima provinsi Sumatera Utara yang memper- selaku tersangka dalang pembunuhan Nasruddin Zulkarnain, atas pengakuanWilliardi bantu Rektor IV USU, Waspada 10 No- Menurut diagnosa para ahli ujian CPNS.akibat permintaan tersebut tidak cayakan penyelenggaraan dari pem- Wizard di persidangan. Polri pun sibuk mengupayakan dalih rekayasa itu. vember 2009) penerimaan CPNS, pemicu cepatnya dapat dipenuhi haruskah secepat itu buatan, pemeriksaan dan perengkingan Hampir tiap tahun masyarakat In- penyebaran virus yang berubah menjadi berpindah ke lain hati. kepada USU, artinya lebih banyak da- Meskipun Polri tetap kukuh dengan keyakinannya ketiga mantan pimpinan itu donesia dihebohkan dengan virus pene- radang dan berakhir dengan demam Dan kalaulah lah kita boleh mene- erah di Sumatera Utara ini yang mem- bersalah, kenyataannya di lapangan masyarakat (publik) semakin curiga dengan rimaan masuk Calon Pegawai Negeri seperti saat sekarang ini. Salah satunya bak-nebak, kira-kira apalah permintaan percayakan penyelenggaraan kepada merebaknya dukungan ke KPK lewat ‘’facebook’’ dan sejalan terbukanya sisi lemah Sipil (CPNS). Tanpa membedakan status adalah perubahan penyelenggara ujian Pemkab/Pemko kepada penyelenggara pihak lain selain USU. tidak profesionalisme Polri dalam melakukan penyidikan kasus Bibit – Chandra dan sosial, lokasi tempat tinggal dan strata masuk CPNS dari Universitas Sumatera ujian masuk CPNS kali ini. Jatah orang Sedikitnya daerah kabupaten /kota Antasari. Aliran dana ke Bibit dan Chandra semakin kabur saja. pendidikan, virus itu begitu cepat mere- Utara (USU) kepada universitas di luar yang diluluskan? kunci jawaban?, yang mempercayakan penyelenggaran Hal yang sama juga terjadi di jajaran Kejaksaan Agung. Jaksa Agung Hendarman bak ke seluruh sendi-sendi kehidupan. USU. muatan soal? atau hal-hal lain yang ujian masuk CPNS kepada USU harus Supandji digugat anggota Komisi-III dan masyarakat atas banyaknya kasus yang Yang anehnya virus ini tidak cepat di- Diagnosa ini setidaknya merujuk dapat mempermudah keinginan satu kita akui sebagai fenomena yang tidak tanggulangi sebagaimana virus-virus kepada kondisi seleksi ujian masuk kelompok karena rata-rata mereka yang baik terhadap dunia pendidikan di memalukan terjadi di jajarannya, di antaranya terlibat dalam kasus penyuapan jaksa CPNS dua tahun belakangan ini. Rata- lainnya, melainkan kehadirannya sudah ingin berpindah ke lain hati adalah Sumatera Utara. Urip dan kemudian kasus Anggoro yang melibatkan sejumlah pejabat tinggi di gedung dinanti. rata daerah yang bekerja sama dengan daerah-daerah yang akan melaksanakan bundar. Itu baru yang ketahuan karena KPK memiliki bukti berupa rekaman percakapan Akibatnya banyak orang yang kena USU cendrung lebih kondusif dan me- pilkada 2010 ?. Penutup mereka. Oleh karena itu, kasus-kasus serupa dipastikan jauh lebih banyak yang tidak radang penerimaan CPNS. Namanya lahirkan hasil yang sangat mengejut- Tebakan manapun yang akan dipilih Semua pihak memiliki alasan untuk terungkap di permukaan. juga radang, begitu mendengar akan kan. Bayangkan ada anak seorang tu- sebagai alasan perpindahan penye- menentukan pilihan kerjasamanya. Te- Hemat kita, sulit bagi Kapolri dan jajarannya untuk membersihkan dirinya dibukanya pendaftaran ujian masuk kang lontong yang lulus, anak penjaga lenggara ujian masuk CPNS hasilnya tapi setidaknya sebelum pilihan itu dari kecaman masyarakat atas kasus ‘’Cicak versus Buaya’’ yang dipopulerkan CPNS maka banyak yang kegatalan, masjid lulus, anak pegawai rendahan sudah dapat ditebak,kekesalan dan krisis ditentukan marilah kita melihat ribuan bersin-bersin dan bentuk-bentuk reaksi diterima, walaupun bukan berarti ti- kepercayaan masyarakat terhadap pe- harapan dari mereka-mereka yang ha- Kabareskrim Irjen Pol Susno Duadji. Walaupun secara institusi hal itu benar dak ada anak pejabat yang lulus, anak lain dari sebuah radang, seperti mengu- nyelenggara pemerintahan di republik nya punya asa dan kemampuan akade- mengingat personil KPK sebagian besar rus kartu kuning ( surat keterangan me- anggota DPRD yang lolos dan anak ini akan semakin tebal dan menyesak- mik yang dimilikinya. Haruskah mereka diambil dari Polri dan jaringan Polri sampai nganggur dari pemerintah) yang akhir- orang kaya yang diterima, namun ke- kan. Bayangkan saja sudah dua bulan kita singkirkan hanya dikarenakan ada Intisari ke seluruh daerah, tetap saja publik menilai nya tidak digunakan sebagai persyarat- lulusannya bukan dikarenakan duit, ini kita disuguhkan dengan permainan pihak, kelompok, family, dan saudara ada upaya mengkriminalisasi KPK oleh pim- an, mengurus KTP meski dengan cara deking apalagi dukun.bahkan tidak kelas atas yang disimbolkan dengan yang juga ingin menggapai mimpi yang pinan Polri. Apalagi kinerja Polri semakin memanipulasi data ( KTP Tembak), me- jarang kita mendengar apresiasi positif cicak vs buaya, haruskah kita lanjutkan sama. Kalaupun itu harus terjadi harus- Kasus Bibit, Chandra, merosot di mata masyarakat, sementara legalisir ijazah yang terkadang sudah yang keluar dari masyarakat, “kalau sepukul ni baru paten”. seri itu dengan episode teri vs tongkol ? kah kita salahkan lantai padahal kita berubah warna akibat terlalu lama di- atau gajah vs semut. yang tak bisa menari, haruskah kita ba- Antasari menjadi pelajar- citra KPK semakin membubung tinggi. Dalam kasus ‘’perampokan’’ yang terjadi simpan. Sebalik itu, daerah-daerah yang Kedua, apa yang disampaikan Suka- kar rumah hanya karena ada tikus yang Kini radang itu sudah menjadi de- tahun itu tidak mempercayakan penye- ria Sinulingga “kami menjamin keraha- mengganggu. an untuk mereformasi di Bank Century misalnya, kalau saja KPK tidak mam. Suhu badan hampir mencapai lenggaraan ujian masuk CPNS-nya ke- siaan dan keamanannya tidak sampai proses penegakan hu- diobok-obok dengan mencuatnya kasus ‘’Cicak versus Buaya’’ kemungkinan sejumlah 40 derjat celcius. Mengingat demam dapat berdampak pada bentuk penya- pada USU dapat kita baca di media- media massa akhirnya berurusan de- bocor. Salah satu hal yang dilakukan demi kerahasiaan soal, tim perumus dan Penulis lulusan S1 IAIN Sumut dan tinggal di Sei Rampah, Serdang Bedagai. kum yang‘’carut-marut’’. petinggi Polri bisa menjadi tersangka sangat terbuka. Sebab, kasus yang merugikan uang negara hingga enam triliunan rupiah itu juga disebut-sebut melibatkan sejumlah pejabat negara, seperti Boediono (kini Wapres) dan Sri Mulyani (Menkeu) meskipun penjelasan pemerintah kebijakan yang diambil Boediono dan Sri Mulyani dalam kaitan penyelamatan Bank Century sudah sesuai dengan ketentuan, di mana jika tidak digelontorkan dana segar dikhawatirkan terjadi Toll Cabinette Oleh Djoko Sugiarno Itu memang fakta. Tetapi yang harus di- koalisinya sudah memegang posisi ‘’rush’’ besar-besaran dalam perbankan nasional. Jadi, terkesan di sini, Polri ingin garisbawahi di sini adalah sang penga- single majority. Dus praktis KIB II ini mengambil alih kasus penyidikan Bank Century sekaligus ‘’mengamankan’’ orang- mat yang sangat jeli melihat celah kecil adalah kabinet bebas hambatan, toll P orang yang diduga terlibat di dalamnya. Dan hal itu semakin terlihat dengan turun ertama, penulis mengucapkan terlihat dari keberanian jajaran Golkar antara TK dan Mega. Dan menduduk- cabinette. Dengan kabinet yang nyaris tangannya Presiden Susilo BambangYudhoyono dalam‘’mengganti’’ sejumlah pimpinan selamat kepada pasangan DR. di DPR yang kerap mengganjal kebijakan kan TK menjadi jurus pamungkas mem- tanpa hambatan ini, SBY akan lebih le- KPK lewat proses Perppu yang kontroversial mengingat masih ada dua pimpinan Susilo BambangYudhoyono dan SBY. Bagusnya, semua ini dipelajari SBY bungkam PDIP . luasa menjalankan program kerjanya KPK yang aktif. Sepertinya ada keberpihakan sehingga situasinya makin ‘’carut marut’. Prof. Boediono atas terpilihnya menjadi dengan seksama, dan dengan kebera- Selesai dengan PDIP SBY masih , membangun Indonesia. Melihat perkembangan kasus Bibit, Chandra, Antasari yang semakin menyesakkan Presiden dan Wapres RI untuk periode nian penuh melakukan terobosan yang berkalkulasi dengan Golkar. Momentum Bagusnya, pemerintahannya kali ini 2009 – 2014. Kedua, juga ucapan selamat secara politik dinilai terlalu berani, yakni Munas menjadi sangat krusial bukan adalah pemerintahan terminal. Di satu rasa keadilan rakyat dan melibatkan dua institusi (Polri dan jakgung), keduanya di kepada seluruh jajaran menteri Kabinet menentukan cawapres non parpol. Be- hanya bagi Golkar, tetapi juga bagi SBY sisi, ini berarti kondisi tanpa hambatan bawah Presiden SBY maka sebaiknya Presiden segera mengambil tindakan tegas, Indonesia Bersatu II, yang baru saja lum lagi nama Boediono yang diisukan dan Demokrat. Pada permainan ini ini akan segera berakhir, sehingga tidak jangan lagi ragu-ragu, dengan mengganti unsur pimpinan Polri dan Jaksa Agung. dilantik. Semoga dengan dilantiknya penganut paham ekonomi neoliberalis- memang tidak terlihat campur tangan memungkinkan terciptanya gurita ke- Jika tidak, ‘’bola liar’’ yang awalnya murni mendukung eksistensi KPK bisa berbelok jajaran KIB II ini, segala program kerja me. Lengkaplah sudah double blind ex- SBY atau Demokrat dalam memenang- kuasaan. Di lain pihak, pelelangan ke- merugikan kinerja pemerintahan. Program 100 hari pemerintahan SBY tidak akan mensejahterakan rakyat Indonesia bisa periment yang dilakukan SBY. kan Aburizal Bakrie.Tetapi, seperti sudah kuasaan lima tahunan akan dimulai dari dapat berjalan normal alias ‘’terseok-seok’’ jika SBY menganggap masalah yang terlaksana sesuai target. Presiden dan Dimulai dari kemenangan pemi- diperhitungkan sebelum Munas, keme- nol kembali. Dan ini memungkinkan bekembang masih dalam tahap wajar. Padal rakyat melihat sebaliknya. Kabinet di sisi eksekutif dan DPR (dan lihan legislatif, di mana Demokrat me- nangan Ical menjadi point penting bagi tatanan toll cabinette buyar lagi. Kalau parpol) di sisi legislatif, memang seha- nang telak, SBY dengan full speed maju SBY dan Demokrat dalam melanjutkan ini yang terjadi, maka rakyat akan kem- Sudah saatnya SBY turun tangan, jangan sampai terlambat, setelah terungkap rusnya bersinergi dalam menjalankan berpasangan dengan Boediono, dan program kerjanya sebagai Kepala Peme- bali memasuki wilayah dominasi parpol. kasus rekayasa tiga pimpinan KPK yang melibatkan jajaran Polri dan Kejakgung. amanat rakyat, agar seluruh 230 juta juga terbukti menang telak. Inilah yang rintahan. Ical adalah katup pengaman Karenanya, jika mengharapkan kondisi Momentum pas buat Presiden untuk membersihkan jajaran aparat penegak hukum rakyat Indonesia bisa hidup aman ten- menjadi dasar sikap SBY yang berani SBY. Dengan kemenangan Ical yang yang tetap kondusif, SBY harus berani dengan menjalankan hak prerogatifnya sehingga kepercayaan masyarakat (rakyat) teram dan damai lahir dan batinnya. mengembalikan sistim presidential memang terkesan loyal kepada peme- merancang pemerintahan selepas dia kembali pulih terhadap sistem hukum di negeri ini. Presiden bersama lembaga wakil Segala gejolak menjelang pemilihan, usai murni dalam menyusun kabinetnya. rintah (SBY) maka jelaslah sudah bahwa lengser 2014 nanti agar tidak kembali rakyat (DPR) harus tanggap atas perkembangan yang terjadi saat ini. Sangat berbahaya sudah. Dan pekerjaan berat harus segera Dari 34 kursi menteri, hanya ada 16 SBY tidak lagi memiliki resistor, peng- diperebutkan parpol. Wajar saja jika jika DPR masih tetap sebagai ‘’stempel’’ pemerintah karena rakyat akan menggunakan dimulai. personal parpol dan sisanya dari ka- halang atau kendala politik dalam men- rakyat yang kelelahan menempuh era Enam belas menteri KIB II berasal langan profesional. Komposisi ini jalankan semua kebijakan dalam pe- reformasi yang berporoskan parpol, caranya sendiri, dan hal itu sudah dibuktikan lewat dukungan sejuta lebih‘’facebookers’’ dari kalangan parpol – PD, PKS, Golkar, sungguh menggambarkan keutuhan merintahannya yang terminal ini. Sean- menghendaki masa kehidupan ten- mendukung KPK dari upaya kriminalisasi pihak-pihak penentang. PKB, PPP dan PAN – dan 18 lainnya, plus keyakinan SBY bahwa dirinya dan De- dainya tidak ada pembatasan maksimal teram dan damai dalam segala ketercu- Kabar baik datang dari Menteri Koordinator bidang Politik, Hukum dan Keamanan 3 pejabat setara menteri, seluruhnya ber- mokrat – untuk saat ini – memang me- dua periode, titik awal semacam ini pas- kupan kebutuhan. Dan itu hanya bisa (Menko Polhukam) Djoko Suyanto yang mengatakan, akan ada reformasi di tubuh asal dari kalangan profesional murni. rupakan tumpuan harapan rakyat. Ini- tilah akan merupakan benih bagi ke- tercipta jika pemerintahannya bulat Kepolisian Republik Indonesia (Polri), sebagai aparat penegak hukum. Namun tidak Komposisi ini menggambarkan ke- lah keuntungan pilpres secara lang- munculan pemerintahan otoriter baru. bersatu loyal kepada negara dan rakyat. terungkap apakah juga dilakukan reposisi di jajaran Kejakgung. Jika dilakukan sekaligus beranian dan ketegasan SBY dalam sung. Keinginan rakyat terbaca lang- Pada simpul demikianlah dulu Golkar Itu hanya bisa tercipta dalam kinerja mengambil sikap memilih sendiri para sung tanpa penghalang parpol, DPR mengawali kekuasan 32 tahunnya. Toll Cabinette. maka kepercayaan rakyat segera pulih. Dan mari kita ambil pelajaran dari kasus ‘’Cicak pembantunya. Hanya enam parpol yang maupun MPR. Sampai di sini, satu- versus Buaya’’ sebagai pembelajaran bagi tegaknya supremasi hukum di masa terakomodir dalam kabinet, tiga parpol satunya gangguan politis datang dari Toll Cabinette Penulis adalah Wakil Sekretaris mendatang.+ big nine lainnya – PDIP Hanura dan , dua parpol besar yang menjadi kuda Seperti sudah diatur, kemenangan KAGAMA Sumut, tinggal di Medan Gerindra – memilih dan menerima kon- hitam, yakni PDIP dan Golkar. PDIP Ical menjadi semacam penguat bagi SBY disi tidak diakomodasi dalam jajaran yang sudah ‘sukses’ menjadi oposisi dalam ‘memarginalkan’ kekuatan bar- Hubungi kami KIB II. Dengan komposisi ini, SBY akan selama lima tahun, telah memben- gaining posisition parpol, sehingga de- lebih aman dan relatif terbebas dari re- tuk lapisan pendukung fanatik tersen- ngan berbagai kalkulasi, maka kursi KANTOR PUSAT Penerbit: PT Penerbitan Harian Waspada cokan parpol seperti di masa lalu. diri dan menjadi gambaran parpol menteri untuk partai politik tidak sampai Jalan Letjen Suprapto/Brigjen Katamso No. 1 Komisaris Utama: Tribuana Said Jalan Bebas Hambatan mandiri yang tidak mengemis kursi menteri. 50 persen. Ke depannya, rakyat akan mudah menilai. Jika ada menteri yang SUDUT BATUAH Medan 20151 Direktur Utama: dr. Hj. Rayati Syafrin, MBA, MM Ketika mengawali kerjanya lima ta- Keteguhan sikap PDIP inilah yang tidak becus kerja, rakyat tinggal melihat Tel: (061) 4150858, Faks Redaksi: (061) 4510025, SIUPP: 065/SK/MENPEN/SIUPP/A.7/198 hun lalu, SBY nampak gamang dan terus membayangi penyusunan kom- itu menteri dari parpol atau profesional. Faks Tata Usaha: (061) 4531010. * Menkopolhukam: Hormati tanggal 25 Februari 1988 terkesan terlalu banyak pertimbangan. posisi KIB II. Entah siapa yang memiliki Kalaupun di tengah jalan ada tragedi proses hukum E-mail Redaksi: Anggota SPS No. 13/1947/02/A/2002 Karenanya, menjalani lima tahun per- pikiran sangat cemerlang, tetapi me- pergantian menteri, dipastikan SBY akan - Walaupun hukum dalam ujian KANTOR PERWAKILAN tamanya, banyak pengamat yang men- motong PDIP di simpul TK adalah trik memasukkan unsur profesional sebagai Percetakan: PT Prakarsa Abadi Press cap SBY sebagai presiden peragu. Saat yang luar biasa jitu. Ternyata Pak Taufik penggantinya. Itulah yang tersirat dari Bumi Warta Jaya * Polemik KPK-Polri jangan Jalan Letjen Suprapto/Brigjen Katamso No. 1 itu, Demokrat memang belum bisa me- sungguh tak mampu menahan diri dari sambutan ketika mengumumkan na- Jalan Kebon Sirih Timur Dalam No. 3 berkepanjangan Medan 20151 ngukur diri, karena kemenangan paket godaan kursi ketua MPR. Dan PDIP ter- ma-nama menterinya. Siapa pun yang Jakarta 10340 Tel: (021) 31922216, Faks: (021) 3140817. Tel: (061) 6612681 SBY – JK saat itu masih rancu, apakah gunting dalam lipatan TK. Dengan du- sudah duduk menjadi menteri harus - Capek dech! Isi di luar tanggung jawab percetakan itu karena SBY-nya, Demokratnya atau duknya TK di kursi ketua MPR, maka loyal kepada pemerintahan dan rakyat, Jalan Ratu Syafiatuddin No. 21 C karena JK dan Golkarnya. Hal yang sama apa pun statement PDIP jadi sangat * Gubsu jamin tak bisa bantu Harga iklan per mm kolom: tidak kepada parpolnya. Garis inilah Banda Aceh 23122 luluskan CPNS BW Rp. 11.000,- terjadi pada JK yang merasa bahwa ke- hambar. Terlihat jelas, bagaimana TK yang menjadi penuntas bagi terkebiri- Tel & Faks: (0651) 22385 - Kayaknya banyak pesanan neh? FC Rp. 30.000,- menangan itu karena oihaknya. Dan tidak bisa dikendalikan oleh Megawati. nya posisi tawar parpol. Sampai di titik Jalan Iskandar Muda No. 65 Lhokseumawe wajar saja jika kemudian JK terkesan Secara keluarga, TK memang suami ini, praktis parpol hanya bisa menjalan- Halaman depan BW Rp. 33.000,- Tel: (0645) 42109 tidak bisa dikendalikan SBY, sering jalan Mega yang sudah sewajarnya menjadi kan fungsi kontrol melalui jalur parle- Halaman depan FC Rp. 90.000,- D oel Jalan Sutami No. 30 Kisaran. Tel: (0623) 41412 Ukuran kolom: 40,5 mm sendiri dan menjadi kekuatan pengim- bang utama bagi SBY. Keyakinan ini kepala keluarga. Tetapi dalam kepar- men saja. Dan jalur ini pun sudah di- Wak taian, TK adalah bawahan Megawati. amankan SBY, karena Demokrat dengan WASPADA Dewan Redaksi: H. Prabudi Said, H. Teruna Jasa Said, H. Azwir Thahir, H. Sofyan Harahap, H. Akmal Ali Zaini, H. Muhammad Joni, Edward Thahir, M. Zeini Zen, Hendra DS. Redaktur Berita: H. Akmal Ali Zaini. Redaktur Kota: Edward Thahir. Redaktur Sumatera Utara: M. Zeini Zen. Redaktur Aceh: Rizaldi Anwar. Redaktur Luar Negeri: H. Muhammad Joni. Redaktur Nusantara & Features: Gito Agus Pramono. Redaktur Opini: H. Sofyan Harahap. Redaktur Ekonomi: Armin Rahmansyah Nasution. Redaktur Olahraga: Johnny Ramadhan Silalahi. Redaktur Minggu/Humas: Hendra DS, Redaktur Agama: H. Syarifuddin Elhayat. Asisten Redaktur: Rudi Faliskan (Berita) Zulkifli Harahap, Muhammad Thariq (Kota Medan), Feirizal Purba (Sumatera Utara), T. Donny Paridi (Aceh), Syafriwani Harahap (Luar Negeri), Setia Budi Siregar (Olahraga), Hj. Hoyriah Siregar (Ekonomi), T. Junaidi (Hiburan), Hj. Erma Sujianti Tarigan (Agama), Hj. Neneng Khairiah Zein (Remaja), Austin Antariksa (Kreasi), Armansyah Thahir (Otomotif), Anum Purba (Wanita), Hj. Ayu Kesumaningtyas (Kesehatan), Denny Adil (Pelangi). Sekretaris Redaksi: Hj. Hartati Zein. Iklan: Hj. Hilda Mulina, Rumondang Siagian (Medan), Lulu (Jakarta). Pemasaran: Andi L. Said (Medan), H. Subagio PN (Sumut), S. Manik (NAD). Wartawan Kota Medan (Umum): H. Erwan Effendi, Muhammad Thariq, Zulkifli Harahap, David Swayana, Amir Syarifuddin, Ismanto Ismail, Rudi Arman, Feirizal Purba, Zulkifli Darwis, H. Abdullah Dadeh, H. Suyono, Ayu Kesumaningtyas, M. Ferdinan Sembiring, M. Edison Ginting, Surya Effendi, Anum Purba, Sahrizal, Sulaiman Hamzah, Sugiarto, Hasanul Hidayat, Aidi Yursal, Rustam Effendi. Wartawan Kota Medan (bidang khusus): H. Syahputra MS, Setia Budi Siregar, Austin Antariksa, Dedi Riono (Olahraga), Muhammad Faisal, Hang Tuah Jasa Said (Foto), Armansyah Thahir (Otomotif), Dedi Sahputra (Penugasan Khusus). Dedek Juliadi, Zulfan Efendi, Tetty Rosiana, Handaya Wirayuga (Koran Masuk Sekolah/KMS). Wartawan Jakarta: Hermanto, H. Ramadhan Usman, Hasriwal AS, Nurhilal, Edi Supardi Emon, Agus Sumariyadi, Dian W, Aji K. Wartawan Sumatera Utara: H. Riswan Rika, Nazelian Tanjung (Binjai), H.M. Husni Siregar, Hotma Darwis Pasaribu (Deli Serdang), Eddi Gultom (Serdang Bedagai), H. Ibnu Kasir, Abdul Hakim (Stabat), Chairil Rusli, Asri Rais (Pangkalan Brandan), Dickson Pelawi (Berastagi), Muhammad Idris, Abdul Khalik (Tebing Tinggi), Mulia Siregar, Edoard Sinaga (Pematang Siantar), Ali Bey, Hasuna Damanik, Balas Sirait (Simalungun), Helmy Hasibuan, Agus Diansyah Hasibuan, Sahril, Iwan Hasibuan (Batubara), H. Abu Bakar Nasution, Nurkarim Nehe, Bustami Chie Pit (Asahan), Rahmad Fansur Siregar (Tanjung Balai), Indra Muheri Simatupang (Aek Kanopan), H. Nazran Nazier, Armansyah Abdi, Neirul Nizam, Budi Surya Hasibuan (Rantau Prapat), Hasanuddin (Kota Pinang) Edison Samosir (Pangururan), Jimmy Sitinjak (Balige), Natar Manalu (Sidikalang), Arlius Tumanggor (Pakpak Bharat)Parlindungan Hutasoit, Marolop Panggabean (Tarutung), Zulfan Nasution, Alam Satriwal Tanjung (Sibolga/Tapanuli Tengah), H. Syarifuddin Nasution, Mohot Lubis, Sukri Falah Harahap, Balyan Kadir Nasution (Padang Sidimpuan), Idaham Butarbutar (Gunung Tua), Iskandar Hasibuan, Munir Lubis (Panyabungan), Bothaniman Jaya Telaumbanua (Gunung Sitoli). Wartawan Aceh: H. Adnan NS, Aldin Nainggolan, Muhammad Zairin, Munawardi Ismail, Zafrullah, T. Mansursyah, T. Ardiansyah (Banda Aceh), Iskandarsyah (Aceh Besar), Maimun (Lhoksukon) Bustami Saleh, M. Jakfar Ahmad, Jamali Sulaiman, Arafat Nur, M. Nasir Age, Fakhrurazi Araly, Zainal Abidin (Lhokseumawe), Muhammad Hanafiah (Kuala Simpang), H. Syahrul Karim, H. Ibnu Sa’dan, Agusni AH, H. Samsuar (Langsa), Amiruddin (Idi), HAR Djuli, Zainuddin Abdullah (Bireuen), Bahtiar Gayo (Takengon), Muhammad Riza, H. Rusli Ismail (Sigli), T. Zakaria Al-Bahri (Sabang), Khairul Boang Manalu (Subulussalam), Rusli Idham (Meulaboh), Jaka Rasyid (Blang Pidie), Zamzamy Surya (Tapak Tuan), Ali Amran, Mahadi Pinem (Kutacane), Bustanuddin , Wintoni (Blangkejeren), Khairul Akhyar (Bener Meriah), Tarmizi Ripan, Mansurdin (Singkil), Rahmad (Sinabang). Semua wartawan Waspada dilengkapi dengan kartu pers. Jangan layani dan segera laporkan ke pihak berwajib atau ke Sekretaris Redaksi bila ada oknum yang mengaku wartawan Waspada tetapi tidak bisa menunjukkan kartu pers yang sah, ditandatangani Pemimpin Redaksi
  • 10. WASPADA Jumat 13 November 2009 Mimbar Jumat 13 NPF KUR BSM Tertinggi Nomor Tiga NON performing financing (NPF) atau non performing loan pakar dan praktisi barangkali hingga (NPL) bank pelaksana Kredit Usaha Rakyat (KUR) mengalami tingkat rasio kredit bermasalah tertinggi. Bank Bukopin kini dua regulasi tersebut belum tentu terbit,”papar M Syakir Sula. Lain lagi, kata Syakir Sula, ketika pemerintah Cicak Dan Buaya dalam data NPL per september terlihat jumlah NPL tertinggi mengesahkanUndang-UndangMigas dengan angka 11, 2 persen, sedangkan Bank Syariah dan UU Investasi, terasa sangat cepat Oleh H. Syarifuddin Elhayat Mandiri (BSM) yang merupakan satu-satunya perbankan sekalidibandingkandengankeduaUU syariah memiliki tingkat NPF sebesar 5, 45 persen. yang menjadi pilar ekonomi syariah. Bahkan begitu bagusnya perkem- Belum lama ini, layar kaca bihannya sekaligus kekurangan,— DengandemikinBSMmerupakan rapat Kemennegkop UKM. pada pemberdayaan ekonomi rak- banganbanksyariahmembuatInggeris dan lembaran berita di Nusan- Buaya Allah ciptakan punya bank pelaksana KUR dengan tingkat Menurut Sri Sulistiowati, bahwa yat,”ujarnya. yakin sistem ekonomi yang tahan ter- tara ini banyak bercerita tentang kekurangan yakni dia terlahir tak ranking NPF nomor tiga setelah BRI program KUR sangat baik guna men- Terkait dengan dukungan peme- hadapkrisiskeuanganglobal,kinisistem Cicak & Buaya,— Kisah itu dire- punya lidah, “kelebihannya” dengan tingkat KUR 6,23 persen untuk dukung program pemerintah dalam rintahpadapengembanganperbankan ekonomi syariah. Inggeris yang meru- liss sebagai amsal (sindiran) keti- mangsa yang dapat ditelan bulat- Ritel dan 7,07 untuk mikro. mengentaskankemiskinandansekaligus syariah di Indonesia, Direktur Utama pakan pusat perkembangan ekonomi ka Komjen Pol Susno Duadji bulat hingga punah tak tersisa.— MeskiterjadipeningkatanKURyang dalam membuka lapangan pekerjaan Bank Syariah Mandiri (BSM),Yuslam dan bisnis di Eropa berambisi ingin yang Kabareskrim Polri beri con- Kelemahan keduanya,-cicak dan tajam,pemerintahmemandangbahwa baru. Hal tersebut sesuai dengan misi Fauzi, menegaskan, perbankan syariah menjadi pusat perkembangan sistem toh “perseteruan” antara KPK de- buaya kalau dah habis bertelur,— NPLKURmasihdalamkewajaran.Agar dari BSM dalam mengembangkan tak butuh insentif macam-macam perbankan syariah di dunia. ngan Aparat kepo-lisian,— “Ci- telur ditinggalkan hingga menetas takterjadipeningkatantersebut,Menteri pemberdayaan pada masyarakat. seperti yang selama ini banyak diminta Senior Representatif UK Trade In- cak,— KPK,-melawan Buaya,- sendiri, pembinaan generasi dise- NegaraKoperasidanUKM,SyarifHasan, Sri Sulistiowati mengungkapkan, oleh perbankan. vestment, Dominic Jermey, mengata- Polri”,— kira-kira begitu yang kita rahkan pada alam,—tak percaya meminta pada bank-bank pelaksana selama ini BSM dalam menyalurkan “Kami hanya meminta sebuah kan,PemerintahInggerisinginmenjadi saksikan di layar kaca.Saya tidak coba berenglah…he-he,—afwan KUR untuk terus membenahi manaje- KUR kepada Usaha Mikro Kecil dan dukungan yang konkrit secara adil pemain utama dalam Islamic Banking akan mau terlalu jauh masuk “ke sohib,—cicak dan buaya bagai men dalam penyaluran KUR. Menengah (UMKM) sebesar Rp375 dalam mendukung perbankan syariah dan berharap bisa bekerjasama de- arena” ungkapan itu, karena me- cerita canda. “Terkaitdenganhaltersebutdalam miliar.Untuktahun2010nantinyaakan ditanah air ini,” kata Yuslam Fauzi. ngan Indonesia. nurut ana, wilayah ambe belum Tapi,kalaulah ana boleh jujur penyaluran KUR kedepan perbankan ditingkatkan sesuai dengan target LebihjauhYuslamFauzimenyoroti Hal itu disampaikan Dominic sampai,—malah jauuuuhh dari bertanya dan hendak melirik dalam akan didampingi oleh tim pendam- pemerintah sebesar Rp20 triliun. kebijakan yang ada selama ini dari Jermey pada pidato pembukaan Indo- kehidupan ini, adakah orang yang bersikap seperti itu semua,—untuk masuk ke pintu para pembesar ping UKM, sehingga pembiayaan “MakauntukmenyalurkandanaKUR pemerintah, belum mampu mem- nesiaIslamicFinancialForumyangdigelar dan penentu negara ini.- Biarlah mereka yang tau Cicak atau Bua-ya,— Antahlah….Ncek sajalah yang bermasalah tersebut tak terus berlan- tersebut perlu dilakukan perubahan- berikankeadilansepertiyangdiberikan KBRI London bekerjasama dengan untuk kemudian kitapun diberi tahu. menja-wabnya.Tapi bagi saya buaya dan cicak sama- jut,”ucap Syarif Hasan perubahan aturan yang menghambat pada perbankan lainya, maka dari itu PerwakilanBankIndonesia,BankMandi- Selainmengupayakansolusidalam pelakuUMKMdalammengaksesdana Tapi dari kedua contoh hewan melata itu,—anapun sama tak ada baiknya,— ditengah perkembangan perbankan ri , BNI 46 serta PT Timah London yang permasalahan KUR, pemerintah terus KUR seperti agunan, sistem informasi melirik-lirik Cicak di langit-langit rumah dan Buaya -Kedua,— memberi gelar, memberi nama bahkan syariahsebagaialternatifekonomidalam diadakan di Hotel Mandarin. melakukan upaya agar KUR bisa terse- debitur(SID)BankIndonesiadandebitur di asam Kumbang (penangkaran buaya Sunggal) untuk mengolok-olok, mengejek- menurut Islam bukanlah mencegahkrisiskeuangan.Sudahsaatnya, Di kesempatan tersebut, Dominic rap dengan cepat di masyarakat dian- lamaapakahbisamengaksesdanaKUR pemerintah berfikir demikian. mengambil hikmah dan filosofi yang ada. Karena Allah perbuatan (fe’el- bahasa melayu lama ) yang dipuji, Jermey,jugamengatakan bahwaregulasi taranya dengan membuka diri pada lagi atau tidak,”ucapnya. Keadilan yang diminta oleh per- juga menyuruh kita melihat hewan yang Allah jadikan,— bahkan jadi ‘pantang larang’ sebutan. Semua kita keuangan di Inggris mendukung per- bank-bank swasta lainya untuk terlibat Permasalahan-permasalahan bankansyariah,kataYuslamFauzitidak “Apakah kamu tidak memperhatikan bagaimana unta manusia ini secara umum Allah panggil dengan kembangankeuangansyariah,dandu- dalam penyaluran KUR. itulah yang disepakati bersama antara terlalu berat, cukup berikanlah kemu- kungantersebutjugadidapatdaribebe- di jadikan,-(QS Al-Ghasiyah 17). panggilan yang baik,— Ya Ayyuhannaas,— Ya Ibadii,— “Semuanya itu tergantung dalam bankpelaksanadanpemerintahdalam dahandalamregulasi mengoperasikan rapa universitas di UK yang membuka Mauizoh Pertama,-Cicak dan buaya dari yang saya Bukankah kita cucu Adam ini dijadikan Allah sebaik- evaluasipenyaluranKURkedepan,”ujar meningkatkan penyerapan KUR. sistem perbankan syariah yang ada program studi bank syariah di Inggris. amati,-sesungguhnya sepuak,-sebangsa dan baik bentuk dan Allah muliakan kita umat manusia Menteri Negara Koperasi dan UKM. Sementara, Mennegkop dan selama ini, itu sudah cukup. Sedangkan Duta Besar Indonesia seketurunan,—meskipun beda yang melahirkan.— ini dari yang lain dengan rezeki yang baik serta Allah BSM juga mendukung peran pe- UKM, Syarifudin Hasan , mengatakan, Sementara,SekretarisJenderalMa- untuk Kerajaan Inggris dan Republik sangkin sepuaknya, cicak bagi saya adalah buaya kecil beri kelebihan manusia itu dari makhluk-makhluk merintah khususnya Kementerian dalam rapat dengan para bank pelak- syarakataEkonomiSyariah(MES),Mu- Irlandia, Yuri Thamrin, mengatakan, dan buaya adalah cicak yang besar.—Kalau sohib Allah lainnya. Negara Koperasi dan UKM dalam sana telah disepakati strategi dalam hammad Syakir Sula, menambahkan, KBRI London antara lain bertugas sepakat yaa itulah dia.— Ingatlah Firman Allah,” Hai orang-orang yang melakukan evaluasi penyaluran Kredit mempermudah penyerapan dana memangterasakurangdukunganpeme- mempromosikan dan meningkatkan Melihat-lihat sebangsanya, selain buaya,— ada beriman, janganlah satu kaum (laki-laki) menghina Usaha Rakyat (KUR) supaya bisa KUR pada masyarakat. Diantaranya rintahpadapengembanganperbankan pengembangan pariwisata dan inves- komodo,-anoa,-ada biawak,-ada bingkarung, ada kadal, laki-laki yang lain, karena boleh jadi yang kamu terserap dimasyarakat. adalahdengankoreksipadasukubunga syariah atau ekonomi syariah. Hal ini tasi di luar negeri. ada bunglon,- ada tokek dan saudara‘bungsunya’ adalah hina itu jauh lebih baik dari kaum yang menghina,— “Jadi acara evaluasi KUR yang me- KUR atau nisbah, serta mengevaluasi nampak terlihat dalam membuat UU MenurutDubes,perbankansyariah cicak. Orang arab menyebut semua itu dengan Daab dan jangan pula perempuan menghina perempuan rupakanpertemuanantarapeme-rintah permasalahan regulasi-regulasi yang Perbankan Syariah dan UU SBSN yang kitapunyapotensidalammengembang- atau Dawaab( hewan melata berkaki yang perutnya yang lain, karena boleh jadi jiga perempuan yang dan6bankpelaksana,sangatbaikuntuk menghambat KUR tersebut. membutuhkanwaktu sangatlamasekali. kankerjasamadenganpengusahaInggris menyentuh bumi). kamu hina itu lebih baik dari pada kamu,- Jangan- kelangsungan program tersebut,”kata “Dengan demikian kami berharap “Jikapemerintahtidakdi“keroyok” yanginginmenyertakanmodalyangingin Cuma saja, kata orang-orang nie,… antara buaya lah kamu mencela (merendahkan) sesama ka- Direktur BSM Sri Sulistiowati di ruang adanya KUR memiliki keterpihakan oleh para aktifis yang terdiri dari para dikelola secara Syariah.(m13) dan cicak punya perbedaan terutama tentang cari mu, dan jangan pula memanggil-manggil sese- makan,- Cicak yang hanya menempel di dinding,— orang dengan gelaran yang tidak baik.—— Ja- kehebatannya dia berjibaku dalam mengintai musuh nganlah kamu mencari-cari aib orang dan jangan Syekh Muh. Nuruddin Marbu Al-Makky kendati dia harus lengket terbalik,— punya lidah pula kamu me-ngumpat yang lain,-sukakah kamu Dzikir, Tausiyah Di Masjid Raya Al-Mashun Medan bercabang panjang, sehingga ketika menerkam memakan daging saudaranya yang sudah mati mangsa,—tepat sasaran tak pernah meleset.- Sedang (perumapaan orang mengumpat saudaranya MALELIS Dzikir Az-Zikra Suma- buaya, meski badannya besar dia mengintai musuh bagaikan memakan bang-kai saudaranya sendiri).— teraUtaraakanmenyelenggarakandzikir dengan libasan ekor,—bukan kepala,—hingga kadang- (QS Al-Hujarat 11 dan 12). Allah-Allaaahh jangan ngejek bersamapadahariMinggu(15/11)pukul kadang sasaran lepas dan lari menghindar. tapi kele- ya Ncek—— Cicak dan Buaya. 7.30WibdiMasjidRayaAl-MashunMedan. Menurut Ketua Majelis Dzikir Az- ZikraSumutH.RizalMahaputra,dalam dzikirbersamayangterbukauntukselu- ruhkaummuslimindanmuslimatjuga akandiisidengantausiyahkeaga-maan Antara Carrefour Dan Pedagang Kaki Lima dengan menghadirkan al-ustadz Al- FadhilAl-WalidSyekhMuhammadNu- ruddin Marbu Abdullah Al-Banjari Al- Oleh Mustafa Kamal Rokan MakkyasalAmuntaiBanjarmasinProvinsi Kalimantan Selatan, alumni Madrasah MEMBACA surat kabar “Medan” pada beberapa baru? Bukankah tindakan ini secara nyata akan Waspada/Anum Saskia ShalutiahMakkahAl-Mukarramahtahun1982,alumniUniversitasAl-AzharCairo minggu terakhir, berita pedagang kaki lima dan menaikkan angka kemiskinan di Kota Medan? Dan Ari Ginanjar Agustian dan Hj Dr Maryam Lubis saat training ESQ di Grand Mesir Fakultas Syariah dengan gelar Lisans (Lc), dan alumni Ma’had Ali Liddirasat Carrefour sungguh menarik untuk dibaca. Mengapa? kita sangat mafhum, pengangguran dan kemiskinan Angkasa belum lama ini. Al-Islamiyah-Zamalik Cairo dengan gelar Master (MA) pada tahun 1990. Sebab terjadi dua fenomena yang sungguh kontras pada gilirannya akan menjalar menjadi penyakit sosial Syekh Nuruddin Al-Makky banyak menggunakan waktunya untuk dalam dunia perdagangan, antara Carrefour dan peda- dan hukum lainnya di tengah masyarakat?. Manusia Perlukan Kebahagiaan Spiritual mengembangkan ilmu pengetahuannyakepada ribuan pelajar dan mahasiswa yang datang dari berbagai penjuru dunia khususnya Asia Tenggara yang ketika gang kaki lima. Sebelum lebih jauh membicarakan Nah, dalam konteks ini bahwa tindakan hukum “kontrasnya” berita itu, sebenarnya tidak ada perbe- bukanlah hanya melihat pada tataran legal-formal, MANUSIA memerlukan kebahagiaan spiritual dalam menikmati hidup itu sedang menuntut ilmu di Universitas Al-Azhar. Tempat yang dikenal ketika daan antara Carrefour dan pedagang kaki lima, sebab, namun hukum juga sangat terkait dengan kondisi gunamendukung adanyakebahagiaanfisikdankebahagiaanemosi.Kebahagiaan itusebagaipusatkegiatanmengajiselepasAsharhinggamenjelangMaghribadalah kedua-nya adalah pedagang yang memasarkan produk sosiologis dan ekonomi masyarakat yang merupakan spiritual adalah pelengkap dalamkehidupan seseorang, dimana ia akan mampu Masjid Al-Fatah yang letaknya tidak seberapa jauh dari kawasan Raba’ah, Nasr bagi konsumen bukan?. Sebagai konsumen, kitapun hasil konsensus. Tanggungjawab negara terhadap memahamibetapaadilnyaAllahdengansegalakekuasaannyadanbisamenjadikan CairoCity. Selaindhabith(kuatingatan)beliaujugasangatluasilmupengetahuannya bebas memilih kemana kaki ingin mengayunkan langkah rakyatnya tentu tak dapat diabaikan begitu saja.Transaksi hidup lebih tenang apalagi dunia sedang dilanda berbagai krisis. Demikian sehingga murid-murid beliau memberi gelar “Al-Azhar al-Tsani” (Al-Azhar dalam rangka memenuhi kebutuhan dan keinginan negara-rakyat (state-society) jelas berdiri pada kesetiaan antara lain disampaikan Ari Ginanjar Agustian Trainer ESQ dalam semi- yangkedua). Sebagaiseorangpenceramahbeliaujugaseorangpenulisyangproduktif hidup. Namun disisi lain, keduanya sangatlah berbeda. dan kesejahteraan. Kewajiban masyarakat menatati nar di Hotel Grand Angkasa belum lama ini. dalam dua bahasa yaitu Arab dan Indonesia sudah sebanyak 70 judul buku. Betapa tidak, jika Carrefour berlokasi luas dan serba negara harus berdiri lurus dengan kewajiban negara Ari Ginanjar menyebutkan, selama ini untuk mencapai aspek kebahagiaan Di antaranya karya beliau adalah Tasaulat Haula Mu’jizat (Hal-hal yang lux,ditambah dengan suasana AC yang sejuk, sebaliknya mensejahterakan masyarakat. Tanpa itu maka transaksi itu bisa dikategorikan secara fisik yakni adanya materi berupa uang, benda- dipersoalkan sekitar mukjizat) Rasul, Nafais Al-Durar wal Hikam (Mutiara- pedagang kaki lima adalah lokasi berpeluh-ria dengan negara dengan rakyat akan menjadi unbalanced. benda kesayangan dan berbagai fasilitas yang dimiliki. Kemudian kebahagiaan mutiara Hikmah), Rasail Muawanah wa Mabahis Qoyyimah (surat-surat penting suasana yang sumpek sekaligus terkadang tak nyaman Menyangkut persoalan penggusuran, apakah emosi, dimana seseorang akan sangat berbahagia ketika dia mendapatkan danpembahasanmasalah),RisalahalMuawanahwalMuzaharahwalMuazazah dan seterusnya. pemerintah telah mempersiapkan kompensasi nilai penghargaan dan pengakuan serta suasana yang kondusif. Ternyata, kata (suratpenolong,pendukungdanpenyokong)bagiorangmukminuntukmenempuh Perbedaan itu semakin terkuak dalam beberapa ekonomis yang diderita masyarakatnya?. Memang Ari Ginanjar, pelengkapnya harus ada, yakni kebahagiaan spiritual dimana jalan akhirat, Al-Ihathah bi Ahammi Masail al-HaidWannifas wal Istihadhah minggu belakangan. Betapa tidak, jika pedagang kali terdapat usaha pemerintah kota untuk menyiapkan manusia yang sudah bahagia dengan materi dan emosi tadi bisa terbentur (Cakupan masalah penting yang berhubungan dengan persoalan haid, nifas dan oleh kondisi tertentu jika mereka tidak mempunyai satu kekuatan spiritual lima harus tergusur-hancur, sebaliknya, Carrefour sejumlah rekolasi yang dapat digunakan para pedagang darahpenyakit), AdabalMushafahah(adabberjabattangan),danlainsebagainya, yang hakiki yakni agama. terus membangun. Pedagang kaki lima harus “rela” sebagai kompensasi penggusuran tersebut, demikian dan setelah dzikir bersama kita akan mendengarkan tausiyah dengan harapan “Bagaimana mendapatkan kebahagiaan spiritual ? Yakni, dengan mendapat ilmu-ilmu agama serta siraman rohani dari beliau. tergusur oleh petugas tramtib, sedangkan Carrefour juga beberapa program lainnya. mengikuti berbagai pendidikan atau pelatihan seperti digalakkan saat Apa dan bagaimana isi tausiyah nanti, dihimbau kepada seluruh kaum justru menambah lahan “jualannnya” dengan Namun, sudahkah memenuhi rasa keadilan? ini, yakni belajar ESQ, dimana seseorang bisa memahami kemana arah muslimin dan muslimat diundang datang beramai-ramai untuk dzikir bersama membuka cabang baru yang dibentangkan karpet Penulis belum melihat usaha yang serius pemerintah hidup dan mau kemana manusia setelah hidup. Program ini mendapat sekaligus mendengar tausiyah keagamaan, ucap H. Rizal Mahaputra, seraya merah oleh negara. untuk melakukan pemberdayaan ekonomi masyarakat sambutan dari masyarakat yang ingin mendapatkan kebahagiaan spiritual menambah dua kali sebulan kita bersama-sama berzdikir untuk lebih Seperti kita lihat secara langsung ataupun dari lewat penciptaan lapangan pekerjaan dan pola usaha bahkan alumninya sudah 750 ribu orang. mempertebal ukhuwah islamiyah. media masa, penggusuran pedagang kaki lima di lainnya. Pola kompensasi yang dilakukan masih bersifat Tujuannya tak lain agar manusia bisa memahami hidup dan mau kemana Acara dzikir dipimpin langsung Ketua Az-Zikra Sumut H. Rizal Mahaputra, beberapa ruas jalan kota Medan dan sekitarnya menjadi sepihak dan tidak berdasarkan kajian sosial-ekonomi setelah hidup, harus ada tujuan sehinga tidak frustasi jika ada masalah,” diawali sholatTasbih dilanjutkan pembacaan ayat suci Al-Quran qori/hafiz Saleh sebuah fenomena pada beberapa minggu terakhir. yang mendalam. Dengan kata lain, kebijakan kompensasi ujarnya sembari menambahkan dengan ESQ ini manusia bisa mengelola Daulay. Setelah dzikir dengan doa oleh H.M. Saleh Daulay, SHI, kemudian kembali Dari mulai penggusuran pedagang kaki lima di pasar yang dilakukan bukan berdasarkan kajian yang kom- kemampuan nuraninya secara cerdas dan menempatkan ilmu yang dimiliki mendengarkan tausiyah dari ustadz Syekh Nuruddin Al-Makky. (rel) Sukarame hingga “pasar monza” dan ikan di daerah prehensif yang berbasis kebutuhan ekonomi kerakyatan. sesuai dengan peruntukannya. jalan Pancing dan sekitarnya. Para pedagang harus Secara umum, kondisi ini dapat kita lihat dari Sedang Ketua Forum Komunikasi Alumni ESQ Hj Dr Maryam Lubis men- Ketum DPP FPU-SU Ahmad Yani bin H. Abdul Hamid “gigit jari” dan “mengelus dada” ketika Buldozer kebijakan pemerintah pusat hingga daerah. Kebijakan- yebutkan kegiatan ini diikuti ratusan peserta bukan saja dari Medan tetapi dari menerjang sekaligus meratakan tempat berjualan kebijakan ekonomi pemerintah masih dalam tataran Lombok dan Aceh.Ditambahkan kegiatan ini mendapat sambutan positif dari Transparan Membuka Rahasia Ilahi dengan tanah, tempat mencari nafkah untuk kehidupan keluarga selama ini. Di sisi lain, Carrefour yang meru- permukaan dan simbolis jika tidak ingin disebut politis. Lihat saja pemberian Bantuan Langsung Tunai berbagai lapisan masyarakat. Seperti yang pernah disampaikan Rasulullah, jika kamu tahu akan meninggal esok hari tanamlah sebatang kurma karena ia bisa Awaluddin Marifatullah: Awal-awal pakan pedagang ritel kelas dunia itu menambah lahan (BLT), KUR dan lainnya yang belum menyentuh memberi kemaslahatan bagi orang yang kamu tinggalkan. mengenalagamaAllah(TuhanYangMaha baru di jalan Jamin Ginting Medan. Jika pedagang jantung ekonomi rakyat. Demikian juga “ulah” bank Dalam kegiatan ini, motivasi untuk menjadi orang yang jujur, ber- Esa). Pada dasarnya manusia itu terdiri kaki lima harus “mati”, Carrefour “bertambah hidup”. termasuk bank BUMN yang masih “doyan” ber- tanggungjawab,disiplin, peduli,adil dan menjadi visioner yakni kebaikan dari empat anasir atau unsur. Air, api, Tentunya, fenomena ini dapat dilihat dalam main di pasar uang ketimbang di pasar rakyat, diri kita akan berimbas kepada orang lain dan bukan hanya kita yang angin, tanah. Syariat, hakekat, tarikat, berbagai persfektif, apakah hukum, ekonomi dan sehingga fungsi intermediasi perbankan tak berja- menikmati. Demikian Dr Hj Maryam Lubis.(m36) Ma’rifat. Diri yang berdiri yaitu (tubuh), juga sosiologis, terserah dari sudut mana kita melihatnya. lan seperti yang diharapkan. diri yang terjadi (hati), diri yang terperih Dari persfektif hukum formal misalnya, bahwa peng- Khusus bagi Kota Medan, belum terlihat kebijakan Kloter 2 Medan Tiba Di Makkah (nyawa) diri yang sebenar-benarnya diri gusuran yang dilakukan adalah legal selama prosedur ekonomi yang menyentuh kebutuhan rakyat kecil rahasia Ilahi, akan kita buka di sini. Al- hukum telah dilakukan secara baik, apakah menyangkut baik pada sektor formal maupun informal. Justru Pembenahan Masjidil Haram lah jauh tidak berantara dekat tak tersen- tuh, dimana hadapmu di situ Tuhanmu, sosialisasi peraturan tata ruang kota dan juga sosialisasi eksekusi penggusuran. Tata ruang kota Medan menjadi kesan sebaliknya yang lebih menonjol adalah kebijakan memberikan “karpet merah” kepada pengusaha- Belum Rampung Allah lebih dekat dari urat leher. Untuk mencapai ke tingkat mengenal Allah, kita terlihat asri dan bersih. Betapa mata kita akan dapat melihat kota ini terasa lebih tertib dan lapang tanpa pengusaha luar dan kelas “kakap” untuk mengisi ruang- ruang kosong kota ini. Lihat saja berebagai pusat SETELAH delapan hari berada di Madinah untuk mengerjakan shalat harus mengenal dahulu diri kita sendiri pemandangan pedagang kaki lima yang selama ini perbelanjaan super mewah yang jauh dari “urusan Ahmad Yani bin H. Abdul Hamid (siapa kita) kaji dirimu dari ujung kaki berjamaah sebanyak 40 waktu berturut-turut (shalat arbain) hari Senin “menyemak” di sekitar trotoar jalan. tata kota”, dari mulai pendirian plaza-plaza mewah sampai kepala. Sudah engkau kenal dirimu rata-rata, baru kau kenal Tuhan Tak hanya itu, hak berjalan di jalan lalu lintas juga yang harus menghimpit bangunan rumah ibadah pukul 8.30 pagi waktu setempat kloter 2 Medan meninggalkan Madinah yang nyata. Tuhan yang maha Esa, Keesaan Allah, tidak beranak dan tidak Al Munawwarah menuju Makkah. sering diserobot oleh pedagang kaki lima sehingga (masjid) dan kantor kota, hingga pemberian izin diperanakkan, sehubungan dengan zat dan sifat Allah. Sebelumnya para jamaah mengerjakan umrah di Bir Ali. Demikian Kembali lagi ke masalah kaji diri. Diri yang terjadi adalah hati tidak berbunyi kemacetan menjadi tak terhindarkan. Memang tak bangunan hotel yang menjulang tinggi di angkasa laporan H Hamdan Yazid dari kota Makkah Al Mukarramah yang membawa dan tidak bersuara, untuk merasainya mari kita sejenak mendengarkannya, yang terbayangkan misalnya anda lewat di jalan Arif Rahman raya yang merusak arus-lintas penerbangan. rombongan jemaah haji kloter 2 Medan kepada Waspada, Senin (9/11). dimaksud dengan tidak bersuara tadi. Sambil menyelam ke dasar hati yang paling Hakim tepatnya di Pasar Sukaramai yang selalu padat Berkaca dari fakta-fakta di atas jelaslah terlihat Di Masjid Bir Ali para jamaah sangat merasa terbantu sekali dengan dalam. Selama ini tanpa disadari oleh manusia itu sendiri. Hatinya itu sendirilah dengan orang yang berjualan, kini terasa “sedikit” bahwa kebjakan penggusuran dan pemberian izin ditempatkannya petugas yang membantu mengarahkan jamaah kembali yang berkata-kata, menyebut-nyebut Asma Allah, Allah hu Allah, berkumandang lapang dan membuat kita tersenyum ketika melintas. bagi pedagang bukanlah berdasarkan peraturan tata ke bus masing-masing, kata Hamdan. sepanjang hayat di kandung badan, terus menerus. Demikian juga “semaknya” jalan Pancing yang selama ruang kota dan aturan lainnya, namun lebih kepada “Banyak para jamaah di sini yang tidak tau dimana parkir bus yang Beruntunglah orang-orang yang sudah mengenal dirinya sendiri. Dia bisa ini menutupi bangunan Kantor Gubernur nan indah kepentingan pengambil kebijakan semata. Dalam ditumpanginya. Di sini memang sangat diperlukan sekali tanda dan arahan mendapatkandalamkeseharianhidupnya,bukanhanyasekadarmampumelihat itu, kini gedung besar itu tampak luas terlihat. Sampai posisi ini, kepentingan (interest)menjadi determinan dari petugas yang ada di lapangan,” kata Hamdan serta menambahkan dan memandang sampai datang kepadanya tingkat menilik (keker yang paling disini penulis ingin tegaskan bahwa secara peraturan terhadap hukum, peraturan akan “mengikut” dengan yang membuat jamaah kloter 2 merasa terbantu karena adanya salah dahsyat). Melihat denganNya, merasa dan merasaiNya. Menyatulah antara Dzat tindakan ini adalah tepat dan patut diacungi jempol, kepentingan sang pengambil kebijakan. seorang petugas di Masjid Bir Ali tersebut berasal dari Medan. dan sifat maka sampailah ke tingkat fana karena menyatu denganNya. asalkan sesuai dengan prosedur hukum dan “adatnya.” Sampai disini, semakin teguhlah bahwa ekonomi Hamdan Yasid dalam laporannya mengatakan pemondokan kloter Pada hakekatnya manusia itu adalah bangkai berjalan. Orang-orang berzikir Demikian juga dengan bertambahnya “gerai baru” kerakyatan yang dielu-elukan masih sebatas jargon 2 yang teletak di Jumaizah sebelah Madrasah Abdullah Bin Zubain sekitar hidup di sisi Allah. Orang yang tidak berzikir mati di sisi Allah. Hakekat berzikir Carrefour yang merupakan pedagang ritel kelas dunia. semata. Kemandirian melalui slogan mencintai 2 Km dari Masjidil Haram dan jamaah dapat berjalan kaki menuju Masjidil yang tidak berkeputusan, yaitu berkata-kata dengan sendirinya Allah hu Allah. Saat ini, Carrefour memilki 75 gerai di seluruh In- produk dalam negeri hanya sebatas wacana belaka. Haram lurus melewati Ma’la, Masjid Jin dan Masjid Kucing. Walaupun kita sering melupakanNya hati itu sendirilah yang berkata-kata donesia, dan diantaranya ada di Kota Medan, yakni Sebaliknya, ekonomi liberalis semakin kokoh Rumah yang disediakan untuk jamaah sudah memadai sekalipun bukan Allah hu Allah dengan sendirinya. Subhanallah Maha Suci Allah. Kita semua pasti merasainya, tidak satupun manusia bisa membohongi diri sendiri. Karena Carrefour Medan Fair Gatot Subroto dan yang baru menancapkan tajinya melalui perusahaan raksasanya bangunan baru tapi jamaah merasa puas dengan jarak antara masjid di Jalan Jamin Ginting. Jika seluruh syarat peraturan yang berdiri di negeri ini. hati adalah cermin tempatNya bersemayam Asma Allah, kataku katakanlah dan maktab (pemondokan) masih dapat ditempuh dengan berjalan kaki. Allahu hu Allah. Naik dan turunnya satu itulah nafas DzatNya Allah. Tidak perundang-undangan telah lolos, tempat itu menjadi Fenemena ini sungguh menyesakkan dada kita Masjidil Haram dengan kondisinya yang terus dibenahi untuk menyambut mampu mata kepala melihatnya, apalagi memandangnya. tempat baru untuk berbelanja. semua. Karenanya, revolusi kesadaran pengambil jutaan jamaah calon haji masih terlihat belum rampung. Tempat Sa’i yang Terkadang kita heran melihat mengapa manusia banyak yang me- Antara Ekonomi Rakyat dan Liberalisme kebijakan serta revolusi kebijakan dan instrumen diperluas sudah dapat dipergunakan dengan maksimal. nyombongkan dirinya. Padahal kehebatan dirinya, masih adanya naik turun Namun,disebalik penggusuran yang berdasarkan yang berada dibawahnya menjadi wajib hukumnya Saat jamaah kloter 2 Medan melakukan Thawaf dan Sa’i untuk menyem- nafasnya, jika nafas sudah tidak ada lagi di kandung badan. Hilanglah semua “kebenaran peraturan” yang di klaim di atas, tidakkah dilakukan. Tanpa itu, semakin terasa jauh antara purnakan rukun umrahnya dapat dikerjakan dengan baik karena Masjidil kehebatan dirinya. Air pulang ke air, api pulang ke api, angin pulang ke angin. kita berfikir tentang nasib anak-istri dan orang yang Carefour dan pedagang kaki lima, antara kekuatan Haram masih sepi, jelas Hamdan. Tanah balik ke tanah.Diri yang sebenar-benarnya diri pulang dengan sendirinya dihidupi pedagang kaki lima yang selama ini menyan- korporasi dengan rakyat jelata. Wallahua’lam. Hal ini lanjut Hamdan terbukti dari komentar para jamaah rombongan itulah yang merasakan betapa sakitnya dan nikmatnya di alam kubur. Tubuh darkan hidupnya dengan berjualan di atas trotoar ● Penulis adalah: Dosen Fak. Syariah IAIN-SU 3 dan 4 yang mengatakan “Alhamdulillah” tidak ada kesulitan dalam sudah kaku tidak dapat merasa apa-apa lagi. Bagi yang ingin berkonsultasi itu. Bukankah ini bagian dari penciptaan pengangguran dan Sekolah Tinggi Ilmu Hukum (STIH) Graha Kirana. menyelesaikan Thawaf dan Sa’i Umroh. (m29) hubungi HP 08126306400 . (rel/m21). .
  • 11. 14 Mimbar Jumat WASPADA Jumat 13 November 2009 Beberapa Catatan Penting Tentang Qurban S alah satu ibadah yang sangat dan mempersiapkan daging itu layak Oleh Azhari Akmal Tarigan dianjurkan pada bulan zulhijjah adalah menyembelih hewan qurban. Bahkan di dalam satu riwayat untuk dibagi. Oleh karena itu, panitia berhak mendapatkan honorarium di Cara Nabi SAW Berhaji luardaribiayahewankorbanitusendiri. Imam At-Turmuzi, Rasul yang mulai kurban satu bagian (1 ekor kambing) Ini untuk mencegah adanya penjualan Ada baiknya kita mengetahui pernah bersabda, tidak ada amal anak itucukupuntuksatukeluarga.Tegasnya, kulitatauunsure-unsurhewanqurban. cara Nabi Muhammad SAW berhaji. Adam yang paling disukai Allah pada jika sebuah keluarga berkurban hanya Etika Penyembelihan Nabi SAW dan rombongan setelah hari Nahar melainkan menumpahkan mampu satu ekor kambing itu sama Sebaiknya orang yang berkorban darah(menyembelihqurban). Didalam artinyaseluruhkeluargatelahberkorban. harusmenyembelihhewankurbannya menempuh perjalanan jauh Madi- riwayatyanglain,Rasulpernahmenga- Adalah sangat tidak tepat jika ada yang sendirijikaiamemilikikemampuandan nah – Makkah, sampailah mereka takan, siapa yang memiliki kelapangan membuat ibadah kurban itu secara keahlian.Jikatidak,iabolehmengupah- ke Kabah. Pada waktu itu, sebelum (al-sa’ah) namun ia tidak berkurban, bergantian,antarasuami,istridananak- kannyakepadaoranglain.Yangagaknya maka janganlah ia mendekatai tempat anak. sering diabaikan adalah, orang yang memulai tawaf, Rasulullah SAW shalatkami.Artinya,Rasultelahmenge- Beberapa riwayat menunjukkan berkorban sering tidak perduli dengan memegang dan mencium Hajar luarkanorangyangpelititudarikelompok bahwapadamasarasuladasahabatyang hewankurbannya.Untukitu,Rasulper- Aswad. Kemudian Rasulullah SAW atau komunitas umat Islam.Tegasnya, Batas minimal hanyamenyembelihsatuekorkambing nah mengingatkan anaknya Fatimah, sanksimoralorangyangtidakberqurban Udhuhiyyahdidalamfikihdimaknai untukdirinyadankeluarganya.Bahkan untuk berdiri dan menyaksikan hewan jalan cepat (raml) pada tiga putaran padahal ia memiliki kemampuan sebagainamabagisebuahproses(kegia- Rasulullah ketika berkorban dengan kurbanyangakandisembelih.Sebabnya pertama dan setelahnya berjalan sebenarnya cukup keras. Keluar dari tan) penyembelihan terhadap onta, memotong satu ekor kibas sembari adalah,darahyangmemunceratperta- biasa (masyi). kumunitas ummat Islam. lembu dan kambing pada hari nahar mengatakan,BismillahiWaAllahAkbar, makaliakanmemohonkanampunke- Kendatidemikian,hukummenyem- dan hari tasyrik semata-mata untuk Ya Tuhanku, ini sembelihan ku dan pada Allah, agar orang yang berkorban Sehabis pengerjakan tawaf se- belih qurban adalah sunnah mu’akkad mendekatkan diri kepada Allah. Dari sembelihan orang-orang yang tak diampuni dosanya. lanjutnya Rasulullah SAW pergi ke (sunahyangsangatdianjurkan-dikuatkan). defenisi tersebut tidak ada penjelasan mampu menyembelih dari umatku. Lebihdariitu,pentingnyamenyaksi- makam Ibrahim serta membaca surat Saya menyebut sunnah mu’akkad ini tentangbatasmaksimalpenyembelihan Jelas semangat kebersamaan sangat kanhewankurbanituadalahagarorang satutingkatdibawahwajib.Dalamkon- hewanqurban.Artinya,orangyangmam- tegas dalam kurbannya Rasul. yang berkorban itu dapat menghayati Al-Baqarah ayat 125. Setelah mem- teks ibadah qurban, sebenarnya status pubolehsajamenyembelihbuatdirinya Perlu ditegaskan adalah, satu ekor makna penyembelihan itu sendiri. Se- baca ayat Al-Quran tersebut, Rasu- hukumtidakterlalupenting.Tekanannya sendiri lebih dari 1 ekor lembu atau 2 kambing atau satu ekor lembu untuk sungguhnya yang disembelih itu bu- lullah SAW melaksanakan shalat su- lebihpadadimensimoraldalambentuk ekor kambing dan seterusnya. Sebuah 7orangadalahbatasminimaluntukdapat kanlah hewan, melainkan sifat-sifat kesiapan setiap orang untuk membuk- keluarga yang terdiri dari lima orang disebutkorban.Selainitu,jikaadaorang kebinatangan yang mungkin berse- nat dua rakaat di antara makam Ibrahim dan Kabah. Pada rakaat pertama Rasulullah SAW tikan cintanya kepada Allah dibanding angggota, dapat saja menyembelih 5 yang menyembelih 50 ekor ayam atau mayamdidalamdirikita.Penyembelihan membaca surat Al-Kafirun dan pada rakaat kedua Rasulullah membaca surat Al-Ikhlas. dengan apapun yang ia miliki di muka ekorlembuatau10ekorkambing.Tentu bebek, maka perbuatan itu tidak dapat adalah simbolisasi dari pembersihan diri dari sifat-sifat tamak, rakus dan Sesudah salam Rasulullah SAW kembali lagi ke rukun Hajar Aswad dan mengusap bumiini.Disampingitudimensimoral sajalebihbanyakiaberkurbanyangdida- dimasukkan ke dalam kategori kurban yang tidak kalah pentingnya adalah sari oleh takwa tentulah semakin baik. padaharinahar(iduladha).Kendatipun serakah.Orangyangberkorbandengan serta menciumnya, lalu Rasulullah SAW ke luar dan menuju Bukit Shafa untuk Sai. Begitu kesiapan untuk berbagi dengan orang Jika batasan maksimal tidak ada, secarasubstansimaknanyasama.Namun 3ekorlembusakaligusmisalnya,namun sudah mendekati Bukit Shafa, Rasulullah SAW membaca surat Al-Baqarah ayat 158. lain. Jika dua hal ini disadari, dorongan syari’at memberi batasan minimal. Ba- dari sisi fikih tidak dibenarkan. ia tidak mampu menghayati dan menginternalisasi makna sembelihan Selanjutnya, Rasulullah SAW memulai Sai dari Bukit Shafa yang dari ketinggiannya hukum menjadi tidak relevan lagi. tasanminimalpentinguntukmemberi Pembagian Daging Adalah menarik dianalisis bahwa batas antara apa yang disebut qurban Disunnahkan bagi orang yang ber- itu, maka korbannya menjadi tidak dapat melihat Kabah dan menghadap Kiblat lalu Rasulullah bertakbir tiga kali dan di dalam kitab-kitab fikih kata qurban padaharinahardenganapayangdisebut kurbanuntukmemakanhewanqurban- bermakna sama sekali. Di dalam Al- membaca doa: ’’Laa ilaaha illallah wahdahulaa syarikalah, lahulmulku walahul hamdu atau qorban tidak dikenal. Fikih hanya sadakah biasa. Disebut qurban (udhu- nya,menghadiahkannyakepadakerabat Qur’an, Allahberfirman,tidaklahsampai menyebut kata al-udhuhiyyah yang kepada Allah baik itu daging atau wahuwa alaa kulli syai-in qadiir.’’ [HM Iwan Gayo, Buku Pintar Haji & Umrah, penerbit hiyyah)ituadalahminimalmenyembelih dan mensedekahkannya kepada fakir bermakna sembelihan. Di duga kuat, 1 ekor kambing. Jika yang disembelih danmiskin.Sedangkanmenurutulama darahnya. Melainkan yang dipandang Pustaka Warga Negara, 1999, Jakarta Timur]. kata qurban dipakai karena esensi dari itulembu,bolehuntuk7orang.Sekalilagi yang paling afdhal pola pembagiannya Allah adalah ketakwaan yang menjadi ibadahpenyembelihantersebutadalah iniminimalbukanbatasyangketattentang adalah, 1/3 dimakan oleh orang yang motivasi qurban itu sendiri. Selanjutnya,adalahdipandangetis untukmendekatkandiri(qaraba-qarib) kepada Allah swt. Di Indonesia kata udhuhiyyahtidakpopular.Katakurban dipakai mungkin hanya pertimbangan kuantiti hewan qurban. Di dalam Fiqh Al-Sunnahpersoalaninidibahasdalam bab,jawaz al-musyarakah fi al-udhu- hiyyah(bolehberkongsidalampenyem- berkurban,1/3disimpandan1/3lainnya disedekahkan.Pentingdicatat,keboleh disimpan bukanlah untuk dinikmati sendiri.Sebagiandagingtersebutboleh ketika darah telah ditumpahkan, orang yang berkorban berikrar kepada Allah, inna salati wa nusuki wa mahyaya Kurban, Hukum Dan Maknanya peraktis saja. Artinya, kata qurban lebih belihanuntuksatuekorlembu7orang). disimpan beberapa hari (selama hari wa mamati lillahi rabb al-‘alamin (sesungguhnyashalatku,pengorbananku, “Ceritakanlah kepada mereka kisah kedua putra Adam (Habil dan Qabil) mudah dipahami baik dari sisi syari’at Adalah tidak tepat jika orang yang me- tasyrik)agarkitadapatmemberimakan menurut yang sebenarnya, ketika keduanya mempersembahkan kurban, ataupun esensinya. Disebut qurban milikihartaberlebih,laluberkorbanha- kepada orang lain, terlebih anak yatim, hidup dan matiku hanya untuk Allah Tuhansemestaalam).Dengandemikian, maka diterima dari salah seorang dari mereka berdua (yaitu korbanya Habil) artinya menyembelih hewan qurban nyamengambilbatasminimalnyasaja. fakirdanmiskin.Sesungguhnya,didalam untuk mendekatkan diri kepada Allah. Ibadahqurbaninihukumnya(dari perayaaniduladha,Rasulmenganjurkan berkorbanbukansekedarmenyerahkan dan tidak diterima dari yang lain (Qabil)....” Maidah ayat 27. Artikel ini akan mengkaji beberapa sisibeban)sunnah‘ainatausunnahkifayah. kepadakitauntukbanyakmenyiapkan hewankurbanlalukitatidakperdulisama sekali. Akan tetapi jika ada factor-faktor hal yang sering terlupakan, setidaknya olehsebagianorang.Pertama,berkaitan SayyidSabiqmenjelaskanhalinidalam babKifayah adhiyah wahidah ;an al- makanandanminumanyanglezatcita rasanya.Rasulbersabda,“sesungguhnya yang menghalangi kita untuk menyak- Oleh Fachrurrozy Pulungan dengan batas minimal sembelihan baiti al-wahid (dipandang cukup hari idul adha dan hari tasyrik adalah sikanprosesipenyembelihanitu,maka (qurban).Kedua,Modelpembagiahewan penyembelihan satu hewan (bagian) hariuntukmakan,minumdanberzikir dibolehkan untuk tidak menghadiri prosesipenyembelihanhewankurban. mushallana”/barangsiapa memiliki K qurban.Ketiga, etika penyembelihan. untuk satu rumah. Beberapa riwayat (bertakbir).Agaknyainilahyangmenjadi ata kurban dalam kamus Mengingat terbatasnya kolom ini, pen- yang menjelaskan topik ini menyim- sebab mengapa pada bulan Zul Hijjah ● Penulis adalah Kordinator Tim bahasa Indonesia diartikan kemampuan, lalu ia tidak berkurban, jelasanterhadapketigatopicdiatassangat pulkanbahwahukumnyasunnahkifayah. kitadiharamkanberpuasaselama4hari. Penulis Tafsir Al-Qur’an karya ulama sebagai‘persembahan kepa- maka janganlah ia mendekati tempat singkat dan sederhana. Artinya,dalambatasyangpalingminimal, Panitia hanya bertugas memotong tiga serangkai. da Tuhan: sapi atau beri-beri disem- shalat kami . H.R. Ahmad dan Ibnu belih pada hari raya haji’. Dalam Islam Majah dari Abi Hurairah ra. Pada hadis kata kurban berasal dari kata ‘qurb’ lain, Rasulullah SAW bersabda,“Tidak Ulama Bukan Politikus yang berarti dekat (kepada Tuhan). Kemudian kata tersebut mendapat imbuhan‘an’ menjadi‘qurbaaan’ yang ada satu perak yang paling utama untuk diinfakkan, melainkan mem- beli binatang kurban pada hari ‘Idh (hari Raya Adha)”. HR. Daruquthni (Refleksi Menyongsong Musda MUI Kabupaten Serdang Bedagai) bermakna‘kedekatanyangsempurna’ (kepadaTuhan). Dalam al Qur’an kata dari Ibnu Abbas ra. ‘qurbaaan’dapatdijumpaidalamsurah Makna Berkurban U lama merupakan salah satu pilarpentinguntukmewujud- kan masyarakat rabbani. Ketauladanannyasebagaipewarispara Oleh Sugeng Wanto, MA tanpaalasanyangbenardaritanda-tanda kekuasaan-Ku.Merekajikamelihattiap- tiapayat-Ku,merekatidakberimankepa- danya.Danjikamerekamelihatjalanyang Ali Imran ayat 183, surah Al Maidah ayat 27, surah Al Ahqaf ayat 28. Sejarah menginformasikan kepa- da kita bahwa kurban sudah dikenal Sejarah mencatat, bahwa pen- duduk Mesir dulunya mempersem- bahkan gadis cantik sebagai kurban untukdewasungaiNil.DiMexico,yang nabi (waratsatul anbiya’) sangat dibu- takut dan kagum kepada Allah, yang membawa kepada petunjuk, mereka tuhkan di tengah-tengah umat sebagai padagilirannyamendorongyangberilmu tidak mau menempuhnya, tetapi jika oleh manusia melalui putra-putra Adam pertama, Habil menyembah dewa matahari, mempersembahkan jantung motivatoruntukmeningkatkankualitas untuk mengamalkan ilmunya serta merekamelihatjalankesesatan,mereka dan Kabil. Q.S.Al Maidah. A. 27. dan darah manusia. Persembahan itu dilakukan karena moralspiritual.Seyogyanyaulamamem- memanfaatkannyauntukkepentingan terusmenempuhnya.Yangdemikianitu Manusia pada mulanya dekat kepada Allah. Hal ini mereka meyakini dewa matahari terus menerus berperang berikankontribusibesarbagiterwujud- makhluk.Allahswt.Berfirman:“Sesung- adalahkarenamerekamendustakanayat- bisa dipahami secara tersirat dari firman Nya yang ditujukan dengandewakegelapan.Dandemikesinambungancahaya nyakhairuummah(sebaik-baikumat), guhnya yang takut dan kagum kepada ayatKamidanmerekaselalulalaidaripa- kepada Nabi Adam as sebagai manusia pertama yang dan kesinambungan hidup, maka dewa harus dibantu khususnyadidaerahnyamasing-masing. Allahdarihamba-hamba-Nyahanyalah danya.(QS.Al-A (7):146)Kedua,ulama ’raf diciptakan, “Wahai Adam, bertempat tinggallah kamu dengan darah dan jantung manusia. Namun,masihmenjadipersoalansiapa ulama” (QS.Fathir(35):27-28).Rasulullah . yang hanya menjadi stempel penguasa dalam surga bersama istrimu, serta makanlah buah-buah- Orang-orang Viking, bangsa pelaut yang mendiami yang layak disebut sebagai ulama?. Saw. Bersabda: “Ulama adalah pewaris (salathin)ataupolitikus(mengakuulama an dimana saja yang kamu sukai, dan jangan kamu Skandinavia, menyembah Dewa Odin/dewa perang. Pertanyaan ini muncul seiring ba- para Nabi (Waratsatul Anbiya’)”. Hadits tapihanyauntukmenyahutihasratpoli- dekati pohon ini yang menyebabkan kamu berdua ter- Orang-orangViking memepersembahkan manusia dan nyaknya yang mengaku sebagai ulama ini menjelaskan akan pentingnya ulama tiknyadankepentinganpribadi/kelom- masuk orang-orang yang dzalim ”. Q.S. al A’raf A. 19. menggantungnya disebuah pohon suci dan menembus dan menggunakan simbol keulamaan dalam meneruskan misi kenabian poknya).AnasbinMalikra.Menuturkan Akan tetapi Adam dan Hawa tertipu oleh setan yang meng- jantungnya dengan tombak untuk mengalirkan darah demimenyalurkansyahwatpolitiknya. (nubuwwah) di muka bumi ini. sebuahhadits:“Kebinasaanbagiumatku goda mereka sehingga mereka merasai buah pohon itu, manusia yang dikurbankan bagi kekuatan dewa Odin, Akhirnya, kesan umat tentang ulama Tidak bisa dipungkiri, dalam kehi- datangdariulamasu’,merekamenjadikan dan Allah berfirman, “ Bukankah Aku telah melarang ka- dan orang yang berkurban tadi terhapus dosanya. tidak lagi baik akibat banyak yang men- lebihbersikapdanmenjagakualitasdiri dupan di dunia ini peran ulama sangat ilmu sebagai barang dagangan yang mu untuk tidak mendekati pohon itu...!” A’raf A 22. Pada Masa Nabi Ibrahim as sudah ada pemikiran gatasnamakanulamadanmenggunakan baik ilmu, amal dan spiritual. menentukan kebaikan dan keburukan merekajualkepadaparapenguasamasa Mari kita simak, kata yang difirmankan Allah pada bahwa pengorbanan diri manusia untuk dewa adalah simbolkeulamaanhanyauntukkepen- Kerinduanumathariiniadalahhadir umat atau masyarakat. Ad-Darimi me- merekauntukmendapatkankeuntungan ayat 19 di atas. Allah menunjuk kepada pohon yang suatu kekeliruan. Manusia terlalu mahal untuk dijadikan tingansesaat.Sepertikatapepatah:“akibat ulama-ulamayangbenar-benarmenjadi nuturkan, ketika Said bin Jubair ditanya bagidirimerekasendiri.Allahtidakakan dilarang itu dengan ‘hadzihi/ini’ yang merupakan isyarat kurban demi Tuhan. Kemudian Allah SWT meluruskan nila satu titik, rusak susu satu belanga”. tauladanbagiumatdanumatmerasakan tentangtanda-tandakebinasaanmasya- memberikankeuntungandalampernia- kedekatan. Namun setelah Adam dan Hawa melanggar pemikiran dan tradisi keliru itu, sekaligus membenarkan Untuk itu, kita harus mengembalikan manfaatilmunyasertamerasakankein- rakat,iamenjawab:“Jikaulamamereka gaanmerekaitu.”( perintah, Allah menjauh, dan karena itu pula pesan dalil yang mencegahnya melalui Nabi Ibrahim as. citradanperanulamasesuaikhittahnya. dahanakhlaknya.Tulisaninisecarakhusus telahrusak” RasulSaw.Bersabda:“Ingatl- . rut az-Zahabi, ulama su’ adalah ulama yang disampaikan dalam ayat 22 di atas menunjuk kepada SebagaimanadiuraidalamalQur’an,bahwaNabiIbrahim Hari ini kita harus melihat dengan sebagairenungandalammenyongsong ah!Sejelek-jelekkeburukanadalahkebu- yangmempercantikkezalimandanketi- pohon terlarang itu dengan kata ‘tilkuma’/itu, yang as melalui mimpinya diperintahkan oleh Allah SWT untuk landasan pikiran yang jernih. Kata MusdaMUISerdangBedagaipadahari rukan ulama dan sebaik-baik kebaikan dakadilanyangdilakukanolehpenguasa. merupakan isyarat kejauhan. menyembelih anaknya Ismail. Dan salah satu cara Allah “ulama” bukan untuk komoditas po- Rabu, 18 November 2009 sebagai tang- adalahkebaikanulama”.(HR.Ad-Darimi) Ulamayangmemutarbalikkankebathi- Demikianlah, dengan ‘tobat’ yang berarti kembali memberikanwahyukepadamanusiaadalahmelaluimimpi. litik yang dijadikan sebagai alat untuk gung jawab moral penulis, agar terpi- Namun,adabeberapaindikasiyang lanmenjadikebenaranuntukpenguasa mendekatkepadaposisisemula.Menyadariakankekeliruan Q.S.AsSyura.A.51.KarenahalituadalahperintahAllah,maka politisasi agama dalam memenuhi lihyangbenar-benarbarkarakterulama bisadigunakansebagaipanduanuntuk atau ulama yang diam saja di hadapan dan kesalahannya, Adam kemudian memohon ampunan Ismail dengan penuh ke ikhlasan merelakan dirinya untuk syahwat politik pragmatis yang mate- bukanyangmengakuulamademime- memilih yang paling layak, antara lain: penguasapadahaliamampumenjelaskan Allah dengan kalimat, “ Robbana dzolamna ampfusana disembelih. Namun setelah Ibrahim membaringkan Ismail rialistis. Ulama mengemban misi langgengkankepentinganpolitiknya(poli- Pertama,kualitaskeimanan.Orangyang kebenaran.Rasulbersabda:“Ulamaadalah wa in lam tagfirlana watarhamna lanakunanna minal (sambil menggerakkan pisau dileher anaknya itu), Allah kemaslahatan dan bertanggung jawab tikus) dan hanya untuk menyalurkan berkualitaskeimanannyaakantampak kepercayaanparaRasulselamamereka khosirin ”. Q.S.Al A’raf ayat 23. menggantinya/menebusnya dengan hewan sembelihan terhadapkesinambungan nilai-nilai kekuasaan politik. dari jejak rekam khidupannya (track tidakbergauldenganpenguasadantidak record-nya). Faktanya, sosoknya ‘arif, Kecintaan terhadap dunia, membuat orang lupa akan (anak domba yang besar). Q.S. Ash Shaffat. A.103-107. moralitas demi terwujdunya masyara- Ulama Ideal: Panduan Kriteria asyikdengandunia.Jikamerekabergaul tekun beribadah, sabar, ikhlas dalam denganpenguasadanasyikdengandunia kehidupan setelahnya. Dengan cinta dunia itu pulalah, Ada satu pertanyaan, mengapa Allah memerintahkan kat yang adil, makmur dan sejahtera Kata‘ulama bentukpluraldarikata akhirnya manusia melakukan berbagai dosa, dengan menyembelih Ismail, kemudian membatalkan dan di bawah naungan Ridha Ilahi. ‘alim, secara etimologi berarti orang berbuat, rendah hati, perduli dengan maka mereka telah mengkhianati para sesama, tidak terkontaminasi dengan Rasul. Karena itu, jauhilah mereka. (HR. mengabaikan perintah Allah dan Sunnah Nabi Nya. Dan menebusnya dengan seekor anak domba. Hal ini bukan Sudah saatnya, bagi mereka yang yang berpengetahuan (ahli ilmu). karena dosa itu pula akhirnya ia memiliki jarak antara hanya sebagai ujian ke imanan kepada keluarga Ibrahim dijadikan sebagai tauladan masya- Sedangkan secara terminology ulama dunia politik apalagi bermain-main di al-Hakim)Ketiga,tamakterhadapdunia. dunia politik, berkarakter sederhana, Artinya,ulamayangdenganilmunyaber- dirinya dengan Allah. Untuk itu manusia berkewajiban as dan bukan pula untuk membuktikan ketabahan mereka, rakatnyaatauyangmemposisikandirinya adalahorangyangmampumenghasilkan mendekatkan dirinya kembali kepada Nya. Dan salah tetapi pada dasarnya adalah untuk menjelaskan kepada untukmenjaditauladankehidupanagar ilmunya kepada khasyyah yakni rasa danlain-lain. Kedua,kualitasintelektual. tujuanmencarikenikmatandunia,me- Tidakadayangmeragukankemampuan raihgengsidankedudukan.Umarberta- satu cara untuk mendekatkan diri kepada Allah, adalah manusia, bahwa tiada sesuatu yang‘mahal’ dan‘berharga’ ilmunya.Sosoknyaharusyangcintailmu nyakepadaKa’ab:“ yangmengeluar- Apa dengan berkurban. untuk dikurbankan kalau hal itu merupakan panggilan Konsultasi Al-Quran dan itu dibuktikannya dengan aktif mengajarkanilmunya,mengisipengajian- kan ilmu dari hati ulama?” Ka’ab men- jawab:“Ketamakan”.Keluarnyailmudari Hukum Berkurban Berkurban adalah suatu amal ibadah yang dilakukan oleh Rasulullah SAW, namun ulama berbeda pendapat Ilahi. Karena itu, penyembelihan hewan qurbanhakikatnya adalah penyembelihan sifat anthropocentrisme manusia yaitu sifat-sifat egocentrisme, individualisme, vandalisme Ikatan Persaudaraan Qari-Qariah & Hafizh Hafizah pengajian, menulis karya, menyahuti hati artinya ilmu itu sudah tidak berpe- (IPQAH Kota Medan) persoalan-persoalan keumatan, mem- ngaruhdantidaklagidijadikantuntunan. tentang hukum berkurban bagi setiap individu muslim. dan isme-isme lain menuju kepada sifat theocentrisme buat pojok-pojok diskusi dan lain-lain. Abu Hurairah ra. Menuturkan hadits: Imam as Syafi’i rahimahullah berpendapat bahwa berkur- yaitusifatkehidupanyangberorientasikepadaAllahsemata. KONSULTASI AL-QURAN adalah tanya jawab sekitar Al-Quran, yang Ketiga,komitmen.Sosoknyaharusdikenal “Siapayangmakandenganmemperalat ban hukumnya ‘sunnat muakkad’, sementara imam Abu Hidup dengan dinamika gerak yang memiliki orientasi. meliputi: tajwid, fashohah, menghafal Al-Quran, Ghina (lagu) Al-Quran, Hanifah ra menghukumkan‘wajib’ bagi setiap orang yang Dan orientasi tertinggi itu adalah Allah SWT. Artinya, Hukum dan ulumul Al-Quran. Kontak person. 08126387967 (Drs. Abdul dalammemperjuangkanpersoalankeu- ilmu,Allahmembu-takankeduamatanya Wahid), 081396217956 (H.Yusdarli Amar), 08126395413 (H.Ismail Hasyim, matan,tidakkenallelahdanselalumen- dan neraka lebih layak untuknya.” (HR. mampu dan tidak dalam keadaan musafir, demikian juga Allah harus selalu berada di atas segalanya sebagai bukti MA) 081375238649 (Mustafa Kamal Rokan). dahulukan kepentingan umat Islam AbuNu’aimdanAd-Dailami)Keempat, pendapatdarisebagianpengikutimamMalikra.Dalamkata pengakuan keberimanan sejati dan murni. daripadakepentinganpribadiataugolo- sombong dengan ilmunya. Kata “tidak lain, setiap orang yang mukim (berdiam di satu tempat) dan Setelah hakikat ini ditegaskan melalui perintah Assalamu’alaikum Wr.Wb. Al-Ustadz yang saya hormati, Saya ingin bertanya, bagaimana cara ngan.Sosoknyaadalahulamayangtidak tahu” tidak ada dalam kosa kata ulama memilikikemampuanfinansial,wajibbaginyauntukberkurban. penyembelihan , dan Nabi Ibrahim pun melaksanakan membacahurufghainyangterdapatpadakalimatghairilmaghdhubi‘alaihim silaukarenaharta,tidaksombongkarena su’. Ia merasa gengsi mengatakan tidak TetapibagiimamSyafi’i,‘Atha’ imamAhmad,AbuYusuf, , sesuai kemampuannya, Allah dengan ke Mahakuasaan di surat al-fatihah, apakah dengan suara tebal atau suara tipis, karena ada ilmunya,tidakpelitterhadapilmu,selalu tahu.PadahalorangsekaliberIbnuUmar Ishaq,IbnuMundzir,danDaud,berkurbanitusunnatmuakkad Nya menghalangi penyembelihan itu untuk kemudian yangmengatakanharusdengansuaratipis.Mohonpenjelasan.DariBukhari memberikan kemudahan dan tidak saja tidak merasa malu untuk mengata- baik mereka itu mukim, atau musafir maupun dalam membatalkan tradisi pengorbanan manusia. Pembatalan Zainun desa Rantau Panjang kec. Rantau Selamat Aceh Timur. mempersulit persoalan, menghormati kantidaktahu.Ibnual-Mubarakmeriwa- mengerjakan haji, dan dilakukan pada setiap tahun, karena ini bukan berarti manusia terlalu mahal dan berharga Jawab : yang tua dan mengayomi yang muda, yatkandariIbnuUmar,bahwaiapernah Nabi SAW berkekalan mengerjakannya sejak ayat qurban untuk dikurbankan demi Allah, melainkan karena kasih Terimakasihataspertanyaanya,Hurufghaindalamilmutajwidmemiliki selaluistiqomahdalammemegangteguh ditanyatentangsesuatu,laluiamenjawab, pada surah al Haj turun . Sedangkan berkurban itu sangat sayang Allah kepada manusia. beberapa shifat yaitu Jahar, isti’la, Rakhawah, infitah dan ishmat. Sifat isti’la nilai-nilaiperjuangansekalipunberhada- “Akutidaktahu”. Kemudianiamenimpa- dianjurkan bagi kepala rumah tangga, dan cukuplah bagi Kurbandisyari’atkangunamengingatkanmanusiabahwa iniyangmenjadikanhurufghaindibacadengantafkhim(tebal),yaitudengan pan dengan penguasa (power).Kelima, linyadenganmengatakan:“Apakaheng- satu keluarga untuk satu ekor kambing. Hal ini berdasarkan jalanuntukmencapaikedekatankepadaAllahmembutuhkan mengemukakansuarahurufsehinggamemenuhimulut.(hurufisti’laadalah kharismatik dan bersahaja. Tidak bisa kau ingin menjadikan punggungpung- hadis Nabi SAW yang diriwayatkan oleh Ibnu Majah dan pengorbanan,tetapiyangdikurbankanbukanmanusia,bukan kho, shood, dhod, ghain, thoo, qoo, zhoo). Memang kesemua huruf isti’la dipungkiri sosok ulama yang kita dam- gungkamisebagaijembatanbagikalian Turmudzi dari ‘Atha’ bin Yasar dari Abu Ayyub al Anshari pula nilai-nilai kemanusiannya, melainkan hewan jantan, ini dibaca dengan tebal. Hal ini berbeda dengan sifat huruf yang lain semisal bakan adalah sosok ulama yang kharis- ke neraka jahannam?”. Kelima, mereka yang menceritakan, bahwa di masa Rasulullah SAW ada sempurnaumur,dantidakcacat,sebagaipertandapengorbanan lam dan ro, terkadang dibaca dengantebal dan terkadang dibaca dengan tipis. matikdanbersahaja.AllahSwt.berfirman: mengatakanapayangtidakmerekalaku- seseorang yang berkurban untuk dirinya dan keluarganya, itu memiliki nilai. Pengorbanan yang bukan asal berkurban. Menurut Imam Jaziri, ada lima tingkatan ketebalan penyebutan huruf “(Ibrahimberdo’a):“YaTuhanku,berikan- kan. Allah Swt. Berfirman: “Hai orang- lalu mereka makan dan membagikan untuk fakir miskin. Karenayangdikurbankanadalahsifat-sifatbahimiyah(binatang) isti’la ini, yaitu: 1) huruf berbaris fathah setelah alif. 2) berbaris fathah tanpa lahkepadakuhikmahdanmasukkanlah orang yang beriman, mengapa kamu Urusan kemampuan secara finansial ini pun kemudian yang melekat pada diri manusia, seperti rakus, tamak (sifat alif.3)berbarisdhommah4.berbarissukun5)berbariskasrah. Dapatdijelaskan akukedalamgolonganorang-orangyang mengatakanapayangtidakkamukerja- berkembang, apakah dengan menabung (mencicil) atau tikusdanbabi),licik,pelit-kedekut(sifatkancil),inginmenang pula, huruf ista’la yang mempunyai sifat ithbaq lebih kuat pula tafkhimnya shaleh. (QS. Asy-Syu’ara: 83-84). kan?.” (QS. Ash-Shaf: 2-3). berkuraban secara cash (tunai). Menurut para pengikut sendiri (harimau), merusak alam lingkungan (perambahan dibanding dengan huruf isti’la yang tidak memiliki sifat ithbaq.Yaitu huruf Ulama Su’ : Non-Ideal Kita butuh sosok ulama yang bisa Ulamasu’ataufajir,adalahilmuyang imam as Syafi’i ra, baik berkurban dengan cara mencicil hutan,pencemaranlingkungandenganmembuangsampah/ shood, dhood, thoo dan zhoo. mengayomi dan mampu mengatasi Kesimpulannya:hurufghainyangterdapatpadakalimatghairilmaghdhubi dimilikitidakdijadikanpenuntun.Iatidak berbagaipersoalankeumatankhususnya atau pun cash hukumnya adalah sama, yaitu sunnat limbahdiparitdandisungai,korupsi,manipulasi),sertasifat- ‘alaihimdisuratal-fatihahwajibdibacatebal.Artinyajikaadaorangmembaca beramalsesuaidenganilmuyangiaketa- di Serdang Bedagai. Mudah-mudahan mu’akkad. Kendati demikian, ada juga pendapat bahwa sifat yang mengabaikan norma-norma agama dan susila. ghairil magh (arah bunyinya a ), maka dinyatakan salah. Bacaan yang benar hui. Asy-Syathibi mengatakan bahwa Allahmemberikankitakemudahandalam berkurban dengan cara mencicil (menabung), tidak Betapapun hewan kurban semacam yang dipersem- adalah ghoiril magh (arah bunyi gho mati mengarah juga kearah bunyi ulamasu’ adalah ulama yang tidak ber- mensukseskan Musda MUI Serdang mensyaratkan sebagai suatu kemampuan, dan pendapat bahkan Habil adalah domba terbaik yang dimilikinya, o bukan mengarah bunyi a,tetapi jangan sampai dibaca magho ).Wallahu amalsesuaidenganapayangiaketahui. Bedagaidanmun-culsosokyangbenar- ini tidak diketahui berasal dari pendapat ulama . (Bidayatul pasti tidak diterima Allah kalau tidak disertai dengan keikh- A’lam.(lihat Muhammad Shadiq Qamhawi, Al-Burhan fi tajwid Al-qur’an. Palingtidakadabeberapaindikasi,antara benarlayakmenjaditauladanbagiumat mujtahid, Nailul Authar, al Muwath-tha’). lasan dan ketaqwaan orang yang berkurban. Hal 31-32. Abduh Abbas Al-walidi, Al-majmu’ Almufid fi ilmi At-Tajwid, lain:Pertama, Beramal tidak sesuai de- Islam.Wallahu a’lamu. Dalil untuk menetapkan bahwa berkurban wajib atas “Lan yanalallaha luhumuha wala dima-uha walakin hal 94-95. Abdul Rahim At-thurhumi, jami’ Al-mufid. Hal 292). ngan ilmunya, tetapi mengikuti hawa ● Penulis adalah: Dosen Fakultas setiap individu muslim adalah berdasar firman Allah, yanaluhu altaqwa min kum” /daging dan darah (unta Al-Ustadz H. M. Tuah Sirait S.Ag nafsunya. Allah Swt. Berfirman: “Aku Ushuluddin IAIN Sumatera Utara dan “fashalli lirabbika wan har”/Maka shalatlah kamu untuk kurban) itu sekali-kali tidak dapat mencapai keridhaan akan memalingkan orang-orang yang Sekretaris Komisi Pengkajian dan Pe- Tuhanmu dan sembelihlah kurban, dan hadis Nabi SAW, Allah, tetapi ketaqwaan kamu lah yang dapat mencapainya. Ketua IPQAH Kodya Medan menyombongkandirinyadimukabumi ngembangan MUI Serdang Bedagai. “man wajada sa’atan falam yudhahhi fala yaqrubanna Q.S. Al Haj. A. 37. Wallahu a’lam.
  • 12. WASPADA Jumat 13 November 2009 Mimbar Jumat 15 5 Syiar Islam Di Bulan Zulhijjah (Haji Simbol Islam yang Menakjubkan) Perjalanan Haji Rasulullah Hadits Rasulullah: ’’Khudzuu ’annii manaasikakum’’ yang artinya S ecara kebahasaan, Syi’ar berarti “motto”,“slogan”,“lambang”,dan bila digandengkan dengan kata Islam berarti simbol kemuliaan dan (Bagian 1) Oleh H.M. Nasir, Lc, MA sebagai manusia yang tidak mampu menciptakan dirinya sendiri apalagi menciptakan alam semesta. Dengan kesadaran ini akan rontoklah segala kebesaran Islam. Alquran menyebut- bentuk aorgansi, kesombongan dan ’’Ambillah dariku pelaksanaan ma- kan kata syiar ada beberapa tempat, pada gilirannya akan mengakui nasik hajimu, atau ikutilah cara diantaranya dalam surah Al-Baqarah keesaan Allah Swt., tidak ada yang ibadah hajiku.’’ Demikianlah sabda ayat 158: Sesungguhnya Shafâ dan ini adalah menyelami secara men- mampu menandinginya. Marwa adalah sebahagian dari syi’ar dalam pengertian 5 syiar yang meru- Dari pakaian ihram ketika ber- Nabi Muhammad SAW kepada pa- Allah.AllahSwt.berfirmandalamsurah pakan karakteristik bulan Zulhijjah wukuf di Arafah (dianjurkan untuk ra sahabat dan umat Islam pada Al-Hajj ayat 32 : Demikianlah (perintah sekaligus merupakan lambang ke- memakai warna putih), mengisya- umumnya. Allah), dan barangsiapa mengagung- besaran Islam. ratkan agar melepas pakaian-pakaian Cara ibadah haji Rasu-lullah itu kan syiar-syiar Allah, maka sesungguh- Diawali dari syiar ibadah haji keduniaan, karena pakaian keduniaan nya itu timbul dari ketakwaan hati. Kewajibanhajidibebankankepada inilah yang membuat timbulnya sudah barang tentu merupakan Syiardapatdiartikansebagai“tanda orang-orang yang mempunyai ke- perbedaan status sosial. Ada pakaian tuntunan paling afdhal bagi umat pengenal” seseorang, seperti halnya mampuan (istitha’ah), tidak hanya jenderal, ada pakaian pejabat, ada Islam dalam melaksanakan ibadah iuntuk mengenal orang-orang yang merupakan gerakan fisik yang kosong pakaian sipil dan ada pula pakaian haji. Kalau bisa seluruhnya diikuti berasal dari satu daerah dengan derah tanpa makna, dan tidak mempunyai militer. Akan tetapi dengan pakaian lain bahkan orang tertentu pun dapat tujuan sama sekali, haji merupakan ihram, perbedaan status sosial hilang meskipun pada kenyataannya tidak dikatakansyi’arsepertisabdaNabiSaw: simbolis(syiar)daripenciptaanmanusia secara bersamaan, yang terlihat hanya semua dapat dijalankan lagi kare- Syi’ar (tanda) orang Muhajirin adalah pertama di permukaan bumi ini, untuk pakaian tauhid, pakaian umat. na kondisinya saat ini sudah berubah. Abdullah sedangkan syi’ar (tanda) cukup luas cakupannya sesuai dengan dilakukan kembali oleh anak cucu ‘Ala kulli hal, ibadah wukuf yang Jabir bin Abdullah r.a dalam ha- kaum Ansor adalah Abdurrahman. perkembangan zaman. Lihatlah per- Adam, ketika bertemu di Arafah (suatu merupakan salah satu rukun haji, tidak Ada banyak syi’ar di dalam Islam, kembangandakwah,mulaidarifasilitas padang pasir yang telah berubah hanya merupakan suatu pergerakan ditsnya berkata: ’’Ketika Rasu- secara garis besar dapat disimpulkan dakwah, metodologinya hingga objek menjadi padang hijau dengan pepo- hampa makna, ia merupakan simbol lullah SAW melakukan haji para kepada 2 macam, pertama Syiar Iba- dan materi dakwah itu sendiri telah honan), mengingatkan pertemuan (syi’ar)Islamyangpalingmenakjubkan, sahabat termasuk kami sendiri ikut berhaji bersama beliau. Kami bersama Rasul dah, yang pada prinsipnya tidak masuk ke dalam segala sendi-sendi manusia pertama (Adam dan Hawa) di samping ia merupakan tempat yang berubahdantidakmenerimaperubah- kehidupan. Tentu perubahan-peru- setelah diturunkan dari Surga, seakan- paling ramai dikunjungi di dunia ini, meninggalkan Madinah pergi ke miqat Bir Ali (zulhulayfah)’’. an, seperti yang dijelaskan dalam surah bahan ini mendapat apresiasi dari akan aksi wukuf di Arafah merupakan setiap tahun (± 4 juta orang). Arafah Dengan memakai pakaian ihram di Bir Ali, beliau dan rombongan shalat, dan Al-Baqarah ayat 158 di atas, bahwa orang-orang yang memahami firman napak tilas pertemuan tersebut. juga merupakan simbol ilmu penge- selanjutnya Rasulullah menaiki unta kemudian menuju tempat dekat masjid yang Shafa dan Marwa adalah merupakan Allah dalam surah Ash-Shaf ayat 9: Dari gerakan wukuf yang meru- tahuan, mengenal diri, memperke- bernama Al-Baida, dan di sinilah Rasulullah mulai membaca talbiyah dengan suara bagian dari syiar Allah. Sebagaimana Dialah yang mengutus rasul-Nya pakanpuncakdarisemuakegiatanhaji, nalkan diri kepada Allah Swt. dengan dimaklumi bahwa Syafa dan Marwa dengan membawa petunjuk dan aga- sebagaimana sabda Nabi Saw. : Haji segala bentuk kekurangannya, lebih keras. Sesungguhnya segala puji dan nikmat itu adalah milikMu, tidak ada sekutu adalah tempat melaksanakan sa’i ma yang benar agar dia memenang- itu adalah Arafah” tidak hanya dipa- dari semua itu, Arafah merupakan bagiMu.’’ sebagai salah satu rukun dari ibadah kannya di atas segala agama-agama hamai sebagai aksi diam di hadapan perhelatan Akbar umat Islam setiap Nabi Muhammad ketika itu hanya niat untuk haji karena belum mengetahui tentang haji dan umrah. Ketika memulai sa’i meskipun orang musyrik membenci. Allah Swt, atau sebagai tempat menge- tahun yang dikumpulkan oleh Allah ibadah umrah, sebagaimana haditsnya: ’’Waktu itu, kami hanya niat haji, sebab kami dari Syafa tidak dari Marwa, ini tidak Tidak seorang ulama pun yang meng- nal Allah Swt, atau mengenal diri, swt.Yang Maha Pengumpul (al Hasyir) akan berobah dan tidak akan mene- klaim perobahan dan perkembangan bahkan merupakan pengenalan diri untuk satu tujuan yaitu haji Mabrur belum tahu tentang umrah.’’ [HM Iwan Gayo, Buku Pintar Haji & Umrah, penerbit rima perobahan, meskipun tempat syiar dakwah ini suatu hal yang meng- semata kepada Allah, sesuai arti dari yang dijanjikan oleh Baginda Rasul Pustaka Warga Negara, 1999, Jakarta Timur]. sa’i hingga sekarang ini sudah menga- ada-ada apalagi sebagai perbuatan kata Arafah yaitu mengenal. Lebih dari saw. Haji mabrur tidak ada balasannya lami perluasan secara besar-besaran, bid’ah yang menyesatkan. semua itu, puncak rukun haji ini me- selain surga. namun starting untuk pelaksanaan sa’i Dari sekian banyak syiar yang ngutip perkataan Dr.Ali Syariatiadalah Terakhir, syiar haji ini tidak semua Berqurban Wujud Cinta Kepada Ilahi tetapdimulaidariSyafakarenainimeru- pakan prinsip sekaligus syi’ar ibadah. Demikian pula halnya syiar-syiar disebutdidalamAlquranadalahkegia- tan-kegiaan yang berkaitan dengan bulan Zulhijjah, termasuk diantaranya merupakan pertunjukan akbar secara bersamaan, “penciptaan”, “sejarah”, “kesan”,“ideologiIslam”dan“ummah”. orang dapat melakukannya, namun demikian bagi yang tidak haji dapat melakukansyi’arlainyangmempunyai lain yang berkaitan dengan ibadah haji ibadah haji, berkurban, thawaf, sa’i Biladirenungkansecaramendalam “bobot” yang tinggi, diantaranya puasa Oleh Drs. H. As’ad Marlan, M.Ag seperti tempat wuquf, mabit di Muz- dan lain-lain. Meskipun ada beberapa aksi wukuf di Arafah adalah meru- Arafah, karena Rasul Saw. bersabda: dalifah, mabit di Mina, 3 Jamarat hal yang tidak disebut secara eksplisit pakan gerakan pertama dilakukan oleh Puasa Arafah dapat menghapuskan (Jumrah Ula,Wustha dan Aqabah). sebagai syiar, seperti puasa arafah, sha- jamaah haji secara bersamaan setelah dosa 2 tahun, satu tahun yang lalu R asacintadanpengorbananpada mengajari anak supaya menjadi Masyair-masyair ini merupakan sim- lat Idul Adha, bertakbir, namun tidak memakai ihram dan berniat, mau tidak dan satu tahun akan datang. Dan hakikatnyatidakdapatdipisah- penyantun.Akibatnyabanyaksekalipara bol-simbol ibadah haji dan tetap utuh dapat dibantah ia termasuk syiar yang mau, suka tidak suka, setiap jamaah syi’ar puasa Arafah akan dibahas pada kan dan senantiasa mewarnai orang tua yang kesal dan stress akibat hingga akhir zaman. dapat dilakukan oleh kaum muslimin haji harus berhenti di sana karena tulisan berikutnya. Wallahua’lam. sirah(perjalanan)hidupumatmanusia. ulah anaknya, otaknya tajam memiliki Kedua Syiar Da’wah, hal ini dipa- meskipun tidak berhubungan dengan Arafah tidak ada duanya di dunia ini. (Bersambung) Sebab,tidakadacintatanpapengorbanan. ilmu, tetapi tidak berakhlak dan tidak hami dari pengertian syi’ar pada ayat kegiatan ibadah haji sehingga dapat Oleh sebab itu sesuai makna dari ● Penulis adalah: Begitupulasebaliknyatidakadapengor- memiliki rasa santun dalam jiwanya. 32 surah Al-Hajj yang menganjurkan menghilangkan imej di tengah-tengah Arafah adalah ilmu pengetahuan, - Pimp. Pondok Pesantren Tahfiz bananapabiladidalamnyatidakadacinta. Rasulullah SAW bersabda : ”Pemberian untuk membesarkan dan menyema- komunitas Islam bahwa hanya orang- seolah-olah aksi wukufini memaksa Alquran Al Mukhlisin Batu Bara Demikian pula dengan Nabi Ibrahim orang tua kepada anaknya yang paling dan putranya Ismail as ketika diuji oleh berharga ialah budi pekerti atau sopan rakkan simbol-simbol Islam, sebagai oranghajisajayangdapatmeramaikan manusia untuk menyadari dan me- - Pembantu Rektor IV Universitas Allah, sampai dimana cintanya kepada santun”. (HR. At-Turmuzi). pertandahatiyangadarasatakutkepada dan memeriahkan syiar tersebut. ngetahuisiapadirinya.Denganmenge- Al Washliyah (UNIVA) Medan Allah SWT. Maka Allah mengujinya PembelajarandariNabiIbrahimAs Allah Swt. Dan syiar-syiar dakwah ini Yangingindiuraikandalamtulisan nal diri, dia akan tahu kelemahannya - Anggota Komisi Fatwa MUI Medan denganmenyuruhmenyembelihputra- Ada beberapa pembelajaran yang nya Ismail itu. dapatdiambildariperistiwapengorbanan Sebagai manusia biasa, alangkah beratnya bagi Nabi Ibrahim untuk mengorbankan anaknya sendiri, apalagi setelah berusia lebih setengah abad ia baru NabiIbrahimAsyangmerupakanbagian dariaqidahdansyariatIslam:Pertama, Allahmengujikecintaan NabiullahIbrahimAs,tingkatkecintaanseorangayahterhadap Jamaah Haji Dalam Bingkai Kesalehan Sosial dikaruniai keturunan, seorang anak laki-laki satu-satunya anaknya biasa sangat tinggi. Apalagi, Ismail merupakan S hasilperkawinannyadenganSitiHajar.Walaupundemikian, dambaan sejak ia dalam kandungan ibundanya. Kecintaan alahsatupersyaratanyangpenting lailatul qadar pada bulan Ramadhan. NabiIbrahimtidakmerasaragusedikitpununtukmenjalani terhadapanakseringkalimelalaikancintaayahterhadapAllah sehingga seseorang wajib untuk Oleh Watni Marpaung, MA Secara jelas dalam buku-buku yang perintahAllahyangditerimamelaluimimpinya.NabiIbrahim SWT. Nabi Ibrahim pun di uji, ternyata ketauhidan dalam berangkat ke tanah suci menu- ditulis para ulama tidak menyebutkan punmenyampaikanperintahAllahtersebutkepadaanaknya dadanya sangat mendalam. Sehingga ia tak bergeming naikanhajiadalahkemampuanfinansial. bagaimana tanda-tanda yang menda- sebagaimana dilukiskan dalam Al-Qur’an : ”Wahai anakku sedikitpun dari cintanya terhadap Allah. Kemampuanfinansialinitidaksajahanya akanterlihatterbuktirasasolidaritasyang patkan haji mabrur tersebut. ! Aku melihat dalam mimpiku, Aku diperintahkan untuk Kedua,kasihsayangkepadaanakseringberlebihan,sehingga untukkepentinganorangyangberangkat terbangun manakala setelah selesai Tetapi paling tidak salah satu tanda menyembelih engkau. Bagaimanakah tanggapanmu seorang ayah lebih memperioritaskan bagi anaknya, lebih haji tetapi juga orang yang ditinggalkan. menjalankan ibadah haji. Sebab dilihat yangmengindikasikanseseorangtelah sendiri?” (Q.S. As Shaffaat : 102). dariyanglainnya.Dalambidangapapun,apalagijikaanaknya Secara implisit bahwa mereka yang darisisifinansialmerekayangtelahberhaji mendapatkanhajimabrursepertidise- TatkalaperintahAllahituakandilaksanakanNabiIbrahim, benar-benarmemanfaatkankelemahanyangdimilikiayahnya. melakukanibadahhajiadalahyangpunya dapatdikatakanorangyangmampudan butkan Nurkhalis Madjid terjadinya setelah Ismail dibaringkan ingin disembelih, pada saat-saat Maka sering kali dalam berbagai bidang kehidupan terjadi kemampuandankesiapandariberbagai memiliki rezeki yang berlebih, sehingga perubahanyangsignifikanpadadirinya mengharukan itulah Allah menunjukkan kekuasaanNya. fenomena tersingkirnya satu pihak yang lebih berhak atas halyangdibutuhkandalampelaksanaan punya bekal untuk dirinya berangkat menjadilebihsaleh,tidakhanyakesalehan TernyatayangdisembelihsaatitubukanIsmailtetapidigantikan sesuatuurusanataupekerjaan,hanyakarenaiakalahbersaing haji di tanah suci. sertabelanjayangditinggalkanterhadap pribadi tetapi juga sosial. oleh Allah dengan seekor Kibas (Jenis Kambing) dan Allah dengan anak si pembuat keputusan, sementara yang dime- Selain itu, para jamaah haji yang keluarga. yang harus juga dikembang- Kitamelihatjumlah hajisetiaptahun menyatakan bahwa pengorbanan Nabi Ibrahim diteri- nangkantidakberkualitas.Dalamhaliniseringdisebutdengan berangkat haji juga orang-orang yang kan sifat memberi kepada mereka yang semakin meningkat yang dipandang ma oleh Allah SWT. Maka, sejak itulah Nabi Ibrahim nepotisme, sesungguhnya yang demikian menghilangkan padaumumnyasudahmulaimembaik membutuhkan. secara semangat keagamaan sangat melakukan ibadah qurban dengan menyembelih hewan sikapadil,yangmerupakanfaktorpentingdalamsyariatIslam. tingkat pemahaman keagamaannya Keempat, Secara kolektif dengan bagusdenganterpanggilnyamemenuhi secara tertib dan teratur. Sementarakeadilanitusangatdidambakanolehseluruhumat kendatipuntidakdemikianseluruhnya. Ikatan Perhimpunan Haji Indonesia seruanAllah.Namun,darisudutpandang Demikianlah asal-muasal ibadah qurban, dan dengan Islam.AllahSWTberfirman:”Wahaiorang-orangyangberiman, Terlebih lagi dengan pembinaan dan (IPHI) lebih dapat berperan lagi dalam efeksosialdalamrangkaperankontribu- itupulalahirlahkata-katapengorbanan,berkorbandanlain- jadilahkamuorang-orangyangmenegakkankeadilandanmenjadi pengarahan yang dilakukan pada tiap- skala yang lebih luas seperti gerakan- sinyaditengah-tengahmasyarakattidak- lain.Kesediaanseorangmukminmemberikansesuatuyang saksi bagi Allah walau terhadap diri kamu sendiri, atau tiap KBIH dengan segalan yang terkait lebih dalam lagi para tamu Allah yang gerakan sosial misalnya, membantu lahbegitudirasakan.Sekalipunadatetapi sangat dicintainya untuk agama Allah dan membela yang anak-anak dan kerabatmu....” (Q.S. An-Nisa: 135) . denganpelaksanaanhajidanhukumIslam. telahpulangmerupakanduta-dutaAllah korban bencana alam, banjir, longsor, seringterbataspadabentuk-bentukkesa- hak, apakah itu berupa harta, tenaga, popularitas, ilmu, Ketiga, da’wah dan pengembangan Islam memerlukan Bahkan,yangpalingmemberikankesan setelah melakukan konferensi terbesar gempa bumi dan lain sebagainya yang lehanindivisubukankolektifparajama’ah kedudukan, pangkat bahkan jiwa sekalipun direlakannya, pengorbanan,dariapapunbentuknya.Dalamrangkapengab- keagamaan yang mendalam pada saat diArafahdenganberbagaiagenda-agen- seharus-nyasebagaisatubentukladang haji.Dapatkita bayangkanbegitubanyak- manakala dengan itu agama Allah akan tinggi, syiar Islam dian diri kepada Allah SWT.Pengorbanan tidak saja dapat dili- pelaksanaan ibadah haji dengan segala dayangharusdijalankansetelahpulang amal yang lebih konkrit diwujudkan nya para haji yang terhimpun dalam akan memancar sampai kepenjuru dunia. hatdarisegikonsekuensilogissebuahperjuanganmenegak- pengalaman spritual dan perasaan kedaerahnyamasing-masing.Sekaligus perhimpunan tersebut. Sehingga tidak IPHI di atas yang tentu jumlahnnya Ismail As sebagai anak yang dikaruniakan Allah kepada kansuaturisalahkebenaran.Bahkanlebihdariitu,pengorba- yang berbeda dalam beribadah pada haliniadalahtuntutanRasulullahuntuk hanya terbatas pada acara-acara per- mungkin sampai jutaan orang, jika di- orang tuanya (Nabi Ibrahim As) bukan sekedar saleh tetapi nan juga merupakan manifestasi rasa syukur manusia atas saat di tanah air. menyampaikandakwah“Sampaikan- kumpulanpengajianantarajama’ahtanpa arahkankepadabentuk-bentukkegiatan penyantun.Anakyangpenyantunitumempunyaiciri,bentuk nikmat yang diberikan Allah SWT. Allah berfirman : ”Sesung- Oleh sebab itu, terdapat dua po- lah dariku walaupun satu ayat”. menyentuh dimensi sosial masyarakat amal sosial tentu akan sangat lebih dan sifat tersendiri, ada belas kasihan pada orang tuanya, guhnya Kami telah memberki engkau nikmat yang banyak, tensi pada jamaah haji yaitu pertama, Kedua, Memberikan keteladanan umum. Sehingga tidak menutup ke- dirasakanmasyarakatluasmanfaatnya. serta pandai menenggang rasa dan perasaan. maka shalatlah dan berkorbanlah”. (QS. Al-Kautsar : 1-2). potensi finansial, dan kedua, potensi yangbaikkepadamasyarakat,sehingga mungkinan jama’ah haji dengan IPHI- Ibadahhajiyangtelahdilaksanakan Ada empat tanda atau ciri anak yang penyantun itu, Ketika datang Idul Qurban bukan hanya bersifat ritual pengetahuan dan pengamalan agama, orang akan menjadikannya sebagai nyadianggapkebanyakanorangsebagai oleh saudara-saudara kita yang lebih yaitu:Pertama,tidakmaumenyusahkandanmemberatkan tanpamakna.TapiIdulQurbanmemilikiartiyangmendalam paling tidak jamaah haji harus mampu ikutandalampaktekkehidupanmereka tempat berkumpulnya orang elitis dan dahulu punya kemampuan untuk orang tua-nya.Kedua, tidak mau mencemarkan nama baik dan luar biasa untuk menumbuhkan kembali energi bagi melakukan kesalehan sosial dalam sehari-hari.Sebabterkadangtidaksedikit suci. Jika kondisi seperti ini terus berke- berangkat mempunyai konsekwensi ayah dan ibunya. Ketiga, selalu berupaya menolong dan kaum muslim yang bersumber dari aqidah dan syariat Islam bentuk sebagai berikut: mereka yang telah kembali dari tanah panjangan tanpa ada perubahan akan manakala setelah kembali ke daerah- meringankanbebanmerekaberdua.Keempat,selalumenjaga untuk mencapai kebahagiaan dunia akhirat. Pertama, Dapat menyampaikan suci bukan menjadi lebih ramah dan dapat menciptakan jurang pemisah nya masing-masing. Haji yang mereka perasaan hati orang tua tidak mau menyinggung dan Filosofi qurban yang dianjurkan Islam tentunya bukan dakwahdanpencerahankepadamereka menghargaioranglain,tetapisebaliknya antaramerekayangsudahhajidanyang yang belum melakukan haji supaya laksanakan menuntut perubahan menjadikannya iba. sajadalambentukhewanternaksaja.Tapidalamsemuaaspek keangkuhan,menganggapstatuslebih belum berangkat haji. yang nyata kepada yang lebih baik KeempatsifatinisudahadasejakNabiIsmailmasihkecil, kehidupanmanusia.Kitaperluinstropeksidanbertanyapada terdoronguntukberangkatketanahsuci tinggi, merasa lebih suci muncul da- Sejatinyaparajama’ahhajiyangtelah dengan menyampaikan pengalaman dalam kehidupan sehari-hari baik itu sebagai hasil didikan Ibundanya (Siti Hajar) yang tak kenal dirimasing-masing,sudahsejauhmanatelahrelaberkorban lam diri, tentunya sifat-sifat seperti pulang dapat menyikapi poin-poin di indahnya bertamasya ke rumah Allah. tercermindalamkesalehanpribadinya berputusasa,Ismailrelaberqurbanuntukmematuhiperintah untukagamaAllahyangmuliaini,termasuknegara,masyarakat, ini menjadi faktor kebencian orang atassebagaibentukmanifestasituntutan Dengandemikian merekayangenggan lain pada diri mereka. terlebih lagi pada dimensi sosialnya. Allah, dan meringankan beban ayahnya, inilah sifat yang keluarga dan kaum kerabat. Rasulullah SAW mengingatkan ibadah haji yang telah ditunaikannya. harus dimiliki oleh putra-putra sebagai muslim. kepadakita:”Sebaik-baikmanusiaialahyangpalingberman- untuk menunaikan haji sementara Ketiga, Menunjukkan kepedulian Selainitupulaapabilakitamenguakmisteri ● Penulis adalah: Dosen Fakultas Pada saat ini kita lihat, bahwa pendidikan lebih banyak faat bagi manusia”. (Al-Hadits)Wallahu A’lam Bishshawab. kemampuan sudah sampai akan sosialyangtinggikepadasaudara-saudara mabruratau tidakkah haji seseorang Syariah IAIN-SU Medan & Pengurus berkembang ke arah mencari materi, pengembangan ilmu ● Penulis adalah: Guru MAL IAIN dan Dosen termotivasimenjadipengisidaftarcalon yangmerekatidakpunyakemampuan tentu persoalannya tidak jauh berbeda Lembaga Baca Tulis Sumatera Utara dan kedudukan, sangat kurang dari didikan agama yang Fakultas Tarbiyah IAIN-SU. hajiberikutnya.Sebabapabiladipahami atau serba kekurangan. Dengan begitu dengan siapakah yang mendapatkan (LBT-SU). Daarul Ma’arif Jl. Damar Raya No. 8 Sidorukun Dr. H. Hasan Mansur Nst., MA MEDAN TUNTUNGAN Al-Hidayah Kel.Tg.Marulak Hilir Lingk.03 (Kp.Keling) Drs. H. Usman Amin Muttaqin Jl. Pasar III No. 40 Glugur Darat I Ahmad Yani, S.Ag Al-Hidayah Jl. Jend. Ahmad Yani No. 50 Kel. Durian Masrisyah, S.Pd.I Nurul Yaqin Jl. Bukit Barisan I No. 74 Dr. H. Mahyuddin Nst., MA Ar-Rahman Griya Nusa Tiga Lingk. 03 Tg. Selamat Ismail Dit Al-Hasanah Jl. Kartini No. 16-A Mhd. Amin Lubis, S.HI, SH Nur Chadidjah Komp.Wartawan Jl. Letter Press No.51 Drs. Akhmad Saukani Al-Amin Jl. Pala Raya Perumnas Simalingkar Agus Rizal, S.HI Al-Mukhlis Jl. A. Yani/Sakti Lubis Khairul Anwar, S.Pd.I Syuhada Jl. Budi Pengabdian No. 03 P. Brayan Drs. Samsuri Matondang Al-Hasanah Jl. Teh 10 Perumnas Simalingkar M. Subhan, S.Ag Al-Muthmainnah Lingk. I Kel. D.Sundoro Suratman Taqwa Jl. Sutomo Ujung Gg. A No. 47 Kel. Durian Drs. Abdul Kadir Jailani Al-Ikhlash Jl. Nilam 11 No. 1 Perumnas Simalingkar Drs. Ahmad Suhardi Matondang Al-Maryam Jl. Darat Lingk. VIII Kel. Rambung Drs. H. Akhyar Nasution Taqwa Kampus UMSU III Jl. Kapt.Mukhtar Basri No.3 Drs. H. Sunaryo Al-Muttaqin Jl. Jamin Ginting Km. 14 Kel. Sidomulyo Drs. Joko Al-Musyawarah Jl. Abd. Rahim Lubis No. 48 A Zuhril Lubis Taqwa Jl. Rakyat/Lr. Maninjau No.6 Sidorame Timur Junaedi Al-Muhtadin Jl. Kemiri Raya I No. 1 Blok-G H.M. Yusuf, BA Al-Haq Kel. Deblot Sundoro Kec. Padang Hilir Ramadhansyah Lubis Taqwa Jl. Bilal Gg.Keluarga No.74 Kel.P.B. Darat II Damiswar, BA Al-Muhajirin Jl. Kopi Raya II Blok A H.M. Majid Damanik Darul Jannah Jl. Bhakti LKMD Lingk. I Kel. Lalang Darwis K. Hasibuan Taqwa Jl. Pelita II No. 3/5 Sidorame Barat Dr. Nawir Yuslem, MA Al-Razzaq Jl. Sakura Raya Kel. Tanjung Selamat Syafruddin Syam, MA Farida Jl. H. Ahmad Bilal Kel. Damar Sari Drs. Abdul Kholik, M.AP Taqwa Jl. Mustafa No. 1 Glugur No. 1 Kp. Dadap Prof.DR.Lahmuddin Lbs, M.Ed Iklab Jl. Letjend. Jamin Ginting Km. 12,5 No. 100 Syahril Dalimunthe, S.Ag Jami’ Jl. Batu Bara Kel. Satria Zulkarnain, S.Ag Taqwa Ubudiyah Jl. Bambu III Kel. Durian Fauzan Mas’ar, S.HI Baitul Rahman Jl. Rami II Simalingkar Drs. Arifinsyah Nurul Hidayah Jl. G.Martimbang II Kel. Rantau Laban Muslim Istiqomah Nurul Hayat Kel. Kemenangan Tani Drs. H. Husni Syuhada Jl. Iskandar Muda No. 70 Drs. Daulat P. Sibarani MEDAN TEMBUNG Nurul Iman Jl. Irigasi No. 12 Kel. Mangga Drs. H. Agusron Harahap, SH Taqwa Jl. Prof. H.M.Yamin Kel. Sri Padang Kp.Keling Yahya Hakim, S.Pd. Akbar Baitus Sujud Jl. Metrologi Raya Gg.Karya No.1 Drs. Syarien Pane Silaturrahim Jl. Kapas 13 No. 49 Perum. Simalingkar Drs. Hasan Basri Ritonga Taqwa Jl. Sawit Raya Perumnas Simalingkar H. Bahrel Datuk, SE, MM INDRAPURA Ar-Ridho Jl.Tuasan Gg.Sukun No.10 Kel.Sidorejo Hilir Drs. Sofyan Sianipar Ar-Ramli Jl. Sidorukun Ujung/Jl. Surya Lingk. XII Drs. H. Tengku Yusuf Jami’Indrapura Kota Iriansyah DELI SERDANG Ash-Shobirin Jl. Pukat Banting II (Mestika) Kel.Bantan Drs. Adnan, M.Ag KISARAN At-Tawwabin Jl. Pimpinan No. 1 Drs. H. Syamenan Hasibuan Amal Islamiyah Kel. Lubuk Pakam Pekan Drs. H. Joharuddin Hasibuan Al-Anwar Jl. Willem Iskandar Kel. Indra Kasih Andi Syahputra Ainul Yaqin Jl. Pembangunan IV No. 30 DR. H. Zulhendi, Lc, MA Ar-Rasyidin Jl. Sei Asahan No. 42 Kel. Tegal Sari Drs. H. Nurul Ihsan Sitorus, SH Al-Falah Jl. Pukat Banting IV No. 10 Solehuddin, S.Ag Al-Furqon Perumahan Bumi Tuntungan Sejahtera DSC Syafi’i Zein, S.Ag Al-Husna Simpang 6 Kel. Kisaran Barat H. Nummat Adham, MA Al-Hidayah Jl. Letda Sujono No.62 Kel. Bdr. Selamat Drs. Bahron Nasution Al-Hidayah Jl. Kongsi Gg. Syukur No. 307 Marindal I Drs. Rozali Umar Batubara Nurul Yaqin Jl. K.H. Agus Salim Pasar Lama H. Usman Darus, S.Ag Al-Hikmah Jl. Letda Sujono Gg. Amal No. 5B Drs. Nukman Ridwan Al-Hafiz Desa Hamparan Perak Kec. Hamparan Perak Khairul Ahmad Nurul Huda Jl. Malik Ibrahim No. 37 Sutrisno, S.Sos Al-Huda Jl. Tuasam Gg. Aman Suheri, S.Ag Al-Iskhlas (YAMP) Komp. Perkant. Pemkab L. Pakam Muhammad Soleh, S.Ag LABUHAN BATU Al-Ikhlas Lingkungan II Kel. Bandar Selamat H. Ahmad Sorimonang Rkt, Mth Al-Muttaqin Jl. S.M.Raja Km.12 Gg.Rasmi T.Morawa Drs. H. Nasrun Zakaria Al-Ikhlash Jl. Pukat V Kel. Bantan Timur Drs. H. Mahyuddin Nasution Al-Muttaqien Gg. Kolam Deli Tua Masnun Syafi’i, A.Ma An-Nur Desa Kuala Bangka A. Kadir Domo Al-Istiqomah Komplek Veteran Medan Estate Drs. A. Dairobi Butar-butar Baiturrahman Jl. Merica Raya Blok F Kec.Pancur Batu H. Syafiar, M.Ag Baiturrahman Kamp. Masjid Kec. Kualuh Hilir L.Batu Al Asyir Saragih Al-Ijtima’iyah Jl. Letda Sujono No. 152 Shufriadi Baitussalam Dagang Kerawan-Tg. Morawa M. Rasyid, S.Pd.I BATU BARA Al-Muhajirin Jl. Garuda II Kel. Kenangan Baru Drs. H. Muslim Lubis, SH, MA Baitul Mukmin Jl. Medan-Binjai Km.15,5 Kec.Sunggal K.H. Zamak Syari Al-Muslimun Jl. Pertiwi No.94 Drs. H. Ibrahim Isa Jami’ Jl. Pantai Labu Dusun Masjid Desa Beringin Zaidil Ar-Rahman Dusun II Desa Pasar Lapan H. Lukman Yanis, SH Al-Muqorrobin Jl. Pukat II No. 52 Bantan Timur Drs. T.H. Baharuddin Siregar Jami’ Asysyakirin Delitua Jl. Medan-Delitua Km.11,5 H. Sugianto, Lc Jami’ Al Mukhlisin PT. Moeis Kel. Perk. Sipare-Pare H. Mawarmin Lubis Al-Muhtadin Jl. Bantam No. 15-A Lingk. III Syahrilluddin, S.Pd.I Jami’ Jl. Irian No. 79 Kel. Pekan Tanjung Morawa H. Habibullah Nurul Iman Dusun V Pasar Lapan Bustami Baiturrahman Jl. Willem Iskandar Psr V Medan Estate Saifuddin Daulay Khairul Fatihin Dusun II Tg. Morawa-A Drs. Harmaini Margolang Nurul Hudadesa Tanah Tinggi Kec. Air Putih Amir Hasbi Darul Amin Jl. Letda Sujono Ujung No. 1 Lingk. I Hasanuddin Hasugian Nurul Ikhwan Jl. H.A. Dahlan No. 38 Edy Syahputra, S.Pd.I Syuhada Sukaraja Desa Sukaraja Kec. Air Putih H. Muslim Ismail Ikhwaniah Jl. Tuamang No. 47 Kel. Sidorejo Hilir Drs. H. Ismail Hasyim, MA Nursa’adah Jl. Medan-Tg. Morawa, Km. 12 H. Ahmad Iqbal, Lc Quba Tanjung Kubah Burhanuddin Lubis, S.Pd. Jami’ Nurul Ihsan Jl. Durung No. 134 Kel. Sidorejo H. Jafar Muhammad Raya Lubuk Pakam Jl. T. Raja Muda No. 26 Drs. H. Lukman Hakim Siregar PEMATANG SIANTAR Nurul Iman Jl. Pertiwi Ujung Kel. Bantan Drs. Syamsuddin Nur Taqwa Jl. Diponegoro No. 1 Lubuk Pakam Drs. Syahrial Anas Al-Ikhlas Jl. Nagur No. 45 Kel. Martoba Drs. H. Rasyid Nasution Raya Muslimin Jl. Pukat I No. 9 Kel. Bantan Timur H. Achyar Nasution, Lc, MA TEBING TINGGI Ubudiyah Jl. Mandala By Pass No. 110 Drs. Syamsul Bahri Silian RANTAU PRAPAT Ulul Albab Jl. IAIN No. 1 IAIN-Sumatera Utara Prof. Dr. H. Hasyimsah, MA Amal Muslimin Kampung Rao Khairuddin Noor Hasibuan, S.Ag Al-Qodar Jl. Torpisang Mata Atas Drs. Abdul Jawad B.Bara Taqwa Jl. Belat No. 76B Faizal Lubis, S.Ag Ash-Sholihin Jl. Badak Lingk. I Kel. Bandar Utama Syihabuddin, S.Pd.I Taqwa Jl. Tangkul II No. 128-A M. Syurif, S.Pd.I, M.SI An-Namirah Perum.Griya Prima Ling.II Kel.Tg.Marulak Ahmad Toga Marbun, S.Ag D A I R I Taqwa Jl. Enggang Raya No. 85 Fakhruddin AR, S.Ag, MA Al-Falah Jl. Ksatria Kodim-0204/DS H.M. Syamsi Al-Muhajirin Perumnas Kalang Simbara Juharta Manik, S.Ag Taqwa Jl. Kolam No. 01 Kampus I Medan Estate Dr. Ali Imran Sinaga, MA Al-Falah Jl. Ir. H. Juanda Lingk. I Kel. Karya Jaya Saiful Bahri Sinaga Telaga Zam-zam Kecamatan Sidikalang Drs. MahruddinAndry, MH
  • 13. 16 Daftar Khatib Shalat Jumat WASPADA Jumat 13 November 2009 MEDAN AREA Amaliah Jl. Amaliun Gg. Bandung Kota Maksum II Drs. Marwan Tanjung Al-Chairat Jl. A.R. Hakim Gg. Sederhana No. 22 Al-Hidayah Jl. A.R. Hakim Gg. Sukmawati Al-Huda Jl. Gedung Arca Gg. Jawa No. 46 Drs. Z. Arifin Gunawan, MA H. Naziruddin Idris, Lc Drs. Supardi Lubis Al-Ihsan Jl. Bromo Gg. Sukri No. 2 Kel. Tegal Sari II Drs. Ahmad Sukron Al-Ikhwanul Wathan Jl. A.R. Hakim Gg. Langgar Drs. Darwis Harahap Masjid Amr, Masjid Pertama Di Mesir Al-Ikhlash Taqwa Jl. Medan Area Selatan No. 129 Ahmad Khawari Al-Ikhwaniyah Jl. Utama/Amaliun Gg. Tertib Nol 15 H. Burhanuddin Parinduri, BA Masjid Amr ibn al-As aslinya dibangun Al-Makmur Jl. A.R. Hakim Gg. Langgar No. 25 Drs. H. Syamsuddin Panarik tahun 642 M sebagai pusat ibukota Mesir Al-Misbah Jl. A.R. Hakim Gg. Langgar/Dame No. 27 Drs. Asroruddin Saidi Chalid Ibnul Walid Jl. Rakhmadsyah No. 366 Drs. H. Muslim Putra yang baru didirikan, Fustat. Struktur Istiqlal Jl. Halat No. 53 Drs. H. Nazaruddin Idris, Lc orisinalnya merupakan masjid pertama Jamik Jl. M.A. Selatan No. 289 Kel. Surakamai-I Drs. H. Harmyn Tanjung Jamik Jl. Sutrisno Gg. Damai I No. 6 Kel. Komat I Drs. H. Zainal Arifin yang dibangun di Mesir, sekaligus yang Jami’ Darul Ikhlas Jl. Batu No. 13 Drs. Mas’ud Panjaitan pertama di benua Afrika. Jami’ Taqwa Jl. A.R. Hakim Gg. Langgar No. 8A Rusydi Khairiyah Jl. Rahmadsyah Gg. Subur 192 Irwan Syahputra, S.Ag, MA Masjid dibangun di lokasi tenda koman- Muslimin Jl. Selam II No. 47 T. Syarifuddin, S.Ag dan tentara Islam yang merebut daerah itu,  Muslimin Jl. Dr. Sun Yat Sen No. 71 Kota Matsum I H. Ismail Malik Muslimin Jl. Gedung Arca Gg. Jawa No. 3 Drs. H. Sanadi Sitorus Amr ibn al-As. Perguruan Ketuhanan Jl. Puri Gg. Perguruan No. 4 Drs. M. Yunus Daulay Amr ibn al-As, atas perintah Khalifah Silaturrahim Jl. Emas No. 10 Mahmuddin, BA Silaturrahim Jl. Bromo Gg.Silaturrahim Kel. T.Sari III Drs. Syahman, H.S. Umar menjadi penakluk pertama Mesir. Syekh Hasan Maksum Jl. Puri Gg. Madrasah Drs. Usman Hasibuan, SH Pada 641, sebelum bersama pasukannya Taqwa Jl. Bromo Gg. Taqwa No. 11 Drs. Budiman Taqwa Jl. Megawati Drs. Mario Kasduri, MA menyerang ibukota Alexandria,  Amr Taqwa Ar-Rahim Jl. Utama Gg. Ampera I No.240AR Drs. Zulkarnaen, MA mendirikan tenda di sisi timur Sungai Nil, Taqwa Jl. Demak No. 3 Maulana Siregar, S.Ag, MA Taqwa Lawang Jl. Gedung Arca Gg. Sehat No. 8 H. Baharuddin Isa di utara delta. Diceritakan, menjelang MEDAN AMPLAS bersiap untuk berperang seekor merpati Amaliyah Jl. K.H. Rivai Abdul Manaf Nasution No.83 Drs. Suramin Hadi bertelur di tendanya. Ketika Amr kembali Al-Hidayah Mapolda SU Jl. S.M.Raja Km.10,5 No.60 Drs. H. Maratua Simanjuntak dengan kemenangan, dia harus menetapkan Al-Hilal Asrama Widuri Eks Brigif 7 Jl. S.M. Raja Drs. Ramli, A.T. lokasi untuk ibukota baru, karena Umar Al-Muhajirin Jl. Bajak II H Gg. Nasional No. 100-D H. Salman Al Farisyi, MA Al-Waqif Jl. Sempurna Kel. Sudirejo I H. Jalaluddin, AM, MA mengharuskan tidak boleh di Alexandria Hijratur Ridho Jl. Selamat Ujung Gg. Subrah No. 12 H.M. Silahuddin, S.Pd.I yang jauh. Amr menjadikan tendanya Ikhwanul Muslimin Jl. Swadaya Lingk. XVI Marindal Rafdinal, S.Sos, MAP Jami’ Harjosari Jl. S.M. Raja Km. 6,5 No. 21 Drs. H. Burhanuddin, P. sebagai pusat kota baru, Fustat, atau Misr Kampus UNIVA Jl. S.M. Raja No. 10 Komp. UNIVA Agusman Damanik, S.Ag, MA al-Fustat,yang artinya Kota Tenda. Bela- Nurul Islam Jl. M. Nawi Harahap Drs. Suramin Hadi Nurul Iman Jl. S.M. Raja Km. 09 Timbang Deli Hasbi Almawardi Lubis, S.Pd.I kangan, Masjid Amr dibangun di lokasi itu. Nurul Barkah Jl. Selambo IV No. 29 Drs. M. Al Farabi, M.Ag Denah asli masjid segi empat sederhana, Nurun Nabatiyah Jl. S.M.Raja Komp.Kantor Kehutanan Drs. Fahmi Ahmad Ramadhan Jl. Pertahanan No. 37 Kel. Timbang Deli Asrizal Tanjung, SHI panjangnya 29 meter dan lebarnya 17 Salman Jl. STM. Kel. Sitirejo II Drs. H.M. Hafiz Yazid meter. Dindingnya dari tanah liat dan batu, Raya Taqwa Jl. S.M.Raja Km.5,5 No.1 Kel.Harjo Sari Drs. Mustamam Batubara, MA Taqwa Jl. S.M. Raja Gg. Pulau Harapan No. 1 B Junaidi, S.Pd.I, M.SI langit-langitnya rendah dengan tiang-tiang MEDAN BARU dari pohon kurma yang dibelah. Atapnya Agung Jl. Pangeran Diponegoro No. 26 Drs. H. Sangkot Saragih dari daun kurma, sedangkan lantainya Al-Amanah Komplek GKN Jl. P.Diponegoro No. 30-A Drs. H. Suparmin Pareh tanah. Tanpa hiasan dan tanpa menara. Al-Hasanah Jl. Letjend. Jamin Ginting No. 314 H. Murtadho Sulaiman, S.Ag Al-Ikhlas Jl. Sei Padang No. 129 Ummul Aiman, SH Ukurannya cukup besar untuk menampung Dakwah Jl. Dr. Hamzah No. 2 Kampus USU H. Taufiq Haris, Lc pasukan Amr shalat berjamaah. Muslimin Jl. Batang Serangan No. 93 H. Zulfikar Hajar Nurul Muslimin Jl. DR. TD. Pardede No. 42 Drs. M. Sholihul Amri Masjid ini dibangun kembali secara Nurul Huda Jl. Djamin Ginting Km. 8 Kwala Bekala Junaidi Arshad, SHI menyeluruh pada tahun 673 oleh Nurul Huda Jl. Sei Serayu No. 38 Drs. H.R. Taufiq Nurul Huda Jl. K.H. Wahid Hasyim Asrama Brimob Drs. Ali Asri Mu'awiyah, yang menambah empat menara Taqwa Kampus II Jl.Setia Budi No.79-B/Jl.Sei Serayu Dr. H. Zulhadi, MA di setiap sudut masjid dan memperluas MEDAN BARAT ukurannya dua kali lipat. Penambahan At-Taqwa Jl. Puteri Hijau No. 14 Drs. H. Mustamir menara-menara itu memungkinkan suara Al-Furqan Jl. Karya II Kompleks Ex Kowilham Kel.K.B. H.M. Nasir Al-Hasanah Inna Dharma Deli Jl. Balaikota Drs. H. Abidin Azhr Lubis azan terdengar jauh ke semua arah. Al-Istiqomah Jl. Putri Hijau No. 01 Komp. Deli Plaza Ahmad Junaidi Pada tahun 698 masjid kembali diperluas Al-Jihad Jl. Kom. Laut Yos Sudarso/Jl. Pertempuran Drs. Sarwo Edy, M.Ag Al-Muttaqin Jl. Karya No. 41 Kel. Sei Agul Drs. H. Muchlis Nasution dua kali lipat dan perluasan ke ukurannya Al-Massawa (Arab) Jl. Temenggung (Arab) No. 2,4,6 Drs. Mulkan Daulay yang sekarang terjadi pada tahun 827, Baitus Syifa RS. Tembakau Deli PTP Nusantara-II Jumanah Nasution, S.Ag Haji Maraset Jl. Sei Deli No. 139 H. Heri Adlin, Lc menjadi 120 x 112 meter. Jami’ Jl. Merdeka No. 3 Pulo Brayan Kota Drs. H. Ahmad Taufiq, SH Jami’ Jl. Kejaksaan Ujung H. Jamaluddin Juned, Lc Jami’ Ash-Shalihin Jl. S.M. Raja No. 178-A A. Syafi’i, S.HI Halaman dalam Masjid Amr, dengan tempat Nurul Hidayah Jl. Danau Singkarak Gg.Masjid Lingk. I Drs. Ponidi Sabari wudhuk berkubah (foto kanan atas), pintu Nurul Islam Jl. Karya Lk.VIII No.203 Kel.K.Berombak Drs. H. Nasrun Jami, MA Lama Jl. Mesjid Gg. Bengkok No. 62 Kel. Kesawan Drs. H. amlan Y. Rkt., MA gerbanbnya (kiri bawah) dan ruangan shalat di Rabithatul Muslimin Lingk. 14 Kel. Glugur Kota Drs. Ky. Maragading sayap kiri masjid (foto kanan bawah) Syuhada Komp. Trikora Jl. Danau Toba No. 2 Drs. Mukhsin Yahya (m04, dari berbagai sumber) Taqwa Jl. Karya Gg. Madrasah No. 24 Gunawan, S.Pd.I MEDAN BELAWAN Al-’Aqabah Jl. Taman Makam Pahlawan G. Arang H. Mahmud Sholeh, Lc Jami’ Belawan Jl. Selebes Belawan H. Zulkarnain Namiroh Asrama Haji Embarkasi Medan Drs. H. Khaidir Tanjung Al-Hasanah Jl. Teratai No.17-A Lingk.V Kel.Sari Rejo Drs. Yusuf As’adi Nurul Aldys Jl. Karya Bakti No. 34 Pkl. Masyhur Mukhlis Mu’az, SHI Baitussalam Kosek Hanudnas III Drs. Ahmad Suhaimi, MA MEDAN DELI Nurul Falah Jl. Eka Rasmi 42 Kel. Gedung Johor Drs. H.M. Selian Bakti Jl. Mongonsidi Baru I No. 11 H. Darwin Zainuddin, MA Amalyatul Huda Jl. Nusa Indah No.22-A Kel.Tg.Mulia Drs. Labib Maulana Silaturahmi Jl. Brigjen Zein Hamid Ling. XVI G.Wakaf Drs. Ali Imran Sinaga Dirgantara Lanud Jl. Imam Bonjol No. 52 Drs. H. Ulumuddin Hamsyi Ar-Ridho Komplek TNI AL Barakuda Tg. Mulia Hilir Nurtuah Tanjung, S.Ag Sunnah Rabithah Jl. Karya Darma Pkl. Masyhur Mawardi Hidayatullah Jl. DC. Musi Lingk. I Kel. Sukadamai Sarman, S.Ag Ar-Rakid Jl. Kol. Laut Yos Sudarso Ibnu Saud Silaturrahim Jl. Antariksa No. 64 Kel. Sari Rejo Drs. Indra Budiman MEDAN KOTA Taufiq Jl. Pendidikan Gg. Taufiq No. 17-D H. Romalis As-Sa’adah Jl. Aluminium IV Gg.Tawon Tg. Mulia Mahyudi, S.Ag Al-Amanah Jl. K.L.Yos Sudarso Km. 6,8Kel.Tg.Mulia Maimun Elba Al-Hidayah Jl. Saudara Kel. Sudirejo-II Drs. Ahmad Wazir Al-Hasanah Jl. Tanjung Bunga II Kel.Sudirejo II Drs. Son Haji Harahap MEDAN SELAYANG Al-Ikhlas Jl. Aluminium III Kel. Tg. Mulia Drs. H. As’ad Marlan, M.Ag Al-Ikhlas Complek Deli Raya Kel. Titi Papan H.M. Ali Nasution, Lc, M.Ag Al-Huda Jl. Kemiri III No. 28 M. Yusuf Marpaung, S.HI Al-Arif Kompl. Tm.Setia Budi Indah II Blok III No.136 Surianda, S.Ag Al-Munawwarah Jl. Pulau Batam No. 1 Drs. H. Musa Yahya Al-Ikhlas Jl. Salak No. 09 Drs. Zulkifli Al-Ghufron Jl. Bunga Wijaya Kesuma Pasar IV Ramli Kardi Al-Mustaqiem Kel. Tg. Mulia K.H. M. Abd. Syukur Al-Mashun Medan Deli Jl. Sisingamangaraja H.M. Nasir, Lc, MA Al-Ghufron Jl. Suka Baru No. 21 Kel. P.Bulan Drs. Mahyudin Daulay Al-Syarifah Jl. Metal Gg. Rukun Ling. 18 Tg. Mulia Parentah Lubis, S.Ag Baiturrahim Jl. Pelajar Timur Gg. Darmo No. 5 Darwin Pasaribu, S. Ag Al-Ikhlas Jl. Raharja No. 25 Kel. Tg. Sari Drs. Edi Purnomo Jamik Jl. K.L. Yos Sudarso Km. 6,2 H. Chairuddin, Lc Da’wah Jl. Sakti Lubis Gg. Amal No.5 Kel. Sitirejo-I Drs. H.M. Syukur Abrazain Al-Ikhlas Pasar VII, P. Bulan Drs. Wahid Hasan Jami’iyyatush Shoolihiin Jl. Almunium I Lk. XIII Fachri Isnomo, M.Ag Muslimin Jl. Air Bersih Lingk. III Kel. Suderejo I Drs. Usman Batubara Al-Istiqomah Jl. Sei Asahan Gg. Masjid No. 3 Drs. Hasanul Arifin Nurul Iman Jl.Sidomulyo Ujung Lingk. XXVI Tg.Mulia Parlaungan Harahap Mua’llimin Jl. S.M. Raja Kp. Keluarga No. 33 Drs. H. Usman Ismail Al-Muttaqin Jl. Setia Budi Gg. Tengah No. 11 Agisnirodi H, S.Ag, S.Pd.I Ma’ul Hayah PDAM Tirtanadi Jl. S.M. Raja No. 1 Prof.DR.H. Hasballah Thaib, MA Al-Muhtadun Jl. Karya Sembada No. 179 Drs. H. Lukman Hakim MEDAN DENAI Islamiyah Jl. Jati 3 No. 85 Teladan Timur Drs. Muhyiddin Maskur Jami’ Jl. Psr I Lingk. VIII Tg. Sari Drs. H. Mhd. Iskhak Ibrahim ‘Arafah Jl. Boromo Ujung/Jl.Selamat Gg.Mulia No. 3 Drs. H. Zahiruddin Nasution Jami’ Teladan Jl. Teladan/Gembira No. 2 Juliadi, BA Muslimin Jl. Setia Budi Kel. Tg. Sari Heri Fitrian, S.Sos.I Ar-Ridha Jl. Camar 18 Perumnas Mandala Drs. A. Ridwan Sitorus Jamik Jl. Air Bersih Gg. I Kel. Sudirejo-I Drs. Jamaluddin Nurul Mukmin Jl. Bunga Kantil 18 Psr VII Pd. Bulan H.M. Azhar Al-Ansor Jl. Raya Tenggara Gg. Ansor Drs. H. Anwar Noor Siregar Pahlawan Muslim Jl. Pencak Drs. H. Hafidz Ismail Nurul Mukmin Jl. Bunga Mawar No. 46 H. Tintin Lingga Al-Fajar Jl. Harapan Pasti No. 50 Kel. Binjai Drs. H. Indra Harahap Ridho Bakti Jl. Air Bersih Lingk. IX Kel. Sudirejo-I Drs. Hamzah Harahap, SH Nurul Mukminin Jl. Kenanga Raya No. 10 Tg. Sari H. Dhanil Harun, SH Al-Hidayah Jl. Menteng Indah VI H Blok D7 Drs. H. Abdul Rahman Raya Pusat Pasar Drs. H. Askolan Lubis, MA Nurussalam Jl. Bunga Cempaka No. 53 P.B.S. II Drs. H.M. Nur Hasibuan Al-Hidayah Jl. Bromo Gg. Masjid Al-Hidayah Drs. H. Manaon Batubara Silaturrahim Jl. Pelajar No. 58 Kel. Teladan Timur Drs. H. Sempurna Silalahi Nurul Huda Jl. Bunga Asoka No. 117 Asam Kumbang Drs. Ramli Nasution Al-Hasanah Jl. Merpati I No. 1 Kel. Kenangan Baru H. Hasan Basri Lubis, Lc Setia Amal Jl. Sakti Lubis Gg. Pegawai Kel.Sitirejo Drs. Sariman Alfaruq Salamiyah Jl. Bunga Wijaya Kesuma, 58 D Pasar IV H. Sholahuddin Al-Mukhlishin Jl. Bromo Ujung/Jl.Selamat Kel. Binjai Jamaluddin, S.Pd.I Taqwa Jl. Mahkamah K. 36-C Kel. Masjid Mustafa Lubis, STIQ Taqwa Jl. Setia Budi Pasar I/Abd. Hakim No. 2 Drs. Asrizal Al-Mukhlishin Jl. Enggang I Perumnas Mandala H.M. Darwis Usman, Lc Tarbiyah Simpang Limun Drs. H. Yazid Syamsuddin, Lc Taqwa Jl. Bunga Wijaya Kesuma Psr IV Gg. M.Taqwa Drs. Avandi Al-Muslimun Jl. Bromo (Rawa Sembilang) Gg.Kurnia Drs. Effendi Sipayung Thawalib Jl. S.M. Raja Gg. Isa No. 7 Drs. Ade Mustahdy Ali Taqwa Jl. Sembada No. 25/33 Drs. Kayat Al-Quba Jl. Denai/Rawa No. 233B Kel. Tegalsari I Drs. Kemal Fauzi MEDAN LABUHAN MEDAN SUNGGAL Baiturrahman Jl. Medan Tenggara VII No. 42 Drs. M. Syarawi Muhanjis Jannatul’alim Jl. Pancasila/Rawa Cangkuk IV No. 1 Drs. Ahmad Azizi, A.M. Ash-Shobirin Jl. Pancing V Lingk. III Kel. Besar Muhyiddin Ar-Rahmat Jl. Mesjid No. 20 Dusun III Desa Helvetia Zulhamsyah Lubis, S.Pd.I Nurul Iman Jl. Rawa Lr. Sedar Drs. H. Syamsul Rizal, P. Al-Husein Jl. Raya Griya Martubung Kel. Besar Ahmad Syafi’i Nasution, S.Ag Ar-Ridha Jl. Darussalam No. 52-A Kel. Babura Drs. H. Ismail Zannah Nurul Hidayah Jl. Tangguk Bongkar II No. 28 H. Arif Mhd. Erde, S.Pd.I Al-Mukarramah Kampung Besar Darat Kel. Martubung Drs. Adlansyah Ar-Ridha Jl. Tut Wuri Handayani Perkamp.Kodam I/BB Burhanuddin Harahap, S.Ag Nur Hidayah Jl. Datuk Kabu Gg. Masjid No. 11-C H. Bahauddin Nasution, Lc Baitul Ikhwan Jl. T. Lestari 12/198 Griya Martubung Drs. M. Nizar Rangkuti Al-Basyir Jl. Garuda No. 78B Sei Sikambing B Drs. Tohiruddin Pohan Taqwa Jl. Bromo Gg. Aman Zailani, S.Pd.I Nurul Ikhwan Jl. Helvetia By Pass Gg. Masjid No.234 Drs. M. Mukhtar Hasyim, S.Pd Al-Badar Jl. Binjai Km. 6,8 Medan Drs. Asman Ali Nur Harahap Taqwa Jl. Mandala By Pass No. 140 Drs. Satiman Nurul Hidayah Jl. Veteran Lr. Sukoharjo No. 27-A Drs. H. Azhari Tanjung Al-Falah Jl. Murni No. 27 Tg. Rejo Drs. M. Yusuf Tanjung Taqwa Jl. Pancasila Gg. Masjid No. 1 Kel. T.S.M.III Drs. Zulkarnain Lubis, MA Nurul Khairiyah Jl. Veteran Ujung Pasar X M. Syahri Al-Hasanah Jl. Stasiun No. 4 Dusun I Tg. Gusta K.H. Syaiful Bahri MEDAN HELVETIA MEDAN MAIMON Al-Huda Jl. Perjuangan No. 44 Tg. Rejo Drs. Agus Suhaedi, S.Pd.I Al-Hikmah Jl. Kiwi No. 7 Sei Sekambing B. Drs. H. Mahmuddin Sirait As-Syarifah Jl. Pembangunan Komp. Pondok Surya Drs. H. Lukman Hakim ACC Jl. Palang Merah No. 2 Drs. H.M. Yahya Al-Hafiiz Jl. Pinang Baris No. 142 Dahlil Akbar, SE, HHC Attholibin Husni Jl. Veteran Gg. Utama Pasar 5 Drs. H. Ilyas Halim, M.Pd Abidin Jl. Brigjen Katamso Km.III No.420 Kel.Kp.Baru H. Ruslan Efendi, Lc Al-Ikhlas Jl. Binjai Km. 16.5 Dusun I Aman Damai H.M.U. Supardi Al-Amal Jl. Banten Gg. Amal Dusun X M. Nur Jambak Al-Husna Jl. Teratai M. Nasir, S.Ag Al-Ikhwan Eks Komplek PTP III Desa Lalang Alamuddin, S.Ag Al-Falah Jl. Cendana Blok 17 Perumnas Helvetia Drs. H.M. Ilyas Nasution Al-Muhajirin Jl. Letjend. Suprapto No. 2 Drs. H. Agus Tahir Nasution Al-Islamiah Jl. Binjai Km.14,5 Gg.Gembira Diski Drs. Misnan Al-Falah Jl. Palem Raya Perumnas Helvetia Drs. Abdul Majid Al-Mujtahidin Jl. Brigjen Zein Hamid Gg.Lori Kp.Baru Ahmad Zaini Al-Istiqomah Jl. Raya Medan-Binjai Km.11,5 Dusun I Drs. Edy Trisno Al-Furqoan Jl. Kemboja Raya No. 02 Perum Helvetia Drs. H. Khairuddoroin Darul Ali Jl. Brigjen Katamso Gg. Nasional No. 20 H. Muda WAli, S.Pd.I Al-Irma Jl. Rajawali Sei Sikambing-B Drs. Rustam Harahap, S.Pd.I Al-Hidayah Jl. Bakti Luhur No. 21 Kel. Dwikora Drs. M. Labib Maulana Jami’ Ash-Sholihin Jl. Brigjen Katamso No. 208 H.A. Muaz Tanjung, S.Pd Al-Jihad Jl. Sunggal No. 129 H. Zainal Arifin, MA Al-Ikhlas Jl. Klambir Lima Gg. Bahagia Sarwo Edy Harahap, S.Ag Jami’ Kamp. Baru Medan Jl.Brigjen Katamso No.53 H.M. Yazid Thaib, SH Al-Jariah Jl. Gagak Hitam No.117 Sei Sikambing-B Affan Suedi, S.Ag, MA Al-Ikhlas Jl. Pembangunan Gg. Melati No. 16 Drs. Idrus Uteh Jami’ ‘Aur Jl. Kampung Aur Kel. Aur Drs. H.Agus Taher Nasution Al-Muttaqin Jl. Hanura No. 10 Kel. Tanjung Rejo Mayor Caj. Drs. H. Wendrizal Al-Ikhlas Jl. Jongkong No. 1A Komp. Dolog H.M. Said Muslimin Jl. Brigjen Katamso Lingk. II Pantai Burung Drs. Su’it Al-Muttaqin Jl. Masjid No. 51 Lingk. II Helvetia Darwinsyah Pasaribu, S.Ag Al-Ikhlas Jl. Teratai II Blok 18 Perumnas Helvetia Drs. Idris Ginting PT.Bank Negara Indonesia (Persero) Jl. Pemuda No.12 H.M. Yunus Rasyid, SH, M.Hum Al-Muhtadin Jl. Setia Budi No. 29 Tanjung Rejo Drs. H. Adlan Sirait Al-Ishlah Jl. Kapten Muslim No. 54-A Drs. A. Wahab Kalimantan Thoyyibah Jl. Multatuli Lingk. V No. 64 H. Ardiansyah, MA Al-Muhajirin Kompl. BBLKI Jl. Gatot Subroto Km.7,8 Effendi Jafar Al-Jihad Jl. Veteran Pasar 8 Helvetia Manunggal Mhd. Azmi MEDAN MARELAN Al-Musabbihin Jl. Masjid Al Musabbihin Blok C TSI Drs. H.Khairuman Arsyad,M.Hum Al-Mustaqim Jl. Kapten Muslim No. 226 Drs. H. Burhanuddin Damanik Al-Mu’awanah Jl. Puskesmas I/Jl. Seroja Drs. Ali Amnar Tambunan Al-Mukhlisin Jl. Bakti Utara No. 21 Tg. Gusta Drs. Hammim Rangkuti Al-Muslimin Jl. Masjid Pasar V Kel. Rengas Pulau Zulkarnain Al-Munir Jl. Karya Baru No. 07 Tanjung Rejo Khairul Harahap, S.Pd.I Al-Muhajirin Perumahan Bumi Asri Helvetia I Drs. Zulkarnain Ar-Ridha Jl. Platina Raya Lingk. 21 Kel.Rengas Pulau Drs. Abdul Jalil Darul Huda Jl. Kasuari No. 53-55 Sei Sikambing-B Drs. H. Syarifuddin, D. Al-Masturah Jl. Binjai Km 7,8/Jl. Sekolah No. 29 Drs. H.K. Akmal Rangkuty Taqwa Jl. Marelan Raya Pasar 3 Timur Drs. Tenerman Istiqomah Jl. Binjai Km. 7.2/Perwira No. 20 Dr. H. Marwan Yahya Darussalam Jl. Asrama No. 11 Edi Syahputra Siregar, S.Ag MEDAN PERJUANGAN Istiqamah Jl. Dr. Mansur No. 155 Kel. Tg. Rejo Drs. H. Muniruddin, M.Ag Istiqomah Jl. Amal Luhur No. 86 Drs. H. Abdul Hadi Isti’adah Jl. Amal No. 4 Kel. Sunggal Drs. Hakimuddin Nurul Iman Jl. Bambu No. 37 Pasar IV Zulfikar Husni, S.Pd.I Ar-Rahmah Jl. Gurilla Gg. Melati No. 5 Drs. Abdullah Djamil, MSI Jamik Jl. Pinang Baris No. 19 Kel. Lalang Drs. H. Zainal Arifin Ubudiyah Jl. Klambir Lima Lingk II Tg. Gusta Amri Lubis Al-Amin Jl. Prof. H.M. Yamin SH, 482 Musa Abdul Ghoni, S.Ag Jamik M.Jayak Jl. Gatot Subroto Km. 5,5 No. 184 H. Fuad Husain, Lc Shilaturrahmi Jl. Gaperta Gg. Sekolah, 120 Drs. H. Samiun Mas Al-Aminin Jl. Pahlawan/Sakti Kel. Pahlawan Akmal Al-Kautsar, S.HI Mukhlisin Jl. Darussalam/ Sei Rokan Dr. H. Ramli A. Wahid, MA Taqarrub Jl. Darussalam No. 24 H.M. Muzakir, MA Al-Falaah Jl. Ibrahim Umar No. 3 H. Ali Amran Zakaria, Lc Nurul Huda Jl. Garuda No. 29 Sei Sikambing-B Drs. H. Irham Maulana Hsb. Taqwa Sukadono Jl. Pemasyarakatan Gg. M.Taqwa Drs. Syamsuddin Amin Al-Huda Jl. Malaka No. 117 H. Hanafi Ismet Fahmi, Lc Nur Rukiah Jl. Pungguk No. 42 Kel. Sei Sikambing-B Syaiful Aziz Taqwa Tanjung Gusta Jl. Setia No. 30 Nuzli Rahmendra Al-Ikhlas Jl. Setia Jadi Gg. Masjid Drs. H. Abu Bakar Adenan Srg,MA Nurul Amaliyah Jl. Jend. Gatot Subroto Km. 9 Drs. H. Khairul Anwar Taqwa Helvetia Jl. Kamboja Raya no. 319 Blok 4 Zulkifli Rangkuti, S.Ag Al-Muslim Jl. Pelita VI Gg. Serayu No. 10 Drs. Hasrat Efendi Samosir Riyadussholihin Lingk. XIV Kel. Sei Sikambing-B Drs. Lili Suheri Taqwa Jl. Kapten Sumarsono, Gg. Safar Drs. Suprapto Al-Muslimin Jl. Gerilya No. 1 Drs. Tarmizi, AR Shafiyyatul Amaliyyah Jl. Setia Budi No.191 Tg.Rejo Drs. H. Syu’aibun, M.Hum Taqwa Jl. Kapten Muslim Gg. Jawa Drs. Syahrul, MA Al-Majidiyah Jl. Prof.H.M. Yamin SH Gg. Belimbing Muhammad Zainul, S.Ag Syuhada Jl. Balam Lingkungan XIII Sei Sikambing-B Drs. Ngadiman G., S.Pd.I MEDAN JOHOR Hidayatul Ihsaniyah Jl. Sentosa lama Gg. Aman No.5 Drs. Marwanuddin, S. Silaturrahim Jl. Perintis Kemerdekaan D.SeiSemayang DR. Ir. Abdur Rauf, MS Istiqomah Jl. Bambu Runcing/Pahlawan Drs. Pantis Simamora Taqwa Jl. Merpati Gg. Mushollah Sei Sikambing-B Drs. Khalid Musa Amanah Jl. Eka Bakti Ujung Lingk. IV Kel. Gd. Johor Drs. H. Jalaluddin Hasibuan Ikhwaniyah Jl. M. Yacub No. 3 Drs. H. Tarmizi Lubis, S.Pd.I Taqwa Jl. Garuda Sei Sikambing-B Drs. Khaidir Sulaiman Arrahman Jl. Brigjen Zein Hamid Kel. Titi Kuning H.P. Siregar, BA Ikhsaniah Jl. Gurilla No. 31-A Kel. Sei Kera Hilir-I Adenan Ritonga Taqwa Jl. Taqwa Gg. Pendidikan Tg. Rejo Drs. Bahrin Manik Amaliyah Perumahan Citra Wisata Drs. Nazaruddin Ibnu Sina RSU DR.Pirngadi Jl. Prof.H.M.Yamin No.47 Effendi Sadly, SE Assyafi’iyah Jl. Suka Tari No. 9 Indra Laksamana, S.Ag Jamik Ubudiyah Jl. Pelita-I Gg. Tangga Batu 11 Drs. H. Romsil Harahap MEDAN TIMUR Ar-Raudhah Komplek Risva I Blok V Sofwan Harahap, S.Ag Jami’ Sentosa Jl. Sentosa Lama Gg. Perwira No. 1 Drs. H.A. Sanusi Luqman, MA Ainul Iman Jl. Eka Warni I Kel. Gedung Johor Drs. Mauddin Nasution Malikus Saleh Jl. Gurilla No. 10 Kel. Sei Kera Hilir H.M. Nur Abubakar Amal Jl. Ngalengko Lr. Saudara No. 11 Drs. Adi Sucipto, M.Ag Annazhirin Jl. Karyawisata Gedung Johor Drs. H. Syahlan Harun Syuhada Jl. Pahlawan No. 11 Kel. Pahlawan Drs. Khoiruddaroin, MA Amal Ridha Jl. Cemara P. Brayan Bengkel Baru Drs. H. Thaharuddin, AG Al-Amin Jl. Eka Surya Gg. Eka Kencana H. Agus Rizal Koto, SHI Thaharah Jl. Pelita II No. 29 Kel. Sidorame Barat M. Suud Tambunan, S.Ag Amaliyah Jl. Perwira II Pulo Brayan Bengkel Drs. Asran Nasution Al-Badar Jl. Karya Dharma No. 19 Kel. Pkl. Masyhur Azman, SHI Arrahim Jl. Purwosari Gg.Puskesmas P.Brayan Bengkel Drs. Juliardi Al-Hidayah Jl. Karya Jaya Gedung Johor Drs. Ali Imron, R. MEDAN PETISAH Ash-Sholah Jl. Pendidikan No. 39 Kel. Glugur Darat I Drs. Bahari Ahmad Al-Huda Jl. Eka Surya Psr V Gg. Sidodari Ged. Johor Drs. Zarlan Lubis Annas Komplek Diskes Jl. Ibus Raya/Jl. Rotan Drs. Syahrinal A. Lubis Al-A’la Jl. Pembangunan I No.46 Krakatau Kel.Glugur Syarwan Nasution, S.Ag Al-Ikhlas Jl. STM Suka Ikhlas Drs. Syahron Husein Ar-Ridhwan Jl. Abd. Hamid No.28 Kel. S.P. Tengah Drs. M. Bakri Pasaribu Al-Barkah Jl. Setia Jadi Kel.Glugur Barat I Drs. Darfikri Baiturrahman Komp Perum Johor Indah Permai I Drs. H. Syamsuddin Hasan As-Syahaadah Jl. Sikambing Belakang No. 18 Drs. Efendy Arief Al-Furqoan Jl. Asahan No. 78 Kel. Sidodadi Drs. Rasmidi Al-Ikhlas Jl. Eka Suka Lingk. XIII Gedung Johor H. Abdul Karim Rangkuti, BA Asy-Syura Jl. Surau No. 16 Kel. Sei Putih Timur-I Usmar Chan Al-Hidayah Jl. Jawa No. 3 Kel. Gg. Buntu Drs. Syahnin Siregar Al-Ikhlas Jl. Karya Tani Lingk. VIII Pkl. Masyhur Drs. H. Indra Harahap Al-Hidayah Jl. Periuk Gg. Masjid No. 2 H.A. Daud Lubis Al-Iman Jl. Sidang Raya, Komp. DPRD Tk. I P.B.B. Drs. H. Husni Ritonga Sirait Al-Issyah Hakim Jl. Karya Jaya/Namo Rambe Psr IV Drs. Syarifuddin Hasan Al-Ihsan Jl. PWS No. 48 Kel. Sei Putih Timur II H.M. Zahari Lubis Al-Ikhwan Jl. Prajurit No.28 Gg.Bali Kel.Glugur Darat Drs. Adenan Ritonga, M.Ag Al-Muslimin Jl. Suka Luhur Kel. Suka Maju Prof. Usman Nasution Al-Mukaram Jl. Sikambing Gg. Citarum No. 58 M. Nuh Siregar, MA Al-Ihsan Jl. Jemadi No. 34 Drs. Soeparlan Al-Muhsinin Jl. Pintu Air Simp. Pos Yunus Kholish Nurul Hidayah Jl. Tinta No. 69 Kel. Sei Putih Barat Sagio Subroto Al-Ikhlas Hubdam-I/BB Jl. Timor No. 23 Drs. Syahruddin Nasri Hsb. Al-Muharram Jl. Eka Budi Gedung Johor Drs. H.A. Taufik Lubis Nurul Haq Jl. Listrik No. 12 Drs. H. Bahrum Saleh Hsb., MA Al-Ikhlas Jl. Umar No. 71 Kel. Glugur Darat I Drs. Muas Tanjung Al-Mahmudiyah Jl. Brigjen Hamid Km.5 Kel. T.Kuning Hendra Siregar, S.HI Istiqamah Pasar Petisah H. Abdur Rahman S., Lc, MA Al-Ikhlash Jl. Madiosantoso No. 197 Lingk. 14 Drs. H. Amrin Siregar Baitul Iman Jl.Karya Jaya Asrama Arhanud P.Masyhur Drs. H. Zul Akmal Nst., MA Istiqomah Jl. Abdul Hamid No. 70 Drs. Nur Al Jum’ah Al-Muslimin Jl. Brigjend Bejo/Cemara Gg. Rambutan Drs. Juanda Sirait Baiturrahmah Jl. Karya Jaya No. 101 Pkl. Masyhur Drs. H. Suaeb Saragih Raya Aceh Sepakat Jl. Mengkara No. 2 Drs. Muhammad Rafiq, MA Al-Mukhlishin Jl. G.B. Josua No. 8 Drs. Khairuddaroin, MA Baitussholihin Jl. Karya Bakti No. 71 Muhrodli Ubudiyah Jl. Kebun Bunga/Jl. Jend. S. Parman Drs. Ali Imran Skd. Al-Ma’ruf Jl. Sidorukun/Wartawan No.99 P.B.Darat II Drs. Asfan Abdullah Fajar Ramadhan Komplek Perum.Johor Indah Permai II H. Sugeng Wanto, MA Al-Waritsiin Jl. Bilal No. 71 Kel.Pulo Brayan Darat I Prof.DR. H. Muhd.Hatta,MA Muslimin Jl. Karya Jaya No. 120 Kel. Pkl. Masyhur Drs. Badu Amin MEDAN POLONIA Al-Quddus Jl. Pukat Harimau d/h Jl. Aksara No. 136 Drs. Mursalim Muslimin Jl. Eka Surya Pasar V Drs. Ahmad Syaukani Amaliyah Jl. Balai Desa Gg. Amal No. 43 H. Imam Muhdi Baiturrahman Jl. Gaharu Komplek PTPN-II Drs. Khairuddaroin Muttaqiin Jl. Luku I No. 42 Kel. Kwala Bekala Fery Syahbuddin, SHI Al-Hidayah Jl. Starban Kel. Sari Rejo Drs. H. Nasib Selmi Bustanul Huda Jl. Perwira I Lingk. VIII H.M. Thohir Ritonga, Lc
  • 14. WASPADA Jumat 13 November 2009 Sumatera Utara 17 Kota Zhuhur ‘Ashar Magrib ‘Isya Imsak Shubuh Syuruq Kota Zhuhur ‘Ashar Magrib ‘Isya Imsak Shubuh Syuruq Kota Zhuhur ‘Ashar Magrib ‘Isya Imsak Shubuh Syuruq Kota Zhuhur ‘Ashar Magrib ‘Isya Imsak Shubuh Syuruq Medan 12:11 15:33 18:11 19:22 04:42 04:52 06:09 Langsa 12:13 15:36 18:12 19:23 04:45 04:55 06:13 Sabang 12:24 15:46 18:21 19:32 04:57 05:07 06:25 Tarutung 12:10 15:32 18:11 19:22 04:38 04:48 06:06 B. Aceh 12:24 15:46 18:21 20:33 04:57 05:07 06:25 L.Seumawe 12:17 15:39 18:15 19:26 04:50 05:00 06:17 Pandan 12:10 15:32 18:12 19:23 04:39 04:49 06:06 T.Tinggi 12:09 15:31 18:09 19:20 04:39 04:49 06:07 Binjai 12:11 15:34 18:11 19:22 04:42 04:52 06:10 L. Pakam 12:10 15:30 18:10 19:21 04:41 04:51 06:08 Sibolga 12:10 15:32 18:12 19:23 04:39 04:49 06:06 Panyabungan 12:07 15:29 18:10 19:21 04:34 04:44 06:02 Bireuen 12:19 15:41 18:16 19:27 04:51 05:01 06:19 Sei Rampah12:09 15:31 18:09 19:20 04:40 04:50 06:08 Sidikalang 12:12 15:34 18:12 19:24 04:41 04:51 06:06 Teluk Dalam12:14 15:36 18:18 19:29 04:41 04:51 06:09 B. Pidie 12:18 15:40 18:17 19:28 04:50 05:00 06:18 Meulaboh 12:21 15:43 18:20 19:31 04:52 05:02 06:20 Sigli 12:21 15:44 18:19 19:30 04:54 05:04 06:22 Salak 12:12 15:34 18:13 19:24 04:41 04:51 06:09 G. Sitoli 12:15 15:37 18:17 19:29 04:43 04:53 06:10 P.Sidimpuan12:08 15:31 18:11 19:22 04:36 04:46 06:04 Singkil 12:14 15:36 18:16 19:27 04:43 04:53 06:11 Limapuluh 12:08 15:30 18:08 19:19 04:38 04:48 06:06 K. Jahe 12:11 15:34 18:12 19:23 04:42 04:52 06:09 P. Siantar 12:09 15:31 18:10 19:21 04:39 04:49 06:07 Stabat 12:11 15:33 18:11 19:22 04:42 04:52 06:10 Parapat 12:10 15:32 18:10 19:22 04:39 04:49 06:07 Kisaran 12:07 15:29 18:08 19:19 04:37 04:47 06:05 Balige 12:09 15:31 18:10 19:22 04:38 05:48 06:06 Takengon 12:18 15:40 18:17 19:28 04:50 05:00 06:17 GunungTua 12:07 15:29 18:09 19:20 04:35 04:45 06:03 Kutacane 12:14 15:36 18:14 19:25 04:45 04:55 06:12 R. Prapat 12:06 15:28 18:08 19:19 04:35 04:45 06:02 T.Balai 12:06 15:29 18:07 19:18 04:36 04:46 06:04 Sibuhuan 12:06 15:29 18:09 19:20 04:34 04:44 06:02 Dihisab oleh: Tim Ahli Badan Hisab dan Rukyat (BHR) Sumut Tapaktuan 12:17 15:37 18:17 19:28 04:47 04:57 06:15 Lhoksukon 12:16 15:38 18:14 19:25 04:49 04:59 06:16 DS Jalin Kerjasama Sister City Sejumlah Perusahaan Di T. Tinggi Dengan Shanwei LUBUKPAKAM (Waspada): Pemerintah Kabupaten Tidak Miliki UKL/UPL Deliserdangakanmelanjutkanprogramkerjasama kotabersaudara TEBINGTINGGI (Waspa- perusahaan berisiko tinggi lama perusahaan itu mencemari (Sister City) dengan Pemerintah Kota Shanwei yang telah terjalin da):Sejumlahperusahaanberada merusak lingkungan. Namun, Sei Kelembah. selama ini. di Kota Tebingtinggi, kata Kepala hingga kini perusahaan itu tidak UD Sumatera Tapioka, Kerjasama lanjutan ini akan ditandai dengan penandata- Kantor Lingkungan Hidup, ter- membuat UKL/UPL. tambah Lopulisa, karena tidak nganan naskah kerjasama yang akan dilaksanakan perwakilan nyata sejak lama tidak memiliki “Kami sempat bertengkar memiliki UKL/UPL, masuk kate- kedua Pemerintah daerah, demikian Ir. Irman, MSi, Kepala unit pengelolaan limbah dan unit dengan pimpinan perusahaan gori perusahaan hitam dalam Bappeda Kab. Deli Serdang Selasa (10/11) di Kantor Bappeda pengawasan limbah yang dikenal yang bertahan tidak melaksana- program peringkat kinerja pe- Kab. Deliserdang. denganistilahUKL/UPL.Padahal, kanketentuanitu,”cetusLopulisa. rusahaanatauProper.Perusahaan Penandatanganan naskah kerjasama antara Bupati perusahaan yang melanggar ke- Perusahaan itu enggan, aku dia, pengolahan ubi menjadi tepung Deliserdang diwakili H Zainuddin Mars Wakil Bupati Deli Serdang tentuan itu, telah melanggar UU karena berpegang pada Keputu- itu,karenatakmemilikiUKL/UPL atas nama Pemerintah Kabupaten Deli Serdang pada tanggal No.32 Ta-hun 2009 tentang Per- san Badan Koordinasi Penana- juga mencemari Sei Padang. 12 November 2009 di Kota Shanwei, RRC.(a05) lindungan dan Pengelolaan Ling- man Modal No.13/T/Industri/ Selainkeduaperusahaanitu,salah kunganHidupdanbisadikenakan 1990Tanggal 16 Januari 1990 ten- satu unit SPBU di Jalan Yos Su- Malam Lepas Sambut pidana 3 tahun dan denda hingga Rp3 miliar. tang Pemberian Ijin Usaha In- dustri Ketua Badan Koordinasi darso dalam tahap pembangu- nannya belum juga mengadakan Unsur Muspida Langkat Ir Leo Lopulisa H, MSi, Rabu (11/11), mengatakan beberapa Penanaman Modal yang waktu itu ditandatangani Sanyoto UKL/UPL. Padahal, aku Lopulisa, semuaunitSPBUyangberoperasi STABAT (Waspada): Bupati Langkat Ngogesa Sitepu mengha- perusahaan yang terdeteksi tidak Sastrowardoyo. di Kota Tebingtinggi, wajib me- rapkan agar semua pihak untuk lebih meningkatkan intensitas memiliki UKL/UPL, yakni PT. Padahal sesuai UU No.32 makai UKL/UPL dalam kegiatan pertemuan dan komunikasi di antara unsur Muspida. Martua Doli di Jalan Prof. Hamka, Tahun2009tentangPerlindungan usahanya. Tanpa kebersamaan sulit memberhasilkan tugas, kata Bupati Kel. Bulian, Kec. Bejenis, UD Su- dan Pengelolaan Lingkungan Terkait itu, pengusaha PT ketikamemberikansambutanpadamalamlepassambut3pejabat matera Tapioka di Jl. AH Nasu- Hidup, pelanggaran terhadap MartuaDoli,tidakbisadihubungi, muspida Langkat di Serambi Jentera Malay rumah dinas bupati tion, Kel. Brohol, Kec. Rambutan UKL/UPL sesuai Pasal 40 dan karena gerbang perusahaan itu di Stabat , Selasa (10/11) malam. dan unit SPBU JalanYos Sudarso, Pasal 100 Ayat 1, pengusahanya tertutup dan dicoba beberapa Malam lepas sambut pejabat muspida diwarnai dengan Kel. Lalang, Kec. Rambutan yang bisa terkena pidana kurungan 3 kalidiketuktidakadajawabandari saling memberikan cendera mata diawali dari Bupati Langkat saat ini dalam tahap pembangu- tahun dan denda hingga Rp3 dalam pabrik itu. Demikian pula beserta Ny. Nuraida Ngogesa serta sejumlah pejabat lainnya. nan. Ketiga usaha itu, merupakan milyar, terang Kakan LH Kota dengan UD Sumatera Tapioka. Pejabat lama yang dilepas yakni, Letkol Inf. A.Dimyati beberapa contoh unit usaha yang Tebingtinggi itu. Sedangkan di unit SPBU, tidak (mantan Dandim), AKBP Drs.H. Dody Marsidi,SH,MHum tidak memiliki UKL/UPL meski- PT Martua Doli, sebelumnya ada pekerja yang berani membe- (Mantan Kapolres) dan Febri Ardiansyah,SH,MH (Mantan Kajari). pun Kantor LH telah memerin- merupakan perusahaan yang rikan keterangan soal itu. Salah Sementara pejabat yang disambut masing-masing Dandim Waspada/Abdul Khalik tahkan pembuatan untuk itu. bergerakdibidangindustrisumpit seorang pekerja mengatakan pe- 0203/Lkt Letkol Inf. Widjanarko, Kapolres Langkat AKBP BELUM PUNYA UKL/UPL : Unit SPBU di Jalan Yos Sudarso terlihat dalam tahap pembangunan. Diungkapkan, PT Martua dan kertas kasar dari bambu.Tapi milik SPBU itu warga Medan dan Mardiyono dan Kajari Stabat Maju Ambarita SH.MH. (a01) Namun, SPBU itu diduga belum mengurus pembuatan UKL/UPL ke Kantor LH Kota Tebingtinggi. Doli bergerak di bidang pengo- kini mengalihkan usahanya me- sedang tidak berada ditempat. Foto direkam, Rabu (11/11). lahan bubur kertas, merupakan ngolahbuburkertas.Didugasejak (a08) Bank Sumut Stabat Serahkan PT IW Tak Terlibat Hadiah UMK Award STABAT (Waspada): Dalam memeriahkan HUT Bank Sumut ke48tahun2009,PimpinanBankSumutRantingStabatT.Mahmud Jefry sebelumnya menggelar kegiatan‘’Bank Sumut UMK Award’’. Diculik Dari Percut Sei Tuan, Pemalsuan Dokumen PT PLS Dari ribuan nasabah yang menggunakan jasa layanan di bank itu untuk kebutuhan modal usaha kecil dan mikro mereka seleksi untuk memberikan hadiah. Kategori usaha mikro, pemenang pertama Misdi dengan bidang usaha pembuatan kue kering. Pemenang kedua Hariani dengan bidang usaha Mayat Ditemukan Di Perbaungan MEDAN (Waspada): PT Ina Wood (IW) Tanjung Mo- rawa, Jusman Leo mengaku tidak terlibat apalagi merasa dibalik permasalahan antara perajin bordir dan pemenang ketiga Andika bidang usaha Hery Jusman dan Tomsihar PERBAUNGAN (Waspada) : Kamis(12/11) pagi. Medan guna keperluan visum. “Waktu 2 pria kurus itu masuk itu dan menemukan STNK Silaen dengan pihak PT PLS pembuatan tempe. Jasad Hasiolan saat ditemu- Menurut keterangan, para warung, mobil Kijang itu sudah Avanza hitam hingga keduanya Sementara kategori usaha kecil, pemenang pertama Khaidir Jasad Hasiolan Bakkara,60, (Panei Lika Sejahtera) pimpi- kan petugas Jahtanras Poltabes perampok bersenpi yang men- memperhatikan,” ucap Iben. tak berkutik. nan Budianto dan Susilo S se- dengan bidang usaha pembuatan keramik, pemenang kedua alias Tuan Takur warga Jalan Medan yang dipimpin Katimsus culik Tuan Takur dan melarikan Dari kejauhan, 2 pria kurus Naasnya, seorang pria kurus Acep Tateng dengan usaha pembuatan rangka sofa serta laku pemegang saham de- Tegal Sari, Lorong IX,Laut Poltabes Medan AKP Yoris Mar- ratusan surat tanah itu, dibekuk itu sudah curiga bahwa yang bercelana loreng, masuk ke wa- ngan Direktur, Prianto, yang pemenang terakhirWardianto dengan usaha pembuatan meubel. zuki, SIK dengan kondisi ter- saat asyik makan. Pengakuan datang polisi hingga langsung rung saat penangkapan ber-lang- Dendang, Kec.Percut Sei saat ini masih ditangani Dit Dijelaskan PltWakil Pimpinan Bank Sumut Stabat, Aladdin lungkup kedua kaki serta tangan Iben, warga setempat yang meli- melemparkan kunci kontak sung.Ternyata, dia juga komplo- Reskrim Poldasu. Marpaung, kemarin, (10/11), kegiatan juga juga merupakan Tuan, Kab.Deliserdang yang diikat ke belakang. hat penangkapan, saat itu 2 pria Avanza ke rerumputan. “Di da- tan kedua pria kurus itu. Dengan Jusman Leo juga mem- rangkaian program Pemimpin Devisi Kredit di Medan. Hadiah diculik kemudian dibunuh Kondisinya sudah sangat kurus turun dari Toyota Avanza lam warung itu sempat ribut. mudahnya, dia ikut diboyong. bantah PT InaWood membeli yang diserahkan berupa uang untuk kemajuan usaha. (a38) dan ditemukan Jahtanras mengenaskan kulitnya sudah hitam BK 1565 JQ yang sampai Kedua pria yang bertubuh kecil Penangkapan penculikTuan kayu yang diduga diambil Poltabes Medan. mengering, rambutnya yang berita ini dikirimkan tidak dike- bertengkar dengan pria yang Takur dibenarkan Kasat Res- Hery Jusman dan Tomsihar Curi Uang Di ATM, Janda sudah rontok, serta ditemukan tanpa busana. Jasad korban tahui identitasnya dan berhenti di doorsmer, samping warung- bertubuh tegap,” ucap warga lagi. Tak lama kemudian, seorang krim Poltabes Medan, Kompol Gidion Arif Setyawan. “Iya, me- Silaen dari areal IPK PT PLS Tapanuli Selatan (Tapsel). Anak Satu Dihukum 10 Bulan Penemuan mayat itu ter- diletakan persis di dekat dinding tembok penangkaran sarang nya. Kedua pria itu lalu makan pria dengan tangan diborgol dikawal ke dalam warung. Per- mang itu pelaku penculikan yang di Percut,” ujarnya. Namun, “PT Ina Wood tidak per- nah membeli kayu dari Hery ungkap setelah para tersangka TEBINGTINGGI (Waspada): Terpidana kasus pencurian walet yang di sekitarnya ditana- dan minum di warungnya. Tak tengkaran mulut tetap terjadi mantan Kapolsek Pancurbatu ini Jusman dan Somsihar Silaen menunjukan lokasi pembua- atau dari UD.Sitepu yang uang melalui mesin kartu AnjunganTunai Mandiri (ATM), seorang mi pohon coklat. lama, Kijang Kapsul silver da- karena kedua pria kurus itu me- enggan membeberkan iden-titas ngan di areal penangkaran bu- Setelah petugas identifikasi tang dan berhenti di depan wa- ngaku tak kenal dengan pria pelaku. “Namanya jangan dulu, disebut sebagai penampung janda muda beranak satu akhirnya divonis hukuman 10 bulan rung walet di Gang Sawoh, Kelu- penjara oleh majelis hakim Pengadilan Negeri (PN) Tebingtinggi Poltabes Medan meneliti jasad rung tersebut. Dari dalam yang tangannya diborgol itu. karena nama korban ada sama kayu dari mereka, apalagi rahan Melati I, Kec. Perbau- korban, kemudian jasad korban mobil, turun 2 pria tegap yang Karena kesal, polisi langsung pelaku.Masihitubukti-buktiyang disebut kami berada dibela- Deli. ngan, Kab.Serdang Bedagai, dibawa ke RS Dr Pirngadi belum juga diketahui namanya.. menggeledah kedua pria kurus kita temukan,’’ katanya. (a07) kang kasus itu,” kata Jusman Dalam persidangan, Selasa (10/11) terdakwa Fi, dinyatakan Leo, kepada wartawan, baru- terbukti bersalah melakukan tindak pidana pencurian. Adapun kronologis kejadian berawal ketika terdakwa Fina mendapatkan kartu ATM milik korban Evi Br Saragih yang juga teman karibnya. BKD Pulangkan Berkas Pelamar CPNS Dari PKO baru ini di Medan. Dia mengatakan, bila benarHakimTanjung(Pemilik SetelahmengetahuinomorPINmelaluiponseltemankaribnya PT Ina Wood) datang ke Dit itu, lalu terpidana mencuri uang di dalamnya tanpa sepengeta- STABAT (Waspada): Sedikit- hanya dibedakan nama saja. gang, pelamar didominasi rempak balik membalas. Langkat Syahrizal karena Ke- nya puluhan pelamar Calon Pe- Hal itu sangat disayangkan alumnus Universitas Negeri Tak cukup sampai di situ, pala BKD tidak berhasil ditemui Reskrim Poldasu saat lima huan korban. Sebelumnya terpidana yang ditanyai korban tidak saksi diperiksa yaitu Suhardi, mengakui perbuatannya, namun kecurigaan korban kepada gawai Negeri Sipil (CPNS) dari pelamar, sekaligus menilai pihak Medan (Unimed) tetap bersiku- kedua pihak masing-masing maupun dihubungi, berkas tenaga guru, khususnya pendi- BKD Langkat tak paham atau kuh surat lamaran mereka menghubungi koleganya guna lamaran masyarakat akhirnya Irianto,SelamatMarbun,Dewi Fi, terus berlanjut hingga akhirnya Evi membuat laporan ke danAnwar,ituhanyakebetulan kantor polisi. dikan kepelatihan olahraga mengerti soal status pendidikan untuk tenaga pendidik bidang mempertegas dan memastikan diterima karena PKO sama de- (PKO) mendatangi Kantor Ba- dimaksudkan. Akhirnya, kon- olahraga, sah dan berlaku untuk pendapat terkait penerimaan ngan penjas, hanya beda nama. sajadanHakimTanjunghanya Dalam pengakuannya di depan JPU Yusnar Yusuf, SH dan menemui temannya di Dit Majelis Hakim yang diketuai SB Hutagalung, SH dibantu hakim dan Kepegawaian Daerah disi itu sedikit memancing kisruh seluruh Indonesia . CPNS dari formasi guru tenaga Petugas BKD telah berkordinasi Reskrim Poldasu. anggota Silvianingsih, SH dan Cipto HP Nababan, SH. MH dibantu (BKD) Langkat, Rabu (11/11), di loket pendaftaran dan mem- “Dalam keputusan yang kita pendidik olahraga, seperti me- dengan pihak Unimed untuk “Bila memang Hakim panitera pengganti Pitriwati,SH terpidana mengungkapkan karena berkas lamaran mereka buat beberapa petugas kepoli- peroleh, dibutuhkan Penjaskes, nghubungi pihak Unimed dila- meminta penjelasan terkait ke- Tanjung ada di Poldasu, tidak uangnya sebagian telah habis untuk membeli susu anaknya dikembalikan. sian menarik pelamar ke salah bukan PKO,” kata Musti seorang kukan pelamar dan BKD meng- salahpahaman tersebut. Me- bermaksud mencampuri dan juga diberikan kepada orang tuanya buat membayar utang. Alasannya, pihak BKD hanya satu ruangan guna diajak staf BKD kepada CPNS jurusan hubungi BKN. Diperkirakan, ngenani penilaian sejumlah kasus tersebut apalagi disebut Perbuatan terdakwa sebagaimana diatur dan diancam Pidana menerima lamaran guru dari bicara. PKO tadi. Ketegasan itu, memi- apabila BKD tetap dengan ke- pelamar yang sebelumnya kasak-kusuk mengurus kasus Pasal 362 KUH Pidana. (a09) Pendidikan Jasmani Kesehatan Selanjutnya beberapa pela- cu suasana semakin memanas putusan tersebut maka sekira berkas mereka ditolak, petugas itu. Itu tidak benar dan kami (Penjaskes) sesuai keputusan mar yang merasa dirugikan serta sebab pelamar juga tetap mem- 130 pelamar CPNS dari jurusan di BKD tidak memahami tidak ikut campur apalagi Menpan tentang penerimaan melakukan protes atas pengem- pertahankan argumen jika PKO PKO bakal tidak bisa mengikuti aturan, salah seorang kasubid berusaha mencampuri kasus Penanganan Korupsi CPNS di Langkat. Tetapi, menu- balian berkas tersebut, melaku- dan Penjaskes hanya dibedakan seleksi CPNS tahun ini. di BKD ketika ditemui menilai dimaksud,” tegas Jusman Leo. rut pelamar PKO dan Penjaskes kan pertemuan dengan perwa- nama. “Penjaskes dan PKO itu Akhirnya berkas itu dite- petugas bukan tidak mema- JusmanLeomengakukenal Tidak Ada Pilih Kasih adalah jurusan yang sama dan kilan BKD serta pihak keama- sama saja pak, hanya namanya rima panitia, Kamis (12/11). Di- hami, tetapi teliti untuk mence- dengan Hery Jusman namun seluruh mata kuliahnya serupa nan. Dalam keadaan sedikit te- yang beda,” seru pelamar se- jelaskan Kabag Humas Pemkab gah kesalahan lebih lanjut. (a38) tidakpernahingintahuapalagi STABAT (Waspada): Maju Ambarita, SHkini menjabat sebagai nimbrungdenganpermasala- Kajari Stabat menggantikan pejabat lama Febri Adriansyah yang bertugas di Kejagung. Banyak PNS Pemkab Simalungun Pulang Sebelum Usai Jam Kerja han dimaksud. Sebagaimanadiberitakan, Dalam perbincangan bersama Kajari yang baru dua hari Prianto sebagai Direktur PT bertugasdiKab.Langkatitu,Kamis(12/11),diakonsistenmenindak SIMALUNGUN (Waspada): terlihat, Rabu (11/11), sejumlah pegawai terlihat sangat gembira ngan jajaran pegawai selalu kapi sehingga tidak menjadi PLS mengadukan Hery Jus- dan memberantas praktik dugaan korupsi di Langkat untuk Semangat kerja para PNS (Pega- pegawai sudah berdiri dan bera- apabila pimpinan tidak ada di mengingatkan agar semua pe- ‘duri dalam daging’ bagi Pemkab man dan Tomsihar Silaen ke meneruskan prestasi kinerja pejabat lama. wai Negeri Sipil) di lingkungan da di persimpangan.Tanpa sedi- kantor atau tugas luar. Begitu gawai meningkatkan kinerjanya. Simalungun, dalam hal ini Poldasu dalam kasus dugaan ’’Tidak ada pilih kasih atau membeda-bedakan. Tugas yang kantor Sekretariat dan kantor kitpun merasa bersalah, para mengetahui pimpinan tidak Hal ini penting untuk membe- Bupati HT Zulkarnain Damanik pencurian kayu dari areal IPK diemban harus dilaksanakan,’’ katanya. Maju Ambarita yang SKPD Pemkab Simalungun di pegawai yang tidak jelas tujuan- masuk, para pegawai yang rikan pelayanan yang prima dan Sekdakab Mahrum PTPLSdengancaramemalsu- sebelumnya bertugas di Kejati DKI Jakarta menambahkan, Pamatang Raya semakin hari nya itu menghentikan dan me- kurang rasa tanggungjawabnya kepada masyarakat. Sipayung. kan dokumen PT PLS. (m39) khususnya untuk pejabat di Kab. Langkat tidak perlu was-was semakin menurun. Banyak naiki bus menuju arah Pema- ini langsung ambil tas dan ber- M Adil Saragih, tokoh pemu- Sebaiknya Bupati, Wakil dengan kehadiran pejabat baru yang menganggap program pegawai yang pulang meskipun tangsiantar. gerak pulang setelah menanda- da di Pamatang Raya yang juga Bupati dan Sekda membuat for- pemberantasan korupsi akan semakin gencar. ’’Pada dasarnya waktu jam kerja belum selesai. “ Saat ini banyak pegawai tangani absen. pemerhati pembangunan di mat khusus untuk memberikan Pensiunan PNS berani karena benar, takut karena salah,’’ tuturnya. Pemandangan ini dapat yang datang hanya untuk me- Banyaknya pegawai yang daerah ini saat dimintai tangga- tindakan atau sanksi bagi pega- Menyinggung empat pejabat Langkat yang telah berstatus dilihat hampir setiap hari di sim- ngisi daftar hadir saja dan sete- pulang sebelum waktunya me- pannya seputar rendahnya wai yang tidak disiplin. Hara- Main Pukul tersangka terduga korupsi tetapi belum ditahan, Kajari yang pang kantor SKPD. Baru pukul lah itu pulang walau jam masih nunjukkan disiplin Pegawai disiplin para pegawai di Pemkab pannya, dengan sanksi itu disi- belum sepenuhnya mengikuti perkembangan kasus karena pukul 10:00 sudah banyak pega- menunjukkan pukul 10:00,” Negeri Sipil (PNS) di jajaran Simalungun sangat menya- plin para pegawai baik itu di Diadukan baru bertugas, yakin tidak ada penyimpangan wewenang. Proses wai yang pulang. Kondisi ini cetus salah seorang pegawai di Pemkab Simalungun itu sangat yangkan keadaan itu. Menu- kantor Sekretariat maupun di hukumnya tetap lanjut. membuat situasi gedung SKPD kantor BKD. rendah. Padahal, Bupati dan rutnya, keadaan ini tidak dapat kantor SKPD dapat ditingkatkan. P SIANTAR (Waspada): . Secara terpisah ditambahkan Kasi Intel Kejari, Gloria Sinuhaji, menjadi sepi. Seperti halnya Yang parahnya lagi, para Sekda setiap ada pertemuan de- ditolerir dan harus segera disi- (a15) Seorang pensiunan PNS, KT, mereka sedang menunggu hasil badan pemeriksa kerugian 60, warga Jalan Bahagia, Simpang Jalan Kisaran I, Kota pajak (BPKP) Sumut terkait kasus dugaan penyimpangan dana kamtibmas/stabilitas tahun 2007 senilai Rp2,2 miliar. Begitujuga untuk kasus penyimpangan bantuan dana pendidikan yang Perajin Ijuk Di Pelintahan Resah, Bantuan APBN Belum Diterima Pematangsiantar didugamain pukul hingga diadukan ke masih dalam proses. (a38) SEI RAMPAH (Waspada): pok Perajin ijuk “Karya Sejati anggota apa saja bantuan kese- tidak mau memperlihatkan pihaknya membenarkan ada.’’ Polres Simalungun. Sikap tertutup Ketua Kelompok Dusun VIII Pelintahan, Desa luruhannya dan apa saja yang tembusan proposal itu,apa saja Tetapi saya sendiri belum meli- Korban Chandri Naba- Perajin Ijuk di Dusun VIII Pelin- Sei Rampah resah karena pe- dibeli, ketua tidak mau menga- yang dimohonkan, sehingga ban, 39, warga Setia Negara, Lepas Sambut Camat Gebang tahan, Desa Sei Rampah, Kec.Sei ngajuan proposal bantuan ke takannya. Begitu juga saat dita- membuat mereka merasa sa- hat apa saja bantuannya, dan besok saya akan langsung me- Kecamatan Panombean Rampah, Kab.Serdang Bedagai, pemerintah tidak transparan nya berapa harga pembelian ngat kecewa. Pane,KabupatenSimalungun P.BRANDAN (Waspada): Laksanakan tugas dan fungsi kita ninjau bantuan ke Pelintahan,’’ dalam pengaduannya di Pol- dan kita kemari melakukan tugas.” Hal ini disampaikan Camat kepada anggota dalam penga- kepada anggota. Bantuan itu mesin dompeng tersebut,ketua Yang sangat diherankan kata Aliman Saragih sembari juan proposal dan pengguna- disebutkan sudah turun namun kelompok juga tidak bisa menje- dalam pembuatan proposal itu, res menyebutkan KT diduga Gebang Ibnu Hajar, S.Sos dalam arahannya pada acara lepas mengatakan, pihaknya telah melakukanpemukulanterha- sambut di lapangan voli belakang kantor Camat Gebang, Selasa kan dana bantuan alat, mem- tidak diketahui para anggota. laskannya. Sekretaris dan Bendahara ke- menghubungi pusat dan pusat dapnyaditanah garapanSetia sore ( 10/11) dihadiri, Kapolsek AKP Budiman Karo-karo, buat 17 anggota kelompok itu Para anggota resah, setelah Kemudian para perajin men- lompok sama sekali tidak dili- juga mengatakan bantuan telah Negara, Kecamatan Panom- Danramil diwakili, Kakan Sosial Drs T M Auzai, Ka KUA, Lurah/ resah. Hal itu diungkapkan para mereka berkunjung ke rumah datangi Kantor Disperindag batkan. Sebab saat ditanya Was- bean Pane pada Selasa (10/ anggota perajin kepada Waspa- ketua, di sana ada satu unit mesin Serdang Bedagai di Desa Pasar pada mereka mengatakan tidak turun. Kades Dinas/Jawatan , para Sekdes,Anggota DPRD Langkat, Saat ditanya apakah ban- 11) pukul 10:00. tokoh masyarakat dan staf Camat Gebang. da di Desa Sei Rampah, Kamis dompeng besar yang akan digu- Bengkel, Kec.Perbaungan. Na- mengetahui apalagi menan- Kapolres Simalungun Sementara itu Kakan Sosial mantan Camat Gebang Drs (12/11). nakan untuk membuat kayu mun walaupun sudah tiga kali datangi proposal. tuan mesin itu bisa digunakan di daerah lain ? Aliman mene- AKBP Rudi Hartono saat di- TM Auzai, yang banyak memberi kesan dan pesannya itu juga Menurut Zulhap,33, Mu- gagang sapu. Mesin polis untuk menjumpai pegawai Disperin- Kepala Dinas Perindustrian konfirmasi melalui Pahumas pernah bertugas di Kec.Babalan selaku Sekcam dan selanjutnya hammad Zein,30, keduanya membersihkan gagang sapu, dag Kab.Serdang Bedagai, Soleh dan Perdagangan Aliman Sara- gaskan tidak bisa dan bantuan Kompol RamliSiraitdanKasat bertugas di Kec. Binjai kemudian ke Gebang dan sekarang Kakan anggota dan Sekretaris Syahrial, mesin pemotong gagang sapu Nasution dan Setia Budi yang gih yang dikonfirmasi Waspada itu harus digunakan untuk ke- Reskrim AKP Tito Travolta Sosial Langkat. Acara diakhiri pembacaan doa oleh Ka KUA 30, mereka saat ini dari 17 ang- dan mesin doel pembuat ga- dikatakan menangani proposal, mengakui adanya bantuan pentingan kelompok di daerah- Hutauruk di Mapolres, Rabu dan bersalam salaman. (c02 ) gota di bawah naungan Kelom- gang sapu. Namun saat ditanya tetapi dengan berbagai alasan APBN untuk perajin ijuk itu, nya. (a07) (11/11) membenarkan. (a14)
  • 15. 18 Sumatera Utara WASPADA Jumat 13 November 2009 Pengutipan Terhadap Pelamar 147 Calhaj CPNS Batubara Segera Ditindak Batubara LIMAPULUH (Waspada): Masyarakat yang tergabung dalam Dilepas Gerakan Aliansi Muda (GERAM) Kab. Batubara mendesak pengutipan terhadap pelamar CPNS dilakukan aparat desa dan kelurahan untuk LIMAPULUH (Waspada): ditindak tegas karena telah melenceng dari peraturan. Sebanyak147calonjamaahhaji Hal itu diutarakan kordinator aksi dan kordinator lapangan (calhaj) asal Kab. Batubara Ramadhan Zuhri, SH dan M.Yusuf didampingi Ketua GAGAK, Jasmi dilepas bupati yang diwakili Assayuti SHI, Ketua AMPPUN Burhan dan kelompok pendemo Sekdakab Drs H Sofyan, MM yang menamakan dirinya GERAM ke Kantor Bupati Batubara, untukdiberangkatkankeTanah Kamis (12/11) sekira pukul 10:30 Suci Makkah, Rabu (11/11) di Tindakan itu, katanya sebagai langkah menindaklanjuti masih halaman kantor bupati se- berlangsungnya praktek pengutipan di tingkat desa/kelurahan tempat. sekaligus menagih janji pemkab sejauhmana sudah penindakan “Selamadisanajamahahaji dilakukan. untuk dapat menjaga kese- “Kami tidak mau ikut tercoreng akibat ulah segelintir oknum hatan supaya dapat mengerja- memanfaatkan pengutipan untuk kepentingan pribadi di luar dari kan apa yang diwajibkan mau- biaya leges surat menyurat desa sebagaimana ditentukan Perda pun yang disunnahkan men- sebesar Rp5.000,” ujarnya sembari meminta agar pelaksanaan CPNS jalani rukun haji di Makkah,” berjalan bersih bebas dari KKN tidak seperti terjadi tahun sebelumnya sebut bupati pada acara dalam pengadaan berkas ujian sempat bermasalah. pelepasan. Sahut mewakili Pemkab Batubara yang menerima kedatangan Selain menjalankan rukun pendemo secara tegas menyatakan pihak Pemkab telah mengusulkan hajiparajamaahpintanyatidak formasi SMA sebanyak dua kali hingga sampai keluarnya SK Menpan lupa mendoakan Kab. Batu- No. 25 Tahun 2009 tentang formasi CPNS tidak ada menerima SMA. bara merupakan pemekaran “Ini telah kita upayakan jauh hari sebelumnya dan Menpan yang dari Asahan tetap damai dan menentukan,” ujarnya sembari mengatakan, terjadinya kutipan sejahtera. di desa/kelurahan merupakan keperluan leges surat menyurat Dari 147 jamaah haji yang desa yang diatur Perda tidak ada kaitannya dalam penerimaan CPNS berangkat ke Tanah Suci dan Pemkab telah membentuk tim.(a11) Makkah usia termuda berusia Waspada/Iwan Has 30 tahun dan tertua 84 me- nurut jadwal diberangkatan Menunggu Nomor CPNS, BERKUMPUL: Terlihat para jamaah haji sedang berkumpul untuk dilepas menunaikan rukun Islam kelima ke Tanah Suci Makkah di halaman Kantor Bupati Batubara, Rabu (11/11). melalui bandara Polonia Me- dan, Kamis (12/11) tergabung Sepeda Motor Lewong dalam kelompok terbang 17 bersamacalonjamaahhaji asal Trauma Dianiaya, Belasan LIMAPULUH (Waspada): Membludaknya pelamar CPNS di KotaTanjungbalai, Sibolga dan Kabupaten Batubara ternyata dimanfaatkan oleh pihak tertentu Medan. (a11) untuk melaksanakan niat jahatnya. Nasib apes ini menimpa Ari,25,warga Kelurahan Limapuluh, Kec.Limapuluh, Kab.Batubara yang memarkirkan sepeda motornya BJ Ginting, Mahasiswa Akper Kabur Yamaha Jupiter Z BK 6876 QX di pelataran Puskesmas Limapuluh. Kedatangannya ke tempat itu untuk mengambil nomor ujian Ketua KUD- CPNS, ternyata pengambilan nomor dilakukan di Kantor KPUD, iapun mendatangi Kantor KPU yang berada di depan Puskesmas. SMM-I Ternyata antrian panjang mengurungkan niatnya dan bermaksud mengambil sepeda motornya. Di parkiran itu iapun terkejut melihat KOTAPINANG (Waspada): sepeda motornya tak lagi berada di tempatnya, meski begitu ia TANJUNGBALAI (Waspada): balai. ngajak seniornya pulang ke itu diputuskan, mereka sepakat nurutnya, masih diselidiki lebih BJ Ginting unggul dalam pemi- berusaha mencari ke tempat lain namun upayanya sia-sia, sepeda Sebanyak 16 mahasiswa “Kami muak diperlakukan asrama, namun tak digubris, melarikan diri dari asrama, lanjut, karena mereka belum lihan pengurus Koperasi Unit motornya tetap tak terlihat. kasar dan dianiaya kakak senior, sehingga mereka pulang tepat Rabu sekira pukul 03:00. “ Sudah memperoleh informasi jelas Desa Sawit Makmur Mandiri- Tingkat I Akper Pemko makanya kami semua memu- azan Magrib. sering kali kami dikasari dan I (KUD- SMM-I) Desa Asam- Lelah mencari iapun melaporkan kasus yang menimpanya ke tentang masalah itu. “ Kita be- Polsek terdekat.(a31) Tanjungbalai, kabur dari tuskan kabur dari asrama. Kami Sesampainya di asrama, dianiaya, makanya kami tak lum cross chek dan belum pe- jawa, Kec.Torgamba Labuhan- asrama diduga akibat sudah melaporkan sikap kakak mereka dimarahi mahasiswa tahan, kalaupun melapor, pihak ngembangan, tapi informasi batu Selatan (Labusel). senior, tapi sanksi yang diberi- Tingkat II lainnya, dan disuruh pendidik hanya memberikan Pemilihanitudigelar,Sabtu Aniaya Istri Dan Mertua, trauma dianiaya senior, Rabu (11/11). kan sangat ringan, sehingga kami masuk ke ruangan asrama. Di sanksi ringan, seperti kejadian sementara, mereka terlambat masuk asrama dan ditampari (7/11) pada Rapat Anggota tetap dikasari dan dianiaya,” sana, lanjutnya, mereka ditam- yang lalu, kawan kami dianiaya Tahunan (RAT) Luar Biasa Ditangkap Polisi ungkap para mahasiswa Tingkat pari dan dibentak-bentak. “ kakak senior, tapi hukumannya seniornya,” kata Zuflina. Lebih lanjut dijelaskan KUD SMM-I di Balai Desa I Akper Pemko Tanjungbalai Salah seorang teman kami me- hanya skorsing 1 minggu,” ujar Asamjawa. SIMPANGEMPAT,Asahan ( Waspada) : Petugas Polsek Mereka lari dari Asrama kepada Waspada. mar dan bengkak akibat ditam- mereka. Zuflina, pihaknya telah me- Pantauan Waspada, peser- Simpangkawat Polres Asahan, menangkap tersangka penganiaya dengan tujuan rumah rekannya Diceritakannya, awal keja- par kakak senior. Setelah itu, Direktur Akper Pemko Tan- ngantongi beberapa nama ta RAT terdiri dari anggota istri dan ibu mertua, Kamis (12/11) sekira pukul 01:00 dinihari. di Kecamatan Teluk Dalam, dian yang menyebabkan me- kami langsung masuk ke kamar jungbalai, Zuflina, SST dikon- mahasiwa Tingkat II yang diduga KUD mengajukan 3 calon ke- Tersangka AM, 23, warga Sukaraja, Kec Simpangempat, Kab Kabupaten Asahan. Dan, mere- reka melarikan diri, bermula masing-masing, dan setelah firmasi Waspada membenar- terlibat penganiayaan terhadap tua, setelah perhitungan suara Asahan, ditangkap berdasarkan tindak lanjut laporan istrinya, Ita ka kembali lagi ke asrama setelah ketika mahasiswa Tingkat II makan malam kami membahas kan mahasiswa tingkat I mela- mahasiswa Tingkat I. “ Ada be- BJ Ginting memperoleh 54 Purnama Sari Marpaung, 23, ke kantor Polsek Simpangkawat. diantar orang tuanya masing- mengajak berlatih sepak bola perlakukan kakak senior yang rikan diri dari asrama. “ Benar berapa nama pelakunya, belum suara, Amran mendapat 52 Korban mengaku dipukuli hingga babak belur, terutama di bagian masing, Kamis (12/11) pagi, di Lapangan Sultan Abdul Jalil sering menganiaya kami,” ujar kejadian itu, dan sekarang me- dapat kita sebutkan, tapi pasti- suara sedangkan Ir Rasta Per- bibir yang luka robek dan memar. Kejadian itu, kata korban, berawal guna memenuhi panggilan Rahmadsyah Tanjungbalai. mereka. reka sudah kembali ke asrama,” nya mereka mahasiswa Tingkat anginangin memperoleh 7 ketika tersangka menyuruhnya meminta minyak angin ke rumah pihak Akper Pemko Tanjung- Menjelang senja, mereka me- Akhirnya, hasil pembahasan kata Zuflina. Kejadian ini, me- II,” ungkap Zuflina. (a37) suara. tetangga. Usai pemilihan Drs Rah- Permintaan sempat ditolak korban, karena dia sedang mengurus man Harahap Kadis Perindus- anaknya yang masih bayi. Selanjutnya, tanpa basa-basi, tersangka langsung memukul korban berkali-kali, dan karena mendengar Mantan Wakil Ketua DPRD Belum Kembalikan Mobil Dinas trian, Perdagangan, Koperasi dan UKM Kab. Labusel melan- tik pengurus KUD SMM-I, suara gaduh, ibu korban pun keluar serta berusaha melerai pemukulan itu. TANJUNGBALAI (Waspa- dikembalikanlah dulu,” kata kita tunggulah janjinya,” tukas “ Begitu ditemukan, lang- akhir, harus dikembalikan se- terdiri dari Ketua-I BJ Ginting, Akan tetapi, tersangka malah membalik dan menyerang ibu da) : Mantan Wakil Ketua DPRD Abdi. Abdi. Akan tetapi, lanjut Abdi, sung dijaring dan diangkat, baik lambat-lambatnya sebulan Ketua II Yahya, Sekretaris I mertuanya sambil mengancam akan membunuhnya. Akibat peng- Kota Tanjungbalai periode Selain Toyota Avanza BK 11 apabila batas waktu itu tidak di- itu dijalan atau di tempat lain. setelah berakhirnya jabatannya. Ependi PA, Sekretaris II Jutrisno aniayaan tersangka, ibu mertuanya juga mengalami luka serius 2004-2009, Hasbi, belum juga Z, lanjut Abdi, dua unit sepeda penuhi, maka pihaknya akan Hal ini pernah kita laksanakan Dan, Surat Edaran Men- dan Bendahara Amran. Se- di bagian pelipis. Setelah kejadian itu, tersangka kemudian mela- mengembalikan aset negara motor kategori kenderaan dinas menarik paksa kenderaan ter- beberapa tahun lalu, dan Alham- dagri No 024/3341/SJ tanggal dangkan Badan Pengawas B porkannya ke Polsek Simpangkawat, dan ditindaklanjuti dengan berupa mobil dinas jabatan operasional, juga masih dipe- sebut. dulillah hasilnya sukses, seluruh 11 September 2009 ditujukan Kaban, Hisar Munthe dan menangkap pelakunya. merk Toyota Avanza BK 11 Z. gang mantan anggota DPRD “ Bukan itu saja, tapi semua kenderaan dinas berhasil dikem- ke Gubernur dan Ketua DPRD Budiman Aritonang. (c05) Kapolres Asahan melalui Kapolsek Simpangkawat, AKP Rudy Demikian Sekretaris Dewan Tanjungbalai periode 2004-2009. kenderaan dinas yang masih balikan,” pungkas Abdi. se Indonesia selanjutnya di- Perwakilan Rakyat Daerah Kota Kedua unit sepeda motor itu, dipegang mantan anggota Sementara, PP No.24 Tahun sampaikan kepada Kepala Dae- Chandra,SH, dikonfirmasi Waspada, membenarkan. (a37) Tanjungbalai, Abdi Nusa kepada lanjut Abdi, jenis Supra Fit BK DPRD, akan kita tarik paksa,” 2004 tentang kedudukan pro- rah dan Ketua DPRD di tingkat Meriam Kuno Waspada di ruang kerjanya, 2176 V dan BK 2198 V. tegas Abdi. Saat ini, menurut tokoler dan keuangan pimpinan kota/kabupaten untuk menarik Polres Asahan Siap Gelar Kamis (12/11). “ Memang ken- “ Salah satu mantan anggota Abdi, pihaknya telah menyurati dan anggota DPRD sebagaimana seluruh kenderaan dinas dan Di Medangderas daraan yang dipegang mantan DPRD, yakni Jamaluddin Rito- Pemko Tanjungbalai untuk me- disebut pada pasal 17 ayat 3, jabatan yang dipinjampakaikan Operasi Lilin Toba Wakil Ketua DPRD itu akan nga, berjanji akan mengem- minta bantuan Bagian Aset dan yakni kenderaan dinas yang dipa- kepada anggota dan pimpinan Hilang dilelang 2010 nanti, tapi karena balikan sepeda motor BK 2198 Sat Pol PP menarik paksa ken- kai anggota dan pimpinan DPRD DPRD yang telah purna bakti. KISARAN (Waspada): Polres Asahan akan menggelar operasi MEDANGDERAS (Was- masih proses lelang, sebaiknya V dalam tempo dua hari ini, ya deraan dinas itu. yang masa jabatannya telah ber- (a37) pada): Warga Dusun V, Desa lilin 2009/2010 terkait Natal dan Tahun Baru. “ Personil Polres Asahan siap mengamankan Natal 2009 dan Nenassiam, Kec. Medangderas Tahun Baru 2010,” ujar Kapolres Asahan AKBP Mashudi melalaui Waka Polres Kompol DH Ginting pada acara pertemuan dengan Kadiskes Batubara Jenguk Penderita Gizi Buruk Batubara dikejutkan hilangnya dua buah meriam kuno meru- pakan benda bersejarah peni- Pendeta dan Pemuda Gereja dalam rangka pengamananan Na- KISARAN (Waspada): Pende- dikonfirmasi Waspada, Kamis termasuk keputusan memberi menjelaskan, hasil pemeriksaan sesak dan batuk,” ujar Alfian. tal 2009 dan Tahun baru 2010 di Aula Kamtibmas Polres Asahan, nggalan masa lampau, Senin rita gizi buruk Agus, 2,5 bulan, (12/10) di sela-sela kunjungan- bantuan kepada orang tua bayi, bayi diduga suspect TB Paru, Sedangkan ayah bayi Tarbi (9/11). Rabu (11/10). putra pasangan Tarbi,53 dan nya di RSUD Kisaran. selama tinggal di rumah sakit,” sehingga anak harus terus menjelaskan, ia masih mengha- Menurut warga sebanyak Oleh sebab itu, kata Ginting, untuk menciptakan keaman tersebut Nurbaiti,36, warga DusunV Desa , Menurutnya, penyakit gizi ujar Khodijah. diperhatikan perkembangan- rapkan bantuan Pemkab untuk 9 buah meriam kuno diduga diperlukan adanya kerja sama antara masyarakat dengan Polres Ujungkubu, Kec Tanjungtiram buruk yang diderita korban me- Sama halnya, kata Kho- nya. “ Menurut hasil pemerik- biaya hidupnya selama di ru- peninggalan kedatukan Setia- Asahan untuk menjaga ketertiban di tengah masyarakat. mendapat perhatian Pemkab, rupakan tanggung jawab Pem- dijah, tentang rencana pemerik- saan laboratorium bayi suspect mah sakit, karena, katanya, dia wangsa yang sudah tercatat di Senada dengan hal itu Kabag Kabag Ops Kompol Sudung Ferdi- terkait adanya kunjungan Dinas kab untuk penanggulangannya, saan ibunya yang diduga terse- TB Paru,” ujar Alfian. tidak mempunyai cukup uang Kebudayaan Depdikbud Asa- nand Napitu dalam penyampainya menjelaskan, dalam pengaman Kesehatan Kab. Batubara. sehingga pihak Dinkes sedang rang TB Paru ke laboratorium, Olah sebab itu, kata Alfian, untuk biaya hidup di rumah han waktu itu. Ternyata, Senin itu,seorangpolisiharusbisamengamankan1.254orang,perbandingan “ Kami akan segera salurkan berkordinasi untuk membantu “ Kami belum bisa memutus- diharapkan Dinkes Batubara sakit. (9/11)baru diketahuiduabuah mengambarkan betapa beratnya tugas seorang polisi, sehingga bantuan kepada keluarga bayi keluarga korban. kan, kami hanya bisa melapor- segera memeriksakan seluruh “ Istri dan anak-anak di meriam hilang diduga dicuri diperlukan bantuan mayarakat dan menciptakan ketertiban.(csap) tersebut,” ujar Kadis Kesehatan “ Kami akan bicarakan hal kan hasil patauan kami kepada keluarga korban untuk kebena- rumah masih menanti saya, dan oranguntukmengambilbagian Batubara, Surya Darma melalui ini dengan atasan, dan mereka atasan,” ungkap Khodijah. ran apakah salah satu mereka mereka masih butuh biaya hi- logam yang laku dijual. Tahanan Hakim Tertangkap pegawai Pelayanan Kesehatan Khodijah didampingi Wilda akan mengambil keputusan untuk tindakan selanjutnya, Dokter Spesialis Anak RSUD Kisaran dr Alfian Nasution Sp.A terserang TB Paru. “ Terutama ibunya, karena bayi ini terserang dup,” ungkap Tarbi yang mem- punyai 6 anak. (csap) Warga sudah menyam- paikan hilangnya dua meriam Simpan SS Di Lapas kuno itu kepada Kepala Desa Nenassiam tetapi belum di LABUHANRUKU (Waspada) : Dua paket narkoba jenis shabu- shabu yang disimpan S, 49, warga Desa Ujung Kubu, Kecamatan Pimpinan DPRD Diminta Panggil Kadis Kesehatan laporkan ke Polsek setempat. Benda peninggalan sejarah RANTAUPRAPAT (Waspa- kalangan masyarakat dan ang- kegiatan oknum yang ingin ber- yang terindikasi ditumpangi Hj berupa meriam kuno tersebut Tanjungtiram, Batubara, di dalam kamar tahanan Lapas Labuhanruku Menurut Jaffar, kegiatan termasuk benda yang dilin- diamankan petugas. da): Kegiatan sunatan massal gota DPRD Labuhanbatu. yang dilaksanakan dengan tarung dalam Pilkada. “Kalau Adlina untuk melakukan kam- dungiUUkarenaituwargame- Pengungkapan kepemilikan SS itu setelah Tim Pengamanan gratis yang dilaksanakan Dinas “Diminta kepada Pimpinan menggunakan dana APBD, dinas ikut-ikutan dalam acara panye terselubung. ngharapkanpelakupencurinya di Lapas Klas II A Labuhanruku dipimpin Plh.KPLP Zullaeni,Bc.IP ,SH Kesehatan Labuhanbatu yang DPRD Labuhanbatu memanggil haram digunakan oleh oknum pilkada, itu tidak dibenarkan. Kegiatan khitanan massal dapat ditangkap secepatnya atas perintah Kalapas Drs Zaherman,Bc.IP melakukan razia, Selasa dihadiri Hj Adlina dengan me- Kepala Dinas Kesehatan Labu- untuk kepentingan pribadi demi Mestinya, kepada aparat peme- gratis Dinas Kesehatan yang (a30) (10/11). ngatasnamakan Ketua Tim Pe- hanbatu Dr H Nazmil Fuad memuluskan niat menjelang rintahan yang mengetahui menuai protes tersebut, dilak- Menurut Kalapas Labuhanruku Zaherman melalui Plh.KPLP nggerak PKK Labuhanbatu, Siregar, guna melakukan rapat Pilkada mendatang. “Yang sa- adanya oknum yang menum- sanakan dengan menggunakan Zulaeni, Rabu (11/11), razia rutin dilaksanakan terhadap seluruh terkesan dimanfaatkan guna dengar pendapat terkait pelaksa- ngat disayangkan, Dinas Keseha- pang untuk kepentingan pilka- anggaran APBD Kabupaten SD Dan SMP Warga Binaan Pemasyarakatan (WBP), narapidana, tahanan agar mengundang simpatik dari naan sunat massal yang terindi- tan mau saja ditumpangi, mesti- da, harus bersikap lebih profe- Labuhanbatu, di Kelurahan Aek dilingkungan LP terhindar dari peredaran narkoba sesuai instruksi masyarakat. kasi dimanfaatkan untuk kam- nya ini tidak terjadi,” ujar Jaffar. sional,” ujar Syahmat Nur. Paing Kecamatan Rantau Utara, Di Asahan Menhum dan HAM RI agar benar-benar di LP bersih dari peredaran Acara itu terbukti dengan panye terselubung,” ujar Sekre- Ketua Fraksi BAR Syahmat Untuk itu, tambah Syahmat Jumat (6/11). Karena kurangnya narkoba. pengukuhan tim sukses Hj Adli- taris Fraksi Barisan Amanat Nur Ritonga juga menegaskan, Nur, Kepala Dinas Kesehatan sosialisasi oleh dinas terkait, se- Dibobol Maling Barang haram itu ditemukan di dalam tilam busa tersangka na dihadapan ratusan masya- Rakyat (BAR) DPRD Labuhan- kepada dinas maupun instansi Dr H Nazmil Fuad Siregar agar hinggamasyarakathanyamenge- yang bers tatus tahanan hakim terlibat perkara narkoba SS dan rakat. Akibatnya, kegiatan itu batu Jaffar Sidik Nasution kepa- pemerintahan, diingatkan agar segera melakukan klarifikasi tahui, yang melaksanakan acara KISARAN (Waspada): SD merupakan residivis sudah tiga kali masuk penjara “Untuk pengusutan mengundang reaksi keras dari da wartawan, Selasa (10/11). tidak ikut campur tangan dalam terkait kegiatan sunat masal tersebut adalah Hj Adlina. (c01) Negeri 01389 di Jalan Budi lebih lanjut tersangka S diserah kan ke Polsek Labuhanruku untuk Utomo No 78 Kel Siumbut- diteruskan ke Polres Asahan “ sebut Zulaeni. (a30) umbut,Kec.KisaranTimurdan Proyek Rumah Dinas Jadi Sorotan Saat Pemimpi Incar Kursi Bupati L. Batu SMP Negeri 2 Meranti Dusun VIII, Desa Gajah, Kec. Meranti, Kab Asahan dibobol maling, SUHU politik menjelang tengah masyarakat. Dengan kandidat membagi-bagikan Uang ada, kekuasaan ada. Ini rakat untuk menyambut Hj Selasa (10/11). AEKKANOPAN (Waspada): Proyek pembangunan satu unit alasan ini dan itu, kegiatanpun beras, buku dan pakaian sekolah. yang menarik. Orang-orang di Adlina T Milwan begitu besar. Informasi yang dihimpun rumah dinas dikomplek kantor Dinas Kesehatan Kabupaten pilkada di tiga Kabupaten Waspada, maling masuk ke terlaksana. Peran serta TS atau Itu dilakukan dari masjid ke sekitar calon kandidat adalah Masyarakat desa selalu berha- Labuhanbatu Utara dan rehab pagar kantor instansi itu dipertanyakan. Labuhanbatu semangkin sering disebut tim sukses dari masjid sehingga tidak heran orang terpelajar sehingga lebih rap bisa melihat wajah sang ibu ruangan perpustakaan SD Pantauan Waspada, Selasa (10/11), pembangunan satu unit hangat. Nama-nama yang calon kandidat ternyata menje- setiap Jumatan ada saja masya- mudah diorganisir dan kesan- dan berjabat tangan. Bagi ma- dengan merusak jerjak jendela rumah dinas yang disinyalir diperuntukan bagi rumah dinas sekretaris lang pilkada di tiga kabupaten rakat kecil ke bagian rezeki. nya lebih profesional. Kekuatan syarakat dua hal itu saja sudah dan berhasil melarikan satu Dinas Kesehatan yang hampir rampung diduga tidak dibiayai dari muncul, ingin bertanding di unitkomputerdanmesinprint, pentas pilkada pemekaran itu mempunyai Ada lebih profesional biar maha dahsyat itu bak gunung merupakan kebahagian yang APBD Labuhanbatu Utara. Begitu juga dengan rehab pagar di kantor peran yang sangat penting. Bila tak nampak tak berduit tapi rajin gelombang air laut yang dapat tak terlupakan seumur hidup. sehinggakerugiandiperkirakan dinas tersebut juga diduga tidak dibiayai dari APBD Labura. Labuhanbatu (induk), sebesar Rp 6 juta. menginginkan suatu kegiatan mengumpul tokoh masyarakat menyapu apapun di sekitarnya. Namun, walau Hj Adlina T Pejabat Pembuat Komitmen (PPK) Dinas Kesehatan Labura Sementara di SMP Negeri Labuhanbatu Utara itu mendulang sukses. dan tokoh pemuda di setiap desa Melirik di Labuhanbatu Milwan setiap kunjungan di- 2 Meranti, maling berhasil me- Harmeini Hasibuan, SKM mengaku, pembangunan satu unit rumah dinas di lingkungan kantor Dinas Kesehatan tidak ada dalam RKA (Labura), dan Labuhanbatu Banyak akal dan cara dila- yang dikunjungi. Bermodal (induk) sepertinya nama-nama sambut hangat masyarakat, larikan 2 unit komputer di rua- (rencana kerja anggaran) dan daftar pengguna anggaran (DPA). kukan. Ada yang selama ini ja- parade kunjungan dua mobil yang muncul masih kalah jauh namuan dia dibayangi oleh ngan KTU, dan 1 unit di rungan Selatan (Labusel) mulai Sementara rehab pagar kantor Dinas Kesehatan, katanya, sudah rang nongol di pesta perkawi- atau tiga mobil, calon kandidat dengan calon kandidat Hj Adlina orang yang selama ini dianggap Kepsek, ditambah lagi 1 unit menunjukkan ‘giginya’ nan, khitanan atau mengayun- bupati masuk kampung ke luar T Milwan. Uniknya hajjah ini ‘si pemimpin pemimpi’. Sang diusulkan dalam RKA agar masuk di PAPBD namun hingga saat di ruang perpustakaan, menu- ini DPA belum ada kami terima. “Hal itu Pak Kadis sudah tahu, dengan mendatangi kan. Menjelang pilkada calon kampung memperkenalkan selama sembilan tahun tetap pemimpi sempat berkeinginan rut perhitungan kerugian jadi kalau tidak termasuk dalam DPA maka pekerjaan rehab pagar masyarakat. kandidat rajin datang dan bila diri. Kalau ada menanya ingin dermawan dan senang mem- mencalon di Labusel, namun mencapai Rp 10 juta. tersebut tidak kita bayarkan,” katanya dan menambahkan anggaran berhalangan maka ‘pinomat’ mencalon barulah dijawab de- bantu masyarakat terutama kemudian ‘lompat pagar’ me- Kapolres Asahan AKBP yang diusulkan sebesar Rp40 juta. papan bunga sudah nongol di ngan diplomasi. Jadi, tak nam- masyarakat yang ekonominya ngincar kursi nomor satu di Mashudi melalui Kabag Bina- Hasibuan juga sangat menyayangkan sikap Dinas Pendapatan, Berbagai kegiatan sebagai acara pesta. pakbolang (belang) sebenarnya. lemah. Labuhanbatu. mitraAKPZulfikardikonfirmasi Pengelolaan Keuangan dan Aset Daerah, karena hingga saat ini ‘ajang promosi’ dari calon kan- Adapula dengan sistem Ada yang lebih elegan, terta- Tak heran, dalam kunjungan Waspada, Rabu (11/11) mem- DPA PAPBD tahun 2009 belum ada mereka terima. (a29) didat selalu tampil di tengah- gerilya. Usai shalat Jumat calon ta rapi, sistematis dan terencana. ke desa-desa antusias masya- Neirul Nizam Aru benarkan. (csap)
  • 16. WASPADA Jumat 13 November 2009 Sumatera Utara 19 Ribuan Guru Di P. Siantar Ancam Mogok Mengajar P SIANTAR (Waspada): . anggota DPRD padahal sudah selaku SKPD. Namun, Ketua DPRD malah muan itu agar dihentikan. Ketua kan sudah sejak September 2009 dua kali diminta. “Lalu apa yang KetuaPGRIkembaliinterupsi meminta pejabat Pemko yang DPK menegaskan bila dalam 30 itu dijelaskan. “Kalau mau cair Pedagang Protes Tuntutan pencairan bantuan dana insentif dari Gubsu mau diawasi?” Zainal Purba menimpali dan menyebutkan pertemuan seperti itu sudah beberapa kali hadir menjelaskan mengapa Walikota tidak hadir. Namun, menit Walikota tidak hadir per- temuan dibubarkan. Hulman sekarang silahkan.” Ketua DPK menyatakan DPRDtidakdihargai Ke DPRD P. Siantar tahun 2009 masing-masing Rp 50.000 per bulan atau Rp dengan mengatakan kalau me- mang Perwa APBD sudah ada dan hasilnya tetap mentok dan tidak ada jalan keluar. “Dengan Ketua DPK menginterupsi dan mempertanyakan marwah Sitorustawarkanagar pertemuan diskors 30 menit menghadirkan Walikota. Hulman Sitorus me- nyatakan para guru orang pintar dan mengetahui bantuan dana agar pimpinan membagikannya, hadirnya Walikota selaku pe- DPRD dengan ketidakahadiran Walikota dan bila tidak hadir, para P SIANTAR (Waspada): Sebanyak 141 kios terbuka di luar pagar . 600.000,- per tahun tiap guru insentif dari Gubsu tidak include namun jangan dalam forum itu ngambil keputusan akan mem- Walikota serta menyatakan guru agar pulang dengan tertib. Pasar Horas di sepanjang Jalan Imam Bonjol dan Jalan Sutoyo akan kembali mentok di APBD Pematangsiantar. Perwa diminta. Sikap Zainal itu beri kepastian tentang tuntutan mereka akan mengundurkan diri Akhirnya, Ketua DPRD menskors Josmar Simanjuntak menyaran- direhabilitasi Pemko dengan merubuhkan kios yang lama hingga mengakibatkan lima ribuan membuat para guru berteriak para guru.” Ketua PGRI saat itu bilaWalikota tidak hadir. Anggota pertemuan 30 menit. puluhan pedagang yang tergabung dalam Aspirasi Pedagang Kecil kan agar ada agenda lanjutan. lebih guru, baik negeri tidak sependapat dan Ketua DPK berteriak kepada para guru, DPRD Saut H Simanjuntak men- Ternyata, sesudah 30 menit, Tuntutan para guru itu tetap tidak (ASPeK) berdelegasi ke DPRD Kota Pematangsiantar, Rabu (11/ kembali mendesak pimpinan mempertanyakan apakah perte- dukung dan meminta kepastian Walikota tetap tidak hadir dan 11) mempertanyakan tempat mereka sementara dan hak mereka maupun swasta dan honor bisa dipenuhi hingga Ketua DPRD agar menghadirkan muan diteruskan tanpaWalikota kapanWalikota akan hadir. Pada jawaban Asisten I tetap sama. Plh DPRD menutup pertemuan sesudah direhabilitasi. mengultimatum bila dalam Walikota. dan dijawab serentak “tidak.” saat itu, Asisten I menyatakan Kepala Bappeda sempat mem- pukul12:30danmendapatcemo- “Selamainitidakadasosialisasiakandirehabilitasi, namunkemarin dua hari tidak cair akan Asisten I Jonson Simanjuntak Asisten I itu malah mengata- bantuan dana insentif dari Gubsu beri penjelasan dan menyebut- han dari para guru menyatakan tiba-tiba semua kios kami dibuldozer. Padahal, sebentar lagi akan didampingi pejabat Pemko lain- kanmenjadibingungapakahmau sudah dibayarkan hingga hingga kan bantuan dari Pemprovsu tidak sanggup. ada perayaan Natal dan Tahun Baru, kemana kami mau berdagang. melakukan aksi mogok nya yakni Kadis Pendidikan Su- berhadapan dengan perwakilan diteriaki para guru dengan kata- merupakan dana penyeimbang Ketika berada di halaman Satu hari saja, kami tidak berdagang, kami sudah terancam makan,” mengajar. rungSiallaganKadis Pendapatan, atau guru dan kalau perlu,Wali- kata “bohong.” dan sudah dimasukkan di APBD gedungDPRDterdengarisu Wali- cetus salah seorang pedagang wanita Uli Manurung saat pertemuan Pengelolaan Keuangan dan Aset kotaakan berkunjungkesekolah- Anggota DPRD Rudolf M Pematangsiantar. Para guru kota akan datang hingga Aliansi di ruang sidang DPRD. Daerah Robert Dontes Simatu- sekolah. Para guru langsung Hutabarat meminta agar saling langsung berteriak-teriak dan sempatbertahan,namunsesudah Awalnya, delegasi para pe-dagang yang didampingi aktivis yang “Ternyata tuntutan kita ditunggu-tunggu tidak muncul sampai sekarang tidak dipenuhi. pang dan Plh Kepala Bappeda bereaksi mendengar itu dan me- menghargai dan kalau memang muncul berbagai interupsi. turut bersolidaritas terdiri DPK SRMI, Eksekutif Kota LMND dan Adyaksa DH Purba saat diberi nyatakan tidak perlu dan menu- harus dihadiri Walikota, perte- Rindu Marpaung menyata- akhirnya Aliansi bubar.(a14) Porkot yang mendatangi DPRD dengan menumpang Angkot diterima Caradamai,negosiasidanmediasi sudah dilaksanakan, tapi tetap kesempatan berbicara, menye- ding mau mengintimidasi. Teria- di ruang kerja Ketua DPRD. Namun, sesudah para pejabat Pemko dan konsultan hadir sesudah diundang, pertemuan dilanjutkan tidak dicairkan. Hanya ada satu jalan kalau sampai Sabtu (14/11) butkan Walikota mempunyai tugas-tugas rutin yang cukup kanparaguruitumembuatZainal Purba bersuara kuat agar tertib Pilkada Tapsel 12 Mei, Anggaran Rp 13,8 M di ruang sidang DPRD. padat guna mempersiapkan dan menghargai mereka. Saat pertemuan delegasi pedagang berlangsung di ruang kerja tidak dicairkan, kita mogok P.SIDIMPUAN (Waspada): bahan. Dikarenakan masih ada- pilkada. mengajar,” teriak Ketua PGRI Drs tugas-tugas tahun 2010 hingga Saat itu, Ketua DPRD berkali- nya pembahasan di tingkat Pendaftaran calon anggota Ketua DPRD hampir terjadi insiden antara ajudan Ketua DPRD Pemilihan kepala daerah Kabu- DanielSiregar kepadaduaratusan tidak bisa hadir dan memerin- kali menawarkan agar pejabat Pemkab Tapsel dan DPRD ter- Panwas dilaksanakan Senin-Ju- dengan seorang aktivis Sumihar Choky Pardede yang hendak masuk paten Tapanuli Selatan rencana- guru yang tergabung dalam tahkan mereka menghadiri Pemko yang hadir diberi kesem- kait dana perhelatan demokrasi mat 16-20/11). Akan diambil ke ruang kerja Ketua DPRD. Ajudan Ketua DPRD terkesan meng- nya digelar pada 12 Mei 2010. Aliansi Peduli Pendidikan Kota pertemuan itu. patan memberi penjelasan dan itu. enam calon untuk diajukan ke halang-halangi Pardede masuk hingga Pardede berteriak dengan Sedangkan anggaran yang diaju- Pematangsiantar sesudah perte- Octavianus Rumahorbo dari didukung Zainal Purba yang “KPUD telah menetapkan Bawaslu agar diseleksi lagi emosional. Anggota DPRD Hulman Sitorus, SE dan Ronald Darwin kan untuk disahkan dewan pada muan dengan Pemko yang difa- Aliansi langsung keberatan Wa- menyebutkan mungkin anggota jadwal penyelenggaraan Pilkada menjadi tiga orang dan kemu- Tampubolon segera menemui Pardede dan membujuknya agar P-APBD 2010 sekitar Rp silitasi DPRD di ruang sidang likota tidak bisa hadir dan DPRD yang lain belum menge- 2010. Besaran anggaranpun dian dilantik. meredam amarahnya hingga insiden itu tidak berlanjut. 13.879.000.000. DPRD,Kamis(12/11)bubartanpa menyebutkan bagaimana DPRD tahui hingga pejabat Pemko telah diajukan agar ditampung Sedangkan proses pendaf- Hadir dalam pertemuan di ruang sidang DPRD antara lain Sekda Ketua KPUD Tapsel Mustar hasil. Teriakan Ketua PGRI itu memfasilitasi pertemuan bila diundang. Namun, Aliansi tetap pada APBD 2010. Tahapan yang taran Panitia Pemilihan Keca- James Manson Lumbangaol, Asisten I Jonson Simanjuntak, Asisten Edi Hutasuhut, melalui Sekre- disambut para guru dengan teria- tidak mengetahui apa yang mau bertahanagarWalikotadihadirkan telah dilalui, baru penerimaan matan (PPK) mulai dari pendaf- II Djumadi, Kadis Perindag Zainal Sinaga, Kadis PU diwakili Sekretaris taris M Yunus Daulay, kepada kangemuruhmenyatakan setuju. diawasi dan menyatakan sudah hingga anggota DPRD Hulman DP4 dari Pemkab Tapsel,” taran, seleksi, hingga pelantikan, Adres Tarigan, mewakili konsultan perencana rehabilitasi Pasar Waspada di ruang kerjanya, Pertemuan antara Pemko sampaitigakalipejabatyangsama Sitorus, SE menyebutkan perte- katanya. berlang-sung sejak Jumat (20/ Horas Mario Ginting. Sedang dari DPRD antara lain Ketua dan Jalan Williem Iskandar, Kelura- yang difasilitasi DPRD dengan hadir saat Aliansi berunjukrasa muan itu agak rumit dan mendu- Sedangkan tahapan proses 11) higga Kamis (24/12). Pendaf- Wakil Ketua sementara Marulitua Hutapea, SE dan Timbul M Lingga, han Sadabuan, Kota Padangsi- Aliansi dikoordinir Drs. Timbul dan jawaban tetap sama. Asisten kung agar Walikota dihadirkan. yang sedang berjalan sekarang taran calon kepala daerah per- anggota DPRD Zainal Purba, Hulman Sitorus, Tumpal Sitorus, Saut dimpuan, Kamis (12/11). Panjaitan dan merupakan gabu- I sempat menjawab sesuai keten- Abestian Sinaga, SH menam- ini adalah pengumuman peneri- seorangan, mendaftar denga H Simanjuntak, Kiswandi, Ibnu Harbaini, M. Rivai Siregar, Josmar MenurutYunus Daulay, ang- ngan dari organisasi pendidikan tuanperundang-undangan,Wali- bahkanagarsama-samapuasapa maan pendaftaran calon ang- persyaratan jumlah KTP dibuka , Simanjuntak dan lainnya. garan pilkada ini kemungkinan danguruterdiriDewanPimpinan kota dibantu perangkat daerah salahnyamenghadirkanWalikota. gota Panitia Pengawas (Panwas) pada Januari 2010. (a20) Menurut Uli Manurung, tiga minggu sebelumnya sudah wanti- masih akan mengalami peru- wanti sesudah mendengar Pasar Horas bakal direhabilitasi, namun Kota (DPK) dipimpin Drs HM tidak ada sosialisasi terhadap mereka dan tiba-tiba kemarin para Natsir Armaya Siregar, PGRI pedagang dikejutkan dengan datangnya buldozer dan meratakan dipimpin Drs Daniel Siregar, semua kios mereka. FKG-PNS dipimpin Drs. Timbul Sekda membenarkan Pasar Horas akan direhabilitasi dan tentang Panjaitan,SGSIdipimpinDrs Bik- parapedagangyangselamaini menempatikiosterbukaakanditempat- man Manalu, MPd, FKGH dipim- kan sementara di jalan tembus Sutomo-Pane dan bila tidak memung- pin Rindu Marpaung, SPd, PGSI kinkan sebagian ke Jalan Thamrin. dipimpin Husnul, SPdI dan Fes- Anggota DPRD Hulman Sitorus mempertanyakan apakah dikari dipimpin Drs Panal Sijabat rehabilitasi itu harus memindahkan pedagang atau boleh tetap sesudah pada hari ketiga berun- berdagang di dekat kios yang direhabilitasi. jukrasa Jumat (6/11) DPRD me- Menjawab pertanyaan itu, Sekda dan Kadis Perindag yang mem- nyatakan akan memfasilitasi persilahkan konsultan perencana menjawabnya dan Mario Ginting pertemuanPemkodenganaliansi menyebutkanpihakkonsultansudahsejakbulanMaret2009melakukan pada Kamis (12/11). survei tentang rencana pembangunan kios terbuka di pelataran Namun, saat dimulai perte- Pasar Horas dan renovasi gedung I, II dan III Pasar Horas. muan mulai pukul 10:00 yang “Renovasi gedung I, II dan III Pasar Horas tidak akan mengganggu dipimpin Ketua DPRD Marulitua para pedagang di dalamnya, namun pembangunan kios terbuka Hutapea, SE didampingi Wakil berbentukbalairungsebanyak 162kiosharusmemindahkanpedagang, Ketua Timbul Lingga, SH dan karena kios terbuka yang akan dibangun akan dipagar dengan seng. anggota DPRD Zainal Purba dan Tugas kami hanya sebatas pembangunan fisik dan tidak ikut urusan hampir seluruh anggota DPRD pedagang.” sudah mulai muncul berbagai Jawaban itu membuat Ketua DPRD meminta dipertegas bagai- interupsi dari Aliansi. Ketua DPK langsung tunjuk tangan dan me- mana nasib pedagang sesudah kios mereka dibolduzer. Tumpal minta agar DPRD menghadirkan Sitorus dan Zainal Purba turut mendukung dan mempertanyakan Walikota Ir RE Siahaan. Permin- bagaimana para pedagang sesudah selesai direhabilitasi. “Saat rehabi- taan Ketua DPK itu didukung litasi, para pedagang jangan sampai terganggu berdagang atau anggota DPRD Ir Saut H Siman- mencari makan apalagi sudah mau perayaan Natal danTahun Baru,” juntakdanmemintaagarWalikota imbuh Saut H Simanjuntak. dihadirkan. Menurut Sekda, sesudah berkonsultasi dengan konsultan Anggota DPRD M. Rivai perencana dan Kadis Perindag, dalam dua sampai tiga hari ini akan Siregar menambahkan Perwa ada solusi penempatan para pedagang itu apakah di dekat kios tentang APBDtahun2009sampai yang direhabilitasi dengan menggunakan atap atau tidak.(a14) saat ini belum sampai kepada Solusi Kemiskinan Di Madina Versi Irwan Daulay jam. Di matanya, ada tiga per- teraan. “Bank harus jadi alat pe- soalan mendasar di Madina merintah untuk memberi ma- sehingga angka kemiskinan versi syarakat akses ke permodalan.” Badan Pusat Statistik 2007 tetap Dia menyatakan di Madina berada di angka 20,4 persen. sepanjang 2008 jumlah kredit Jumlah penduduk madina bank konvensional hanya 417.000. Atau jika dikalkulasi Rp380 juta padahal potensi dana penduduk miskin itu 85.068. Apa beredar di sana mencapai Rp1 yang membuatnya menjadi triliun. “APBD kita saja sudah cukup tinggi? Irwan menekan- Rp600 miliar,” tandasnya. DISKUSI tentang kan pada tiga masalah. Dalam jangka panjang dia Kabupaten Mandailing Pertama keterampilan ma- mensolusikan harus ada bank syarakat Madina dalam ber- syariah dengan tiga jenis pro- Natal (Madina) dengan usaha sebagai petani dan peda- duk yaitu simpan pinjam, kope- Irwan Daulay (foto) seperti gang cukup lemah, kedua mi- rasi dan pengelolaan ZIS (zakat, tak ada habisnya. Tanyakan nim penguasaan lahan perta- infak dan sedekah). “Dapat di- apa saja tentang wilayah nian padahal sesuai standar bayangkan kalau Bank Madina nasional harusnya satu kepala Syariah itu ada dan buka cabang itu mesti dia bisa jawab keluarga minimal punya dua di Medan dan Jakarta, peran- sampai tuntas. hektar lahan. Ketiga tentu saja tauan bisa menyimpang uang- akses permodalan ke bank nya di sana.” rendah. Karena sampai hari ini pe- Topik yang dibahas bisa se- Dia berbicara tentang kele- merintah pusat gagal menerap- muanya. Penguasaan menda- mahan itu karena sebenarnya kan konsep ekonomi yang ter- lami Irwan terhadap Madina sektor pendorong pertumbu- buka dan bisa dipertanggungja- sebenarnya wajar. Dia lahir di han ekonomi Madina didomi- wabkan, jelas Irwan. “Kita kenal sana, dan 10 tahun terakhir ba- nasi pertanian dan perdaga- kapitalis, sosialis dan peme- nyak berperan dalam pemba- ngan. Karena sudah menemu- rintah pusat malu-malu dengan ngunan Madina. Bahkan saat kan masalahnya, tentu Irwan syariah lalu membuat konsep masih mahasiswa pun hingga pun punya solusi. ekonomi kerakyatan yang masih tamat Ikatan Mahasiswa Man- Menurut dia, pertama pe- berbau riba.” daliling Natal (Ima-Madina) tani dan pedagang perlu diper- Padahal dengan syariah sempat dimotorinya. Bagi yang kuat melalui pelatihan baik for- bisa membangkitkan sektor riil. kerap mengikuti perkembangan mal dan non informasi. Semen- Tokoh muda Madina ini me- Madina, sosok tokoh muda tara yang belum jadi petani dan mang cukup cerdas menjawab yang satu ini sulit dilepaskan. pedagang harus mendapat pen- pertanyaan yang spontan. Diskusi pun bukan hanya didikan sejak dini. Begitu juga saat disinggung kira- tentang ekonomi, politik, atau “Saya punya argumen agar kira ke berapa persen dia bisa potensi energi, malah kalau dita- sejak sekolah ada mata pelaja- turunkan tingkat kemiskinan nya berapa jumlah gang atau ran kewirausahaan hinga tingkat kalau kelak jadi bupati di Madina? jalan yang ada di Panyabungan SMA. Tentu disesuaikan dengan “Saya yakin tiga persen setiap mungkin dia bisa tahu. Maklum potensi sumber daya alam di tahun bisa tercapai. Atau paling Irwan lahir di Panyabungan. sana seperti pertanian dan per- tidak kasi saya waktu lima tahun Faktor putra daerah dan pe- dagangan tadi,” jelasnya. untuk menurunkan angka ke- ngalaman sepertinya membuat Generasi sekarang pun miskinan menjadi satu digit,” lulusan sarjana teknik itu mam- mesti ada pelatihan. Lalu ten- papar Irwan. Caranya? Menurut pu menguasai berbagai per- tang penguasaan lahan hingga dia, saat ini Bupati sekarang soalan di sana. Harusnya kalau dua hektar, kata dia, harus ada sudah meletakkan dasarnya. dia lulusan sarjana teknik pasti peraturan daerah. Sebab di Ma- Sudah ada hampir 160 ribu sulit berbicara tentang ekonomi. dina masih banyak lahan ter- hektar dibuka lahan perkebunan Tapi peta kesejangan eko- lantar. baru. Tiga sampai lima tahun nomi dan potensi wilayah begitu “Ketika nanti diinvetarisir ke depan puluhan ribu tenaga kuat dikuasainya. Kesempatan ada yang memiliki lahan lebih kerja bisa ditampung, tandas- bertemu dengannya sekarang si pemilik harus rela direlokasi,” nya. “Kita nantinya bisa menge- pun lebih terbuka di Madina. katanya menegaskan solusi ma- luarkan peraturan daerah yang Sebab waktunya saat ini lebih salah kedua. Lalu solusi untuk memprioritaskan putra daerah.” banyak ke sana. Dia membagi masalah ketiga, Irwan punya Di perbincangan itu masih porsi paling tidak dua minggu cita-cita membuat Bank Ma- banyak topik yang mengemuka. di Madina dan seminggu di dina Syariah. Namun kemiskinan Madina-lah Medan. Di fikirannya Pemda harus yang paling disorotnya Kebetulan Selasa (10/11), punya bank sendiri agar bank sekarang. jadilah diskusi dengannya ten- ini ideal sebagai alat kekuasaan tang Madina nyaris lebih tiga untuk meningkatkan kesejah- Armin Nasution
  • 17. 20 Sumatera Utara WASPADA Jumat 13 November 2009 Bupati Tapsel Serahkan Pembangunan Jalan Natal-Batahan Bencana Madina Murni Faktor Alam Sertifikat Peserta PIR PANYABUNGAN(Waspada): nyebabkan terjadinya puluhan bilitasi yang proposalnya sedang Wewenang Pemprovsu Rapat koordinasi Badan Penang- titik longsor ,” jelasnya. dibahas Badan Nasional Pena- MUARA BT TORU (Waspada): Bupati Tapanuli Selatan gulanganBencanaDaerahSumut Menurutnya, masa tanggap nggulangan Bencana di Jakarta. dan Pemkab Madina 28 Septem- darurat ditetapkan 14 hari setelah Pemerintah daerah akan Ongku P Hasibuan bersama Direktur Utama PT Samukti ber2009dipimpinWagubsuGatot peristiwa banjir. Penanganan memberikan stimulan kepada Karya Lestari (SKL) Drs H Gita Sapta Hadi, MM menyerahkan Pujo Nugroho menetapkan ben- sertifikat tanda peserta Perkebunan Inti Rakyat (PIR) dengan PANYABUNGAN(Waspada): Gadis, telah terprogram melalui Kampung Sipirok,. ‘’Akan tetapi mencakup pencarian, penyele- warga yang rumahnya hanyut Bupati Madina H Amru Daulay, sumber dana penanggulangan ruas jalan yang belum masuk ma- cana di Kec. Muara Batang Gadis matan dan evakuasi korban, dan rusak berat masing-masing pola kemitraan kepada 620 kepala keluarga (KK) Desa Hutajaja, murni faktor alam. SH mengatakan, penanganan bencana alam 2009. sih dimohonkan melalui sumber penyediaanpangandansandang, Rp 2 juta per unit untuk 438 ke- Kec. Muara Batang Toru, Kab. Tapsel yang tergabung dalam ruas jalan Natal-Batahan sepan- Menyangkut pembangunan dana AD Hock ( APBN) TA 2010. Demikian disampaikan Bu- Koperasi Tondi Bersama di Lapangan Desa Hutaraja, Minggu sanitasi dan kesehatan, penam- pala keluarga ( KK) yang akan jang 20 km kewenangan Pem- jembatan penghubung Sikapas- Sementarapeningkatanjalan pati Madina H Amru Daulay,SH (8/11). dalam nota jawaban dibacakan pungansementara,pembersihan diajukan nantinya pada RAPBD provsu yang pelaksananya Dinas Batu Mundom, lanjut bupati, Manisak-Ranto Nalinjang, dije- dan revitalisasi fasilitas umum. 2010. Penyerahan sertifikat ebagai bentuk komitmen PT SKL Bina Marga. telahdilaksanakanpembangunan laskan Amru Daulay, untuk pro- oleh Sekdaklab Drs Azwar Indra “Saat Musrenbang provinsi dengan konstruksi rambin me- gram TA 2010 ruas jalan tersebut Nasution,MMdalamsidangpari- Meskipun masa tanggap Pada bagian lain Amru juga yang bergerak di bidang perkebunan kelapa sawit di Kec. di Medan telah dikordinasikan lalui sumber dana PNPM 2008, belum dapat ditangani melalui purna DPRD Madina, Rabu ( 11/ darurat 14 hari kata bupati, menjelaskan, diajukannya Ran- Muara Batang Toru, Kab. Tapsel dan tindak lanjut dari hasil langsung supaya 2010 jalan ter- sedangkan rencana penghubung APBD Madina. Begitu juga pem- 11). namunkebutuhanpanganwarga perda tentang pembentukan musyawarah masya-rakat Desa Hutaraja yang tergabung di kawasan Siulangaling telah sebut prioritas penanganannya,” ke Batu Mundom melalui jalan bangunan irigasi Siabu-Bukit “Dalam rakor disampaikan organisasi dan tata kerja Badan dalam koperasi Tondi Bersama dengan PT SKL yang difasilitasi dipersiapkan untuk masa 45 Penanggulangan Bencana Dae- ujar Amru dalam nota jawaban nasional Simpang Pondok Ram- Malintang, karena melebihi 3.000 bencanayangterjadimurniakibat Pemkab Tapsel. dibacakan Sekdakab Drs.Azwar be-Batu Mundom sepanjang 7 hektare yang sesuai ketentuan hari,dan sampai saat ini Satlak rah ( BPBD) Madina, karena me- faktor alam karena curah hujan Bupati Tapsel Ongku P Hasibuan dalam sambutannya Indra Nasution, MM atas peman- kilometer telah terbuka melalui peraturan Menteri PU adalah ke- melebihi batas normal di hulu terus memonitoring di lapangan rupakan amanat dari Undang- mengatakan, penyerahan sertifikat ini merupakan langkah dangan umum I fraksi-fraksi kerjasama dengan perusahaan wenanganpemerintahpusat.(a24) sungai perkampungan dan me- hingga dilaksanakannya reha- Undang No. 24/2007. (a24) maju bagi pihak PT SKL bersama masyarakat untuk melakukan DPRD Madina terhadap 15 Ran- perkebunan swasta nasional. pengembangan perkebunan kelapa sawit di Kec. Muara Batang perda dalam sidang paripurna, Peningkatan jalan lingkar Kel. Toru, sehingga dapat mendongkrak tingkat perekonomian Rabu (11/11). Simpang Gambir dan pening- masyarakat ke depan. Selain itu, kata bupati, pem- katan jalan Kel.Tapus-Pangkalan Bupati mengatakan, PT SKL selaku pemegang Hak Guna bangunan dan peningkatan ruas serta peningkatan jalan Tangsi jalan Tabuyung-Sale Baru, Ta- Bawah-Kampung Sipirok, me- Usaha (HGU) untuk mengelola lahan di Kec. Muara Batag buyung-Manuncang-Suka Mak- nurutnya juga telah terprogram Toru dengan rencana luas mencapai 10.425,3 ha untuk terus mur-Manuncang-Panunggulan- di antara ruas jalan tersebut. baru menjalin kemitraan dengan masyarakat. (a19) TagilangJuludiKec.MuaraBatang jalan jurusan Tangsi Bawah-
  • 18. WASPADA Jumat 13 November 2009 Aceh 21 Penyebab Banjir Karena Baru Rampung, Saluran Tanggul Tak Berfungsi Anti Banjir Ambruk Lagi BIREUEN (Waspada): Belum adanya tanggul pem- PANTONLABU, Aceh Utara pingi Wakilnya Mustafa, 28, Rabu buangan air yang memadai mengakibatkan Kec. Makmur (Waspada): Baru dua bulan ram- (11/11). Bireuen rawan banjir bandang setiap musim hujan, seperti pung, saluran pembuang air atau Menurut Ridwan, leaning terjadi Senin (9/11). leaning anti banjir di Dusun Darus- sangat penting bagi masyarakat “Normalisasi Krueng Leubu yang sedang dikerjakan salam, Desa Tanjoeng Minjee, Ta-nah karena merupakan satu-satunya tidak berfungsi sepenuhnya, karena jaraknya hanya 4 Jambo Aye, Aceh Utara ambruk lagi. kanal pembuangan air di kawasan km, seharusnya pemerintah menormalisasi sepanjang Pantauan Waspada, saluran itu itu. Jika leaning benar-benar am- 13 km hingga Desa Lapehan. Insya Allah ini akan mengatasi memiliki panjang sekitar 100 meter, bruk total, dipastikan sebagian De- banjir bandang setiap tahun,” ujar Sofyan, 41, tokoh dari pinggiran jalan lingkungan ber- sa Tanjoeng Minjee kembali teren- masyarakat Makmur, Rabu (11/11). muara ke sungai Jambo Aye. Di be- dam banjir pada puncak musim Normalisasi Krueng Leubu sudah menjadi kebutuhan berapa titik saluran beton tersebut hujan kali ini, sebagaimana tahun- yang tidak dapat ditunda lagi, mengingat sekarang musim terlihat retak-retak. Bahkan sekitar tahun sebelumnya. hujan, sehingga ancaman banjir bandang terus terjadi sepuluh meter di antaranya ambruk. “Saat proyek yang didanai di Desa Cot Kruet, Lapehan, Trieng Gadeng, Leubu Kuta, “Rekanan tidak membuat beton APBK ini mulai dibangun, masya- Leubu Cot dan Leubu Mesjid dan desa sekitar. penyangga di atas permukaan salu- rakat berharap air akan mengalir “Warga sudah sangat menderita, selain rumah teren- ran, sehingga mudah ambruk. Se- lancar ke sungai Jambo Aye. Tapi dam, saat musim tanam mengakibatkan ratusan hektar lain itu campuran material semen belum sampai dua bulan, leaning padi sawah terancam gagal panen, begitu juga beberapa dan batu diduga diakal-akali kon- kembali ambruk. Ini membuat sekolah terendam seperti SMP Leubu Cot, SD Cot Kruet, traktor sehingga bangunan tidak masyarakat kembali resah,” imbuh SD Leubu Cot dan SD Kuta Barat sehingga aktivitas belajar kokoh. Jika tidak segera disempur- Ridwan seraya menambahkan, mengajar terganggu. nakan, kami yakin dalam waktu de- sebelumnya masyarakat protes Untuk mencegah banjir kiriman yang terjadi setiap kat semua dinding leaning bakal dan minta rekanan membuat be- tahun, Sofyan minta Pemkab Bireuen dan Pemerintah runtuh,” kata Ketua Pemuda Tan- ton penyangga di atas leaning, tapi Aceh menormalisasi Krueng Leubu yang selama ini tidak joeng Minjee Ridwan, 29, didam- tak digubris kontraktor.(cmus) berfungsi karena dangkal dan sempit.(b03) Pengibar Bendera Hari Ini, Pimpinan DPRK HKN Tumbang Banda Aceh Dikukuhkan BANDA ACEH (Waspada): Pim- Dikatakan, peresmian, peng- BIREUEN (Waspada): Rahamil Jannah, 16, siswi kelas pinan DPRK Banda Aceh difenitif angkatan/penyumpahan pimpi- III, SMA Negeri I Bireuen asal Desa Blang Dalam, Kec. masa bhakti 2009-2014 dijadwalkan nan DPRK Banda Aceh priode Peudada, angota pasukan penggerek bendera Hari Jumat (13/11) hari ini dilantik dan 2009-2014 sebelumnya sudah di- Kesehatan Nasional (HKN) ke-45 di halaman Meuligoe diambil sumpahnya dalam sidang jadwalkan, Selasa (10/11). Namun Bupati, Kamis (12/12) dikabarkan tumbang usai acara paripurna istimewa. karena kedua pejabat hukum di PN dan dilarikan ke RSUD dr Fauziah. Setelah dirawat Sekretaris Dewan (Sekwan) Banda Aceh berhalangan dan se- kondisnya berangsur membaik DPRK Banda Aceh melalui Kabag dang tugas ke luar daerah terpaksa Menurut informasi, pelaksanaan pengibaran bendera Umum Drs. Hasballah Ajad, Kamis ditunda hari ini. merah putih berlangsung lancar dan sukses, namun usai (12/11) mengatakan, peresmian, Pimpinan DPRK Banda Aceh pelaksanaan seorang pasukan Paskibra harus dilarikan pengangkatan/penyumpahan pim- itu masing-masing Ketua Yudi Kur- ke RSU karena pingsan. pinan DPRK Banda Aceh itu dilaku- nia, SE (Partai Demokrat), Basya- Beberapa saat setelah dievakuasi ke UGD, kondisi kan Wakil Ketua Pengadilan Negeri ruddin (Abu Sara) dari Partai Aceh Rahamil Jannah berangsur pulih tapi masih terlihat lemas Banda Aceh M. Arsyad Sundusin, SH, dan Razali, S.Ag, dari Partai PKS. dan belum bisa diajak bicara.(b03) atas nama Ketua Mahkamah Agung. Bersamaan dengan itu juga Sebenarnya yang akan mengu- diumumkan susunan fraksi DPRK Lingkungan Kotor Ancam kuhkan sumpah terhadap pimpi- Banda Aceh priode 2009-2014 oleh nan dewan, itu oleh Ketua PN Ban- ketua dewan difinitif. Sedangkan Kesehatan Warga da Aceh, tapi karena beliau berha- sorenya dilakukan pengesahan tata langan maka digantikan Wakilnya, tertib dewan yang telah selesai KOTA LHOKSEUMAWE (Waspada): Kondisi lingkung- tutur Hasballah. dibahas Pansus. (b06) an yang kotor, mengancam kesehatan warga Pemko Lhok- seumawe. Paling tidak, sepanjang 18 kilometer drainase di kota ini yang meliputi beberapa desa di Kec. Banda Sakti (pusat Polisi Usut Penyelewengan kota) dan Kec. Muara Dua, Pemko Lhokseumawe kerap tergenang. Hal tersebut diakui Kadis Kesehatan, Saifuddin Waspada/Musyawir Dana Popda 2008 Saleh, SH kepada pers usai upacara peringatan Hari Kese- AMBRUK: Baru dua bulan rampung, saluran pembuangan air atau leaning anti banjir di Dusun Darussalam, Desa SABANG (Waspada): Polres Sa- pada laporan pertangungjawaban hatan Nasional (HKN) ke 45 di lapangan Hirak, Jl. Merdeka Tanjoeng Minjee, Tanah Jambo Aye, Aceh Utara kembali ambruk. Foto direkam Rabu (11/11). bang mengusut dana Pekan Olah yang orientasinya langsung berke- Lhokseumawe, Kamis (12/11). Raga Pelajar Daerah (Popda) tahun naan pada pemalsuan tandatang- Wilayah Pemko ini rentan terhadap penyakit berbasis 2008 pada Dinas Pemuda dan Olah an,” katanya. lingkungan, seperi Deman Berdarah Dengue (DBD) dan Raga Kota Sabang. Kapolres menguraikan, mun- Malaria. Karenanya, kepada masyarakat diminta selalu menjaga kebersihan lingkungan. Joroknya lingkungan perawatan kebersihan drainase, katanya berakibat kepada mudahnya berkembang jentik- jentik nyamuk yang dapat mengancam kesehatan warga. Pameran Terapung “Kita sedang mengumpulkan bukti, kita usut kasus ini hingga tun- tas sesuai hukum yang berlaku,” kata Kapolres Sabang AKBP Imam Thobroni, didampingi Wakapolres culnya kasus ini setelah adanya laporan masyarakat Sabang yang saat itu terlibat langsung dalam Popda 2008 di Tapak Tuan. Angga- ran yang seharusnya diperuntukan Di Krueng Geukueh Oleh sebab itu, bersihkan lingkungan untuk menghambat Kompol Mirwazi, SH kemarin. bagi para atlet dan pelatih disalah- siklus bibit nyamuk apapun perlu perhatian semua pihak, Dijelaskan, penyidik Reskrim gunakan oleh oknum pegawai pintanya.(b10) sudah melakukan pemeriksaan dan sampai berujung pada pengaduan memanggil para saksi yang terlibat dari pengurus dan para atlet yang Nelayan Minta Dibuka langsung kasus tersebut. Saksi-saksi yang sudah dipanggil antara lain kecewa. “Waktu itu dana yang dianggar- Kanpel Di Bireuen ACEH UTARA (Waspada): Pemkab laksanakan di kapal pesiar dan di da- era penuh persaingan. Karena itu para pelatih dari sembilan cabang olahraga dan 18 atlet. kan dalam APBD sekitar Rp400 juta lebih, temuan sementara yang ter- Aceh Utara menggelar pameran rat. Dulu sebelum ini dilakukan ba- masyarakat Aceh kita minta terus BIREUEN (Waspada): Nelayan di Bireuen minta nyak orang protes. Tapi perlu diketa- berbenah agar tidak kalah bersaing.. Dari hasil penyelidikan semen- catat dalam penyelidikan, penyim- pemerintah membuka Kantor Pelabuhan (Kanpel) untuk terapung di atas kapal di hui, kalau tidak ada langkah pertama Nanti ke depan akan banyak negara tara, terjadi penyalahgunaan dana pangan sekitar Rp20 juta lebih, ke- melayani ribuan ratusan boat yang mengurus dokumen Pelabuhan Umum Krueng mana mungkin ada langkah ke sera- yang berkunjung ke Aceh,” sebutnya. dan adanya indikasi manipulasi mungkinan besar jumlah ini ber- kapal penangkap ikan. tus,” ucap Syarifuddin, SE, Wakil Bu- Beberapa kapal yang telah kita data serta tandatangan palsu dila- tambah. Masih ada laporan lain Syarwan, 33, nelayan di Bireuen, Rabu (11/11) Geukueh, 10 - 31 Desember 2009, kukan oknum pegawai AR. yang belum terhitung, termasuk pati Aceh Utara. siapkan untuk bergabung di Expo mengatakan, pihaknya kesulitan mengurus dokumen diikuti lima negara tetangga. “Ada beberapa temuan yang in- bantuan dana provinsi untuk ma- Disebutkan, selain lima negara 2009 yakni Marisa dan beberapa ka- kapal sebab harus mengurus ke Administrator Pelabuhan tetangga ada beberapa negara lain pal dari Malaysia. Langkah ini positif dikasinya kuat terjadi penyalahgu- sing-masing kab/kota saat Popda (Adpel) Lhokseumawe sekitar 60 kilometer dari Bireuen. Aceh Utara akan memamerkan be- yang sedang dalam pendekatan. In- untuk pemberdayaan ekonomi. Un- naan dana diperuntukan bagi para berlangsung. Ini belum kita perik- “Bagi kapal-kapal penangkap ikan di atas 7 gross berapa komoditi unggulan kepada para formasinya, para pecinta laut dari tuk itu, Pemkab butuh dukungan se- atlet dan pelatih tidak sesuai porsi sa, namun yang sangat fatal dari tonase, surat-surat kapal tidak bisa dikeluarkan lagi oleh pedagang dari negara tetangga. Tiga Yunani dan Perancis menyatakan mua pihak, khususnya dari Peme- dan peruntukan. Termasuk temuan pemeriksaan kita adanya mani- Dinas Kelautan Dan Perikanan, melainkan harus diurus dari lima negara tetangga yang menya- kesiapannya singgah di Expo 2009 ini. rintah Provinsi Aceh. terhadap manipulasi data atlet yang pulasi data dan pemalsuan tanda di Kanpel di bawah Departemen Perhubungan. Kami takan kesiapannya yaitu Jepang, Malay- “Mulai hari ini kita melakukan “Perdagangan bebas sudah di tidak sesuai jumlah yang tertera tangan,” sebutnya.(b29) telah sampaikan permintaan ini kepada Kepada Dinas sia, dan Korea. sosialisasi tentang pameran teram- depan mata. Sebaiknya kita segera Perhubungan Telekomunikasi dan Informatika Bireuen,” jelasnya “Ini tindaklanjut Expo 2007, 2008 dan merupakan Expo ke tiga di tahun pung, agar masyarakat tidak terkejut. Kita ingin memperlihatkan seperti berbenah untuk menghadapi pasar bebas tersebut. Kalau tidak, kita akan Tanam Modal 990 Miliar Dolar Kepala Dinas Perhubungan Drs. Azhari Usman, M.Si yang dikonfirmasi membenarkan Kanpel sudah sangat dibutuhkan untuk melayani kapal-kapal nelayan di 2009. Untuk tahun ini, pameran di- inilah yang disebut era globalisasi, salah saing.”(cmun) Untuk Bangun Ekonomi Kerakyatan Bireuen. “Apalagi kita sudah memiliki Pelabuhan Perikanan Ikan (PPI) yang resmi di Peudada, saya sudah mengirim Pencemaran Laut Meluas Ke Garis ACEH UTARA (Waspada): Sab- ban Malawi, Direktur PT. Invest- ment Finace Resorces Aregement tinggal menunggu kesiapan Aceh Utara, mana-mana yang perlu diprioritaskan dan mana yang akan surat permohonan ke Departemen Perhubungan Direkto- rat Perhubungan Laut untuk membuka Kanpel di Bireuen.”(b03) Pantai Lhokseumawe (Infra) Group dari Jakarta, Rabu (11/ 11) di Pendopo Bupati Aceh Utara kepada Waspada mengatakan, pi- dilaksanakan tahap ke dua,” sebut Malawi. Komitmen yang sudah terbina KOTA LHOKSEUMAWE, (Waspa- mutu sudah melebihi ambang batas haknya menyiapkan dana 990 mi- antara Pemda Aceh Utara dengan da): Pencemaran laut yang berakibat yang ditolerir,” tandas Ishaq Rizal. Pelamar PGSD Untuk fatal terhadap berbagai jenis biota laut, Begitu pun, kata dia, walau seca- liar dolar untuk membangun eko- nomi kerakyatan daerah tertinggal PT. Infra Group selama ini yaitu hu- bungan komunikasi tentang ren- berdampak ke garis pantai Pemko ra kasat mata orang sudah berasumsi CPNS Paling Menonjol Lhokseumawe. laut itu tercemar, kita belum berani di Aceh Utara. Salah satu proyek yang akan di- cana Pemkab Aceh Utara. Nanti- nya program-program Aceh Utara Kepala Badan Lingkungan Hidup mengatakan penyebab pencemaran BIREUEN (Waspada): Pendaftaran CPNS Daerah Kab. laksanakan di Aceh Utara dan Kota akan disesuaikan dengan rencana dan Kebersihan (Kaban LH dan K) dari unsur apapun. “Sebab, masalah Bireuen dari 297 formasi yang dibutuhkan, pelamar D- Lhokseumawe yakni bidang perhu- pemerintah pusat, sesuai kepen- Pemko Lhokseumawe, Drs. Ishaq Rizal, kandungan unsur berbahaya yang 2 PGSD paling menonjol dibanding formasi lainnya. bungan, pariwisata dan pemba- tingan daerah. “Ini program peme- M.Si (foto) membenarkan, pihaknya berdampak kepada indikasi pence- Dari sejumlah formasi penerimaan pelamar puteri ngunan ekonomi kerakyatan di dae- rintah untuk mengentaskan ke- sudah menerima informasi terhadap maran, itu persoalan ilmiah. Hasil mendominasi. Hingga Rabu (11/11) formasi pendidikan rah tertinggal dengan menghidup- miskinan,” katanya. pencemaran air laut di wilayah pantai pengujian sample standar baku mu- yang sudah mendaftar 662 orang D2 PGSD mayoritas kan koperasi, membangun peru- Menanggapi komentar Sabban Pemko ini, katanya kepada Waspada, tu lingkungan, baru dapat diketahui puteri, sedangkan formasi yang ditutuhkan hanya 24 mahan, perkebunan dan beberapa Malawi, Syarifuddin, SE, Wakil Bu- Kamis (12/11). pemantau polusi udara kita turun- apa yang terkandung untuk masing- orang. proyek lainnya. pati Aceh Utara menjelaskan, para Sebagaimana diberitakan (Kamis, kan ke lokasi untuk mengambil sam- masing parameter.” Sementara 4 formasi, dokter gigi, psikologi plus profesi, “Ini langkah mensejahterakan investor tergabung dalam PT. Infra 12/11), ratusan kilogram ikan mati tera- ple ikan yang mati, biota laut lainnya Pada kesempatan terpisah, ka- D3 Retraksionis Optisi, D3 Anestesi, Sarjana Statistika rakyat Indonesia. Mudah-mudahan Group dari Jakarta merupakan ha- pung di laut lepas pantai Krueng Geu- dan air laut guna kita periksa di labo- ban Lingkungan Hidup (LH) Aceh dan Tenaga Teknis psikologi plus sertifikasi profesi hingga dengan program ini kita mampu sil lobi Pemkab selama ini. Seiring kueh, Kab. Aceh Utara. Indikasi itu dite- ratorium yang telah terakdetasi,” Utara, Ir Muchtaruddin memberi ko- Selasa (10/11) masih kosong, belum ada peminat. mengentaskan kemiskinan. MoU semakin kondusifnya kondisi ke- mukan Wakil Bupati Bupati Aceh Utara, katanya. mentar yang sama dengan Kaban Sekretrareis Badan Kepegawaian, Pendidikan dan dengan Pemda Aceh Utara telah amanan di Aceh, para investor mu- Syarifuddin, SE dalam perjalanan (eks- Persoalan pencemaran laut, kata LH dan K Pemko Lhokseumawe. Ia Pelatihan (BKPP) Bireuen, M. NasirYusuf mengemukakan ditandatangani empat bulan lalu. lai berdatangan dari seluruh pen- pedisi) sepanjang pantai Aceh Utara, Kaban LH dan K Pemko Lhokseuma- akan membentuk tim, berikut akan itu di kantornya, Rabu. Kita siapkan dana 990 miliar dolar, juru Indonesia.(cmun/b10) Rabu (11/11). we, bukan hanya kali ini. Tapi, per- melakukan survey lapangan, Senin Dikatakan, di formasi kesehatan pelamar SPK 310 Kiranya hal yang sama, juga terjadi (16/11) orang didominasi pelamar puteri yang dibutuhkan hanya 20 orang, disusul D3 Keperawatan 216 pelamar dibutuhkan di sepanjang 13-14 kilometer di garis pantai Pemko Lhokseumawe, sejak dari nah terjadi di tahun 2007 dengan in- dikasi air laut dari warna biru beru- bah jadi merah, sehingga para nela- “Kami daerah tetangga Pemko Lhokseumawe, akan membentuk Wagub Minta Pensiunan PNS 20 orang didominasi pelamar puteri dan D3 Kebidanan 173 pelamar (puteri) dibutuhkan hanya 20 orang.(b16) Pelabuhan umum Krueng Geukueh – Krueng Meuraxa di Kec. Blang Mangat, yan resah. “Ketika itu tak sempat ikan mati tim, Jumat (hari ini-red) bergabung dengan Dinas Perikanan dan Kelau- Bantu Pemerintah Aceh sebut Ishaq Rizal. terapung seperti sekarang ini, hanya tan, karena persoalan ini terkait de- BANDA ACEH (Waspada): Para wartawan. Posyandu Jeumpa Juara I “Hari ini (Kamis, 12/11), tim pe- mantau kualitas lingkungan air dan tim sebatas warna laut kemerah-mera- ngan kematian ikan secara massal,” kata Muchtaruddin.(b10) Pegawai Negeri Sipil (PNS) yang Menurutnya, peran serta para han. Kali ini, mungkin standar baku Cerdas Cermat HKN telah pensiun diharapkan berperan pensiunan amat berarti untuk me- BIREUEN (Waspada): Tim Kader Posyandu Kec. Jeumpa meraih juara I lomba cerdas cermat menyemarak- Penderita Gangguan Jiwa 2.015 Orang, 19 Dipasung membantu Pemerintah Aceh de- ngan memberikan berbagai masu- kan buah pikirin kepada Pemerin- wujudkan kemajuan berbagai bidang di daerah ini. Bahkan, kata Wagub, potensi yang dimiliki para kan peringatan Hari Kesehatan Nasional ke 45 yang digelar BIREUEN (Waspada): Penderita penderita sudah mandiri dan dapat lisasi dan memberi pelayanan kese- tah Provinsi Aceh demi pembangu- pensiunan itu perlu dikembang- Dinkes bekerjasama Sive Chilfren Bireuen di aula Dinkes, gangguan jiwa yang sudah terdata di disembuhkan, 882 lainnya masih hatan bagi masyarakat pedesaan, nan dan kemajuan daerah itu. kan sehingga dapat membantu pe- Selasa (10/11). Kab. Bireuen mencapai 2.015 orang, butuh bantuan pemerintah dan termasuk usia lanjut (Lansia). Demikian diungkapkan Wakil merintah khususnya dalam me- Tim kader Posyandu Kec. Jeumpa yang menurunkan 134 penderita gangguan jiwa berat keluarga. Menurut drg. Nurhayati, jumlah Gubernur Aceh Muhammad Nazar ngatasi persoalan-persoalan tiga kader masing-masingYuslinar Desa Blang Cot Tunong, pungo (tidak waras). Sementara 19 di Kendala belum tuntasnya pe- Posyandu di desa 181 unit (30 per- pada Seminar dan Deklarasi Yaya- pembangunan, pemerintahan dan Muliani Desa Beurawang dan Yusnidar Desa Seuneubok antaranya masih dipasung, dirantai nyembuhan di jajaran Dinkes Bi- sen) dari kebutuhan Posyandu seki- san Persaudaraan Pensiunan PNS, kemasyarakatan. Lhong unggul setelah menyisihkan Kader Posyandu Kec. dan dikurung di kamar khusus. reuen, disebabkan minimnya dana tar 600 desa. Sementara jumlah mas- Badan Usaha Milik Daerah/ Badan “Saya menilai BUMD di Aceh Peusangan dan Kader Posyandu Gandapura. Kadinkes Bireuen, dr. Mukhtar me- rujukan. Tahun 2009 dana rujukan yarakat lanjut usia yang sudah ter- Usaha Milik Negara (BUMD/ saat ini sedang mengalami perma- Demikian Kadinkes Bireuen dr. Mukhtar didampingi lalui Kabid Pelayanan Kesehatan Dasar, APBD hanya Rp39 juta untuk mem- data 9.839 orang. Hingga September BUMN) Provinsi Aceh di Asrama salahan, terutama terkait dengan Kabid KIA Nurjannah selaku panitia penyelenggara lomba drg. Nurhayati didampingi Kasi Ramli biayai dana rujukan penderita gang- 2009 sebanyak 2.047 Lansia sudah Haji Banda Aceh, Selasa (10/11). manajemen sehingga diperlukan balita sehat, cerdas cermat kader Posyandu, di kantornya, Daud, SKM menjelaskan itu di kan- guan jiwa dan rujukan penderita berkunjung ke Posyandu untuk “Tenaga dan pikiran dari para upaya-upaya pemulihan. Saya Rabu (11/11). tornya, Rabu (11/11). balita gizi buruk, yang dinilai sangat mendapat pelayanan kesehatan. pensiunan, terutama mantan peja- optimistis, para pensiunan teruta- Sementara dalam lomba balita sehat diikuti 17 balita Dikatakan, 2.015 penderita ini aki- minim. Sedangkan 7.792 lainnya di bat yang telah berpengalaman di ma mereka yang pernah menjadi dari 17 kecamatan, Salwa Alisaputri asal Kota Juang juara bat imbas konflik, narkoba dan sosial Posyandu pedesaan yang belum memiliki Pos- birokrasi agar dapat memberikan pejabat termasuk bupati ketika I. Raisa Ulil Hawa asal Kec. Jeumpa juara II dan Mailanda ekonomi (kemiskinan). 1.756 Di antara- Pos Pelayanan Terpadu (Posyan- yandu terpaksa mendapat pela- konstribusi pikiran dan pendapat- masih aktif, memiliki kemampuan Yatifa asal Kec. Kuta Blang juara III.(b16) nya sudah mendapat perawatan. du) di desa-desa sangat memegang yanan kesehatan di Puskesmas ter- nya kepada pemerintah,” kata Wa- meningkatkan manajemen Dari perawatan yang dilakukan, 727 peranan penting dalam mensosia- dekat.(b16) gub Muhammad Nazar kepada BUMD,” sambung Nazar. (b09)
  • 19. 22 Aceh WASPADA Jumat 13 November 2009 Kapolres Perintah Tembak Pukat Ikan Tanpa Izin SINGKIL (Waspada): Selain perintah tembak, Selain tindakan tegas terha- Sibolga, Sumatera Utara. terbesar sektor perikanan dan Kapolres Aceh Singkil Kapolres juga menginginkan dap penegakan hukum di perai- “Lemahnya hukum di laut kelautan bagi daerah lain,” se- kapal Trauw dan Pukat Hari- ran laut Singkil, mantan Kapol- selama ini, menjadikan Singkil but Ketua DPC HNSI Kab. mengeluarkan perintah mau yang berhasil ditangkap res Bener Meriah itu juga tidak sebagai penyumbang devisa Aceh Singkil itu.(cb02) tembak terhadap PI (Pukat ditenggelamkan di dekat pela- akan tebang pilih dalam mena- Ikan) yang tidak memiliki buhan Singkil. Ini untuk meng- ngani pelaku kriminal. “Siapa izin beroperasi di perairan hindari keresahan masyarakat atas beroperasinya Pukat Ikan pun yang melanggar hukum akan berhadapan dengan Polres Malam Hari, Kota Idi laut Singkil. Penegasan tersebut disampaikan yang diduga berasal dari Sibol- ga, karena selama ini, menu- Aceh Singkil, tanpa kecuali.” Begitu pun, agar penega- Kerap Jadi Kandang Sapi AKBP Helmi Kwarta rutnya, masyarakat nelayan kan hukum di wilayah Polres IDI, Aceh Timur (Waspada): Malam hari, kota Idi sebagai pusat tradisional di Singkil merasa Aceh Singkil dapat terlaksana Ibukota Kab. Aceh Timur kerap menjadi kandang sapi. Akibatnya, Kusuma Putra Rauf, S.Ik, terancam dengan hadirnya dengan baik, selain dukungan setiap pagi kotoran sapi berserakan di jalan utama seperti jalan MH, menyahuti keresahan Pukat Ikan di laut Singkil itu. semua pihak, kerjasama dari Jenderal Sudirman. nelayan tradisional Singkil, Kecuali itu, kata Kapolres, masyarakat juga sangat diha- Menurut warga, berseraknya kotoran sapi disebabkan seringnya saat kunjungan kerja ke pihaknya akan mentolerir Pu- rapkan, ujar Helmi. puluhan ekor sapi bebas berkeliaran, mondar-mandir di Kota kat Ikan yang beroperasi di laut KM Elang Laut Idi Rayeuk. “Lembu-lembu terlihat bebas berkeliaran di dalam Waspada/ist Mapolsek Singkil, Rabu Singkil selagi tidak memasuki Sebelumnya, H. Rosman kota, baik siang maupun malam hari,” sebut Iskandar, Rabu (11/ Program Advisor, Cahyo Pramono dan Romawati Sinaga dari The Asia Foundation serta (11/10). daerah tangkapan nelayan tra- Hasmy mewakili masyarakat 11) di Kota Idi. tim program, tampak serius mengikuti rapat evaluasi program Penguatan Advokasi Jejaring disional, dan bersedia mem- Singkil membenarkan, selama Dikatakan, bila malam hari lembu-lembu yang tidak diketahui UKM di Aceh di kantor Forda UKM Sumut, Rabu (11/11). bongkar hasil tangkapannya ini Pukat Ikan terus beroperasi siapa pemiliknya itu tidur pulas di depan ruko Kota Idi atau di “Saya perintahkan untuk di pelabuhan Singkil. di perairan laut Singkil. Bahkan tempat lainnya. “Sedangkan siang hari, lembu-lembu itu bebas Tiga Forum UKM Resmi melakukan penembakan ter- hadap Pukat Ikan yang mema- Untuk mendukung kegia- tan tersebut, Helmi mengaku dalam melakukan aksinya pu- kat trauw tidak segan – segan berkeliaran, mengakibatkan macatnya lintasan jalan kota.” Instansi terkait diharap mengambil tindakan secepatnya. suki daerah laut nelayan tradi- telah meminta bantuan Ka- melakukan operasi dekat bibir “Apakah dengan ditangkap dan diserahkan kepada pemiliknya Berdiri Di Aceh sional,” tegas Helmi kepada Kasat Airud Polres Aceh Sing- polda berupa kapal patroli dan penambahan personil. “Saya pantai, sehingga memudah- kan masyarakat mengenali pu- disertai sanksi,” ujar Sakya alis Cek Ya, warga Kota Idi.(cmad) sudah minta Kapolda mem- kat tersebut yang salah satu- MEDAN (Waspada): Tiga Forum Daerah Usaha Kecil dan Menengah (Forda UKM) ka- Program Advisor, Cahyo Pramono pada kesempatan itu menambahkan, “Ini perte- kil, Peltu L. Sembiring yang mendapat sambutan hangat bantu kapal patroli dan perso- nya adalah KM Elang Laut, Mopen Jumbo bupaten di Provinsi Aceh, masing-masing Forda UKM Kabupaten Bireuen, Forda UKM muan rutin untuk mengukur keberhasilan dan kelemahan pelaksanaan program.” masyarakat. nil,” sebutnya. yang diduga milik nelayan Seruduk Rumah Duafa Bener Meriah dan Forda UKM Aceh Barat Perjalanan panjang mengiringi gagasan LANGSA (Waspada): Karena mengelakkan sepedamotor, mobil Daya, sudah resmi berdiri. ini. Mulai dari penghimpunan permasala- penumpang jenis ADT Jumbo menyuruduk rumah milik duafa Keberadaan forum UKM ini diharapkan han yang dihadapi pelaku UKM melalui ge- di kawasan Sarah Teube, Kec. Rantau Selamat, Kab. Aceh Timur, jadi wadah pelaku UKM di daerah dalam me- laran diskusi terfokus sepanjang September Rabu (11/11) sekira pukul 08.00. nyalurkan aspirasinya, terutama soal kebija- lalu hingga kepada sosialisasi tentang pera- Menurut keterangan di lokasi, peristiwa mengejutkan pemilik kan ekonomi lokal. Forda UKM juga akan nan organisasi dalam mengatasi problema rumah itu terjadi ketika ADT Jumbo BL 7508 DZ melaju dari arah melakukan kerja-kerja advokasi dan fasilitasi UKM. Seluruh rangkaian kegiatan di 5 kabu- Idi menuju Langsa. Sesampai di lokasi sopir yang belum diketahui bisnis bagi UMKM serta mendorong berlaku- paten di Aceh tersebut, difasilitasi Forda identitasnya mengelakkan pengendara sepeda motor Supra Fit nya sistem pelayanan perijinan satu pintu. UKM Sumatera Utara dan didukung The BL 3854 UB yang datang dari arah berlawanan dan tiba-tiba terjatuh M. Fachriz T, staf program Penguatan Advo- Asia Foundation. di badan jalan. kasi Jejaring UKM yang merupakan komponen Pembentukan Forda UKM lebih dilatar- Sopir ADT Jumbo coba membanting stir sehingga mobil dari program Tata Kelola Ekonomi Daerah Aceh belakangi kompleksnya masalah yang diha- meluncur ke kanan badan jalan dan menyeruduk rumah dari (SPADA – EGA) mengatakan di Medan, Rabu dapi pelaku UKM, salah satunya akses pasar, depan menembus ke belakang. “Saya terkejut sekali, waktu itu (11/11), berdirinya tiga forum UKM ini bagian jaringan bisnis, permodalan dan sebagai- saya sedang menggoreng ikan di dapur,” kata Asiah, pemilik rumah. dari rencana fasilitasi berdirinya forum UKM nya. Karena itu, Forda UKM Sumut sebagai Dikatakan, suaminya masih tidur, tiba- tiba terdengar hantaman di lima kabupaten di Provinsi Aceh. fasilitator, turut andil dalam mempromo- keras dari depan rumah. Ternyata suara seperti gemuruh itu adalah “Untuk mengevaluasi perjalanan pro- sikan produk UKM binaan, termasuk di mobil menubruk rumahnya. Masih untung Asiah langsung lari gram, tim program menggelar rapat bersama antaranya pelaku UKM yang terlibat dalam dari pintu belakang. dengan The Asia Foundation (TAF) di gedung program di Aceh ini. Ketika mobil menubruk rumahnya, suaminya yang masih Forda UKM Sumut, Rabu kemarin. Rapat di- “Beberapa produk UKM Aceh yang terli- tidur spontan terbangun. Kendati bergerak cepat namun kaki hadiri Project Officer SPADA-EGA The Asia bat dalam program ini kita bantu promosi- suaminya sempat tergores kayu bangunan rumah yang jatuh Foundation, Romawati Sinaga, Advisor Pro- nya pada pameran Bank Sumut Expo, awal dihantam mobil. “Sopir kabarnya kabur, sementara di dalam mobil gram Forda UKM Sumut, Cahyo Pramono, November 2009 lalu. Hal-hal lain yang ber- ada empat penumpang, mahasiswa yang hendak ke Langsa,” kata Program Officer Forda UKM Sumut, Maskur sifat menguntungkan akan terus kita jajaki,” Asiah.(cmad) Abdullah dan para staf,” kata Fachriz. kata M. Fachriz.(rel/m27) Fraksi Golkar Minta Polisi Tangani Realisasi Pengelolaan Otsus Pemindahan Proyek Bronjong Tembilar Dan BKPG Masih Rendah Waspada/ Irwandi KUTACANE (Waspada): H. Rasidun Pagan, Ketua Fraksi Golkar SABANG (Waspada): Realisasi pengelola- tahun supaya aparat gampong bisa lang- SAMPAH MENUMPUK: Tumpukan sampah warga Angkup menggunung di pinggir sungai DPRK Aceh Tenggara (Agara) kepada Waspada, Kamis (12/11), an keuangan program Otonomi Khusus (Ot- sung memanfaatkannya. Begitu juga Peusangan yang berjarak 5 -10 meter dari permukiman penduduk. minta polisi “menangani” sinyalemen konspirasi penyimpangan sus) dan Bantuan Keuangan Peumakmu dengan Otsus, pihaknya sudah bekonsultasi dan pemindahan lokasi proyek bronjong, lokasi bencana tembilar dan dugaan penyimpangan kerja kontraktor. Nanggroe (BKPG) masih rendah, yakni di ba- wah 30 persen. Ketua Tim Monitoring dan Evaluasi Sa- dengan Direktur Jenderal BAKD dan Direk- tur Jenderal Keuangan, ada wacana peruba- han Qanun dan Juklak untuk pelaksanaan Sampah Menumpuk, Rasidun Pagan, yang terpilih dari zona Kec. Bambel, mengatakan, dari berbagai informasi yang diserap, disinyalir ada suatu konspirasi di jajaran dinas SDA tingkat I Aceh, sehingga bang dan Simeulue Aulia Sofyan kepada war- tawan, Senin (9/11), usai pertemuan dengan jajaran Kepala Dinas di Sabang mengatakan, dana Otsus,” terangnya. Menurutnya, kendala yang dihadapi selama ini karena proses tender yang mema- Warga Cemas proyek Otsus tahun 2008 untuk pembuatan brojong di Desa Tembilar, dengan mudah mereka alihkan ke Kec. Darul Hasanah menyikapi persoalan tersebut ada kemungki- kan waktu hingga enam bulan, dan pengelo- yang bukan lokasi bencana. nan ke depan diubah sistemnya, dan tim mo- laannya masih ditangani provinsi. TAKENGON (Waspada): tempat pembuangan akhir persoalan tersebut ke dinas Proyek bronjong bernilai miliaran rupiah sebagaimana nitoring akan merekomendasi hasil evaluasi Namun rekomendasi dari Departemen Menumpuknya sampah di sampah (TPA). terkait. “Ini bukan lagi persoa- diberitakan, mengundang reaksi kekecewaan Bupati Agara H. di lapangan kepada gubernur pekan depan. dalam negeri anggaran Otsus bisa saja Angkup Kec. Silih Nara, Aceh Dampaknya penduduk lan warga, tapi masalah dae- Hasanuddin, B, karena pihak SDA tingkat I maupun PPTK tidak Hal ini akan menjadi catatan Tim Moni- diserahkan ke kab/kota dalam bentuk hibah Tengah semakin mencemas- menggunakan pinggir sungai rah. Namun jika masalah ini kan. Masyarakat yang bermu- Peusangan sebagai tempat belum ada jalan keluarnya, ka- pernah melakukan koordinasi dengan bupati selaku kepala daerah. toring dan Evaluasi Provinsi Aceh, sebab untuk untuk memudahkan pengawasan, sehingga Kecuali itu, Kadis SDA Agara juga tidak tahu soal proyek ini, dan 2009 realisasi dana Otsus masih sangat rendah. sifatnya lebih otonom. kim di sana “tersiksa” dengan pembuangan sampah. Padahal mi khawatir sampah menjadi hadirnya limbah ini. Kebera- lokasi ini hanya berjarak 5 meter sumber penyakit, “ jelasnya. mengambil tindakan memutasi stafnya karena “terlibat” di proyek Perubahan sistem pengelolaan BKPG “Selama di Sabang tim monitoring dan Otsus ini di luar sepengetahuan dinas. maupun dana Otsus tidak lepas dari rendah- evaluasi akan memantau proyek yang di- daan pembuangan sampah dari perumahan warga sebagai Kadis Kebersihan dan tersebut mencemari sungai pilihan alternatif untuk tempat Lingkungan Hidup, Drs. Fah- Soal keterlibatan staf SDA Agara dan sanksi yang diberikan, nya realisasi keuangan, di mana realisasi dana bangun dengan dana Otsus untuk tahun kata Rasidun Pagan, hal ini sangat lemah dijadikan pijakan sebab BKPG Rp100 juta per gampong masih kecil 2009 yang tersebar di sektor pariwisata, kete- Peusangan, yang airnya me- pembuangan sampah (TPS). ruddin, ketika dikonfirmasi ngalir sampai ke Kab. Biruen Menurut Kepala Kampung melalui Kabid Kebersihan, Yus dipindah lokasi proyek bronjong tersebut. Pasalnya, staf SDA Agara dibanding realisasi keuangan untuk program nagakerjaan, dan Pekerjaan Umum. Ke de- ini jelas tidak memiliki kemampuan maupun kekuasaan Mahadi PNPM yang mencapai 100 persen. pan dana Otsus Sabang akan lebih dipriori- dan Lhokseumawe. Angkup Pepayungen, Arjuna, Abdullah, SE, membenarkan, Informasi yang dihimpun, 43, bermacam upaya menang- pihaknya telah melakukan pe- Pinem. “Sebagai antisipasi untuk tahun 2010, jika taskan untuk sektor pariwisata dan ini diaju- Melakukan pemindahan proyek yang telah diplot pada lokasi perlu dana BKPG dapat digulirkan diawal kan pada 2010.” (b29) Rabu (11/11), keberadaan gulangi sampah ini telah dila- ninjauan dua kali ke TPS Ang- sampah itu menganggu akti- kukan bersama warga, namun kup. “Kita akan cari solusi, agar bencana Desa Tualang Sembilar. “Hal begini jelas di level PPTK, fitas. Warga kota Angkup ber- belum teratasi. persoalan sampah itu mampu kepala dinasnya serta kontraktor yang berkonspirasi,” kata ketua OKP Desak KNPI Langsa jumlah 480 KK tidak memiliki Dia telah menyampaikan diatasi,” janji Yus.(b18/cir) Fraksi Golkar ini.(b28) Segera Gelar Musda Terima Gaji 3 Bulan, DPRK Masih Sibuk ‘Urus Periuk’ LANGSA (Waspada): Sejumlah OKP di Kota KNPI Kota Langsa ke depan, baik Alfian Langsa mendesak DPD KNPI setempat agar maupun Chairuddin, berharap agar dipilih “RATIP musara anguk, karnain di ruang kerjanya, Ka- bersikeras diusulkan lima. Ya ini akan dikukuhkan? Belum ngulang pembentukan fraksi. segera membuat Musda untuk memilih para orang yang benar-benar mau bekerja untuk nyawa musara peluk,” falsafah mis (12/11) menjawab Was- akhirnya seperti ini, harus di- diketahui dengan pasti. Seharusnya dewan di sana su- pengurus baru karena masa kepengurusan membesarkan organi-sasi. Dan sebaiknya Gayo yang tak asing lagi bagi pada. adakan rapat kembali,” sebut Yang pasti, dari 5 fraksi dah memasuki tahap pemba- yang lama sudah berakhir, sehingga tidak terjadi bukan dari kalangan birokrat supaya punya rakyat pedalaman Aceh. Mak- Di depan pimpinan dewan Samar Nawan di hadapan yang diusulkan sebelumnya, hasan anggaran yang sangat kevakuman pemimpin bagi kaula muda. waktu yang cukup untuk mengurus kepen- nanya, searah sehaluan, se- lainnya, Zulkarnaian mengha- anggota dewan lainnya. kini harus dilebur menjadi ti- dibutuhkan rakyat. Permintaan itu antara lain disampaikan tingan para pemuda. nang susah sama dirasa. Persa- rapkan agar persoalan fraksi Lima fraksi yang diusul- ga. Otomatis ada yang tidak la- “Ini persoalan daerah. Ba- Ketua Pemuda Mu-hammadiyah, Alfian Syafri Sebelumnya sudah santer disebut-sebut, tuan harus dijaga. di DPRK Aceh Tengah dapat di- kan itu; Fraksi Demokrat dike- gi menjadi ketua fraksi. Dalam gaimana kami mampu be- dan Ketua Pemuda Bulan Bintang, Chairuddin Abubakar Siddiq, Ray Iskandar,SE dan Nasrul Tetapi kenyataannya, DPRK tuntaskan. “Bila sudah tuntas, tuai Ismail SE, Golkar- Hanura penentuan ketua fraksi ini, ada kerja, bila anggarannya tidak SE kepada Waspada di Langsa, Rabu (11/11). Saputra, SSTP MAP akan berasing merebut , Aceh Tengah belum menga- kita akan memasuki pemba- (Imadudin), Aceh Indonesia lagi pertarungan kekuatan un- ada dan belum disyahkan,” Menurut mereka, selaku organisasi induk OKP pucuk pimpinan di KNPI Kota Langsa menda- malkan falsafah nenek mo- hasan anggaran,” sebutnya. Raya (Hasbullah Mango), Ba- tuk menduduki jabatan ketua. sebut salah seorang kepala di- sebaiknya KNPI tidak boleh berlama-lama tang. Ketika nama-nama itu ditanyakan ke- yang. Mereka belum searah Panmus anggaran belum war Linge yang merupakan ga- Catatan Waspada, dalam nas yang ikut dalam pelanti- melakukan musda jika masa kepengurusan pada Alfian dan Chairuddin mana yang cocok, dan belum bersatu. Akibatnya terbentuk, sebut Samar Na- bungan enam partai diketuai pengusulan lima fraksi sebe- kan pimpinan DPRK. suatu periode telah berakhir. mereka malah menyebut nama lain yaitu harus bekerja dua kali dalam wan, anggota dewan lainnya, Halidin dan Fraksi Keramat lumnya yang ditolak biro hu- Tak ada salahnya anggota “Sebab memperlambat musda bisa terke- Taufik Ridla M, SE lebih tepat karena yang pembentukan fraksi. Padahal menambah keterangan Zul- Mufakat di bawah komando kum Pemda Aceh, juga ada ke- DPRK Aceh Tengah dalam si- san pengurus lama sepertinya ingin memper- bersangkutan dinilai telah teruji ke- dewan ini sudah 3 bulan me- karnain. “Kalau memang lam- Muhlis Hasan. kuatan tarik menarik dan tuasi seperti ini mengamalkan tahankan jabatan, padahal sikap seperti itu mampuannya. “Kalau Taufik M Ridla mau nerima gaji, urusan kelengka- ban dalam pembentukan, kita Sementara komisi A diper- upaya lobi sesama anggota de- falsafah nenek moyang mere- tidak baik untuk pendidikan politik bagi genera- maju mencalonkan diri Pemuda Muhamma- pan dewan ( periuk- Pen) saja main keroyok membahas ang- cayakan kepada Wajadal Mu- wan. Ada energi yang terbuang ka. Ratip musara nanguk, nya- si muda,” ujar Alfian yang juga dibenarkan diyah siap memilih dia,” ujar Taufik, dan hal belum tuntas. garan, biar cepat tuntas,” sebut na, SH, komisi B dipegang Ima- di sini, ketika usulan itu kan- wa musara peluk. Satu irama, Chairuddin. yang sama juga diungkapkan Ketua Pemu- Kapan DPRK Aceh Tengah Samar. duddin, komisi C Sirajuddin das di tengah jalan. senasib dalam menjaga kesa- Menyinggung figur yang cocok memimpin da Bulan Bintang, Chairuddin SE.(b22) akan mengurus kepentingan “Persoalan komisi, udah dan M. Ridwan memegang Dampak dari kesalahan tuan. rakyat, membahas anggaran yang ada aja disahkan. Tidak ketua komisi D. Apakah komisi anggota dewan ini, harus me- Bahtiar Gayo Warga Tripejaya Terserang TBC yang saat ini sangat dibutuh- kan. Untuk mengurus periuk dewan sendiri saja belum perlu harus diadakan rapat lagi, karena komisi yang diki- rim ke gubernur udah ada 4 BLANGKEJEREN (Waspada).Penyakit tidak menutup kemungkinan penyakit ini tuntas. komisi,” sebut Saeb Nosarios TBC yang amat ditakuti seluruh masyarakat, bisa meluas ke seluruh pelosok-pelosok Bila 29 anggota dewan di anggota DPRK lainnya. kini kembali muncul di Tripe Jaya. Hal ini kecamatan lain. sana (30 kursi, 1 lagi dalam “Namun semua itu tergan- terkuak setelah beberapa anggota DPRK me- Sedangkan Dr. Nevi Kadis Kesehatan masalah), mengikuti dan me- tung rapat nanti, apakah sete- ngadakan reses ke setiap kecamatan bebe- saat dikonfirmasi menerangkan, “Jumlah ngerti makna undang-undang lah membahas masalah fraksi, rapa hari yang lalu, dah hasilnya ditemukan penderita penyakit ini belum bisa dipasti- no.27 tahun 2009, mereka ti- flour menyetujui penetapan gejala-gejala penyakit TBC di kecamatan itu. kan, jika belum ada hasil dari laboratorium. dak harus bekerja dua kali dan komisi yang sudah ada atau “Beberapa anggota DPRK Kabupaten Kalau kita melihat dari kondisi masyarakat usulan mereka tidak ditolak harus dirubah lagi, ya terserah Gayo Lues yang datang ke Tripe Jaya adalah di sana, penyakit TBC memang ada,” oleh biro hukum Pemda Aceh. peserta rapat,” tambah Taqwa H. Rabusah, Said Sani dan Mardin menuai katanya. DPRK Aceh Tengah me- wakil ketua DPRK Aceh Tengah. hasil. Untuk memastikan kebenaran adanya mang mengusulkan lima Beberapa anggota DPRK Laporan mereka setelah melihat dari pengidap TBC, M. Nurdin Zaini, kepala du- fraksi, sebut Zulkarnain, ketua Aceh Tengah mengakui merasa kondisi masyarakat Tripe Jaya ada yang sun Tripe menerangkan tanda-tanda sudah DPRK Aceh Tengah yang baru malu karena lambannya pe- mengalami penyakit TBC,” kata ketua DPRK, ada dari 2007 hingga sekarang. “Penderita dilantik. Namun usulan itu nanganan soal kelengkapan HM. Amru beberapa waktu lalu. TBC di Tripe Jaya 77 orang, dan yang belum harus dibahas kembali, karena dewan (periuk). Bila sebelum- Amru berharap agar Pemkab setempat sembuh ada 5 orang, dimana yang 5 orang seharusnya yang diusulkan 3 nya semuanya setuju dan tidak segera menindaklanjuti penyakit menular inipun sudah dalam pengobatan,” katanya. fraksi. ada perdebatan beda penda- tersebut. Di samping itu, dia (Amru-red) juga Selain itu dia, kalau masyarakat Tripe “Besok (Jum,at 13/11) akan pat, tiga fraksi yang diusulkan berharap kepada masyarakat yang sudah ter- masih ada yang terkena TBC, mereka eng- dibahas persoalan fraksi ini. sudah tidak menjadi persoalan. kena TBC agar berobat rutin supaya penyakit gan berobat ke Puskesmas karena lebih per- Kita doakan persoalan fraksi “Namun terjadi tolak tarik. tersebut bisa hillang dari Gayo Lues, karena caya dukun.(cb01) DPRK dapat dituntaskan da- Ada yang berprinsip fraksi itu Waspada/ Bahtiar Gayo lam waktu dekat,” sebut Zul- tiga saja, namun ada juga yang DISUMPAH: Anggota DPRK Aceh Tengah sudah disumpah untuk mengutamakan kepentingan rakyat.
  • 20. 23 WASPADA Jumat, 13 November 2009 FAX.4561347 1 CM Rp. 12.000 3 CM Rp. 36.000 5 CM Rp. 65.000 7 CM Rp. 91.000 9 CM Rp. 126.000 11 CM Rp. 165.000 IKLAN KHUSUS HARGA BELUM TERMASUK Khusus Medan Deli, Marelan, Labuhan, Belawan 2 CM Rp. 24.000 4 CM Rp. 48.000 6 CM Rp. 78.000 8 CM Rp. 104.000 10 CM Rp. 140.000 12 CM Rp. 180.000 6x1,5 kolom Rp. 120.000 PPN 10% Hub. 0812 6390 660 Iklan Anda Dijemput Bursa ISUZU Panther 2002 Dijual Cepat. LS 2.5 SUZUKI Escudo Thn. 2005. Bursa Bursa Bursa Service Service AUTOMOTIVE BK Pjg. Harga Bs. Damai. Hub. 1.6 BK Mdn. W. Hitam. RENTAL MOBIL SEPEDA MOTOR KOMPUTER ELEKTRONIK KONSTRUKSI Informasi Pembaca 0852 7567 7142 Jl. Rahmad Syah 206 Hub. HP. 0813 7508 8798 IKHLAS RENT CAR REPARASI AC, KULKAS, MESIN CUCI AC Bursa Automotive Innova 300Rb HONDA GL PRO Thn. 93 Dijual. RYAN TONER Kompor Gas, Dispenser H & C WC TUMPAT, Sal. AIR, K. Mandi TUMPA AC BR : Air Condition : Ban Radial PS PW : Power Stearing : Power Window Panther Pick Up 2006 Rp. 65Jt # TOYOTA 100% BARU # BAR ARU Ready: Innova, Fortuner, Rush, Yaris, Avanza 275Rb Termasuk Supir non BBM. (Mesin hitam). Mulus/terawat. BK DIBELI CATRIDGE : CANON, HP TV, M. Pompa Air Sanyo Hub. SURYA TEKNIK SERVICE Tel. 7878078, 77008458 Vios, Altis, Hilux, D. Cabin (Pick Up 061-913 123 08 - 0852 6118 2406 Telp. 66482216 - 0813 7589 8757 CL ND : Central Lock : Nippon Denso RT VR : Radio Tape : Velg Racing Panther Sporty 1997 Rp. 62Jt Bunga 0%) Tukar Tambah...Oke !!! Panjang. Hub. 0813 7626 5380 CANON 40, 41, 830, 831. HP 21, 22, Siap Ketempat NARO SERVICE Jl. Sisingamangaraja DB : Double Blower EW : Electric Window Hub. 0812 655 6962 / 061 77958206 RENTAL MOBIL 60B, 60C, 27, 28, 56, 57 Pictura Pick Up 2004 Rp. 45Jt 1 hari Rp. 250.000. 1 Jam Rp. 25.000 / Max 4 Jam. YAMAHA RX King Thn. ‘92. W. Hitam, Laserjet. HP 12A, HP 36A, HP 35A, dll. AHLI TOSHIBA, SONY, POLYTRON , S A M S U N G , S H A R P, S A N Y O , SEDOT MOBIL SEDOT : 77737996 BMW 3181 Thn. 90. W. Biru met, TOYOTA 100% BARU Baru / Bekas Dengan Harga Tinggi TV SANKEN, FUJI, DIGITEC, LG, JVC, Mitsubishi Pick Up 2006 Rp. 40Jt AVANZA, RUSH, INNOVA, FORTUNER, YARIS, VIOS, Diantar ke Rumah Konsumen. HP. 061-664 77734 / 0813 9779 1077 Pajak panjang. Hrg. 5,8 Jt/Nego. TV CHINA, DLL. Murah, Full Garansi WC MAJU JAYA : 0852 7093 3649 JA Hrg. 33Jt/Nego. Hub. 0813 6111 1555/ ALTIS, CAMRY, HILUX DP + Bunga Ringan. Hub. 061-76699002 / 0878 682 44474 SIGIT. 76547004 - 0812 6067 7344 0819 33 408099: MURAH : GRS. 1 THN. 061-7742 4248 Zebra Espass Pick Up 2002 Rp. 32Jt Hub. 0813 7512 7297 - (061) 7795 1428 Bursa Hub. 0813 61111 555 / 061 7742 4248 Zebra Espass Pick Up 1997 Rp. 21Jt MAJU TEKNIK WC ANDA TUMPAT - SEDOT CJ7 Th. 85 Bensin. Merah * TOYOTA TERBARU * BUTUH UANG Bursa AC Hi-Lux PU DP 17 Jt-an. Bawa Plg... 7030118 mulus, Udah Jadi Setia Zhaly 061-77599970 Innova Rush, Yaris, Fortuner, Ready Stock. ANDA BUTUH DANA KOMPUTER 76750084 Bunga Ringan. Hub. 061-77875227 KULKAS, M. CUCI Hub. 8219951 Budi Blok CC/10 KIA Picanto Sporty M/T. atau 0815 304 2382 Jaminan Apa Saja, Sertifikat Tanah. Proses Cepat, Syarat Mudah. Hub. DISPENSER (BERGARANSI) Jl. Setia Budi No. 2 DAIHATSU Taruna EFI Type CSX Thn. 2003 (Jual Cepat). Thn. 2005, Biru, BK Mdn Rp. 91Jt. TOYOTA Kijang Super G 061-8222774, HP 0816 314 1807 . Notebook METRO STAR COM - Plaza Millenium Lt.3 Hp. 081 6313 6328 Laptop Baru 10” axioo/Zyrex atom + 250 + Camera. wifi=3.190jt/Baru MADINA SERVICE W. Silver met. AC, Tape, VR, BR, BK Medan Asli Hub. 0812 6594 2789 Thn. 95 asli Medan, Long. Abu Mobil. Sedot BUTUH DANA CEPAT? Laptop: Core2 Core2duo:DELL: Tosiba acer axio + wcam=mulai3xjt AC, Kulkas, M. Cuci, Freezer, Service, Perbaikan. Jl. Brayan Medan WC 0812 642 71725 (An. sendiri). Mesin sehat, Body sgt mulus, jarang pakai. Baru:axioo Dual core Cel Rp. 3.X Jt Acer Compaq Core Duo + Webcam Rp. 4.X Harga 97 Jt/damai abis. Hub. 0813 7618 8118 MITSUBISHI GALANT V6-93. Biru met. Sgt metalic, AC, Tape, VR, PS, Hanya Jaminan BPKB, Semua Jt 2Nd LCD 17Inc LG/acer 15inc Layar Sentuh Acer 4736Z Core2duo + wb Cam_wifi Rp. 6X Jt/Baru Spare Parts. Hub. 061-77972065 - 0812 6310 (touch Screen) acer 4715 Core Duo/512/120/ acer 4630/4732 Dual Core WebCam Wifi/Baru mulus, mesin senyap, jok kulit, alarm. BK Orisinil. Hub. 061-77689316 tahun. Proses Cepat, Syarat Ringan. RW/wifi/Webcam Rp. 3,9Jt HP. Dual Core 1.83/ *LCD acer 15.4 Wide Rp. 1.045Jt/Baru* 4054. Siap ditempat dan bergaransi. Hub. YOGA FINANCE 1gb/80Ggb/Combo/Crystal/Wifi Rp. 3.7Jt Spk Sonic Gear Bt 1/3=530/775 Suara Mantap DAIHATSU Terios TX Matic Asli Mdn, AC, TV, DVD MP3, Sound System. - 0813 7529 9445 TP PAK ADI HP. Toshiba Core2duo/1gb/160Wifi/Dvdrw Rp. 4,5Jt ANEKA: BATRE/HD/Carges/LCD: LAPTOP Telp. 061-455.7607 - 061.6628116 Thn. 2007, Silver, BK Mdn Rp. Siap pakai. Rp. Nego. Hub. 0812 6422 7846 - 061.7781 7498 Compaq Dual Core 1.7/1GB/120/Wifi/ * Toshiba C2 Duo2.1/2/320/Wifi/W. Cam/RW 14 CSV/ DVD Rw/WebCam Rp.3.9Jt PRATAMA TECHNIK TOYOTA Kijang Pick Up Diesel ATI RAdeon/VISTA Rp. 6.5Jt/Grs 5 Bln. Dell C2D2.0/80/1GB/Wifi/ATI Radeon Dedi- MODEM GSM - CDMA MODEM-Best Seller 160Jt. Hub. 0813 9655 7102 REPARASI SERVICE AC SPLIT, WINDOW/ AC MITSUBISHI L300 Minibus Sparta Thn. 05. WC cated 512/RW Toshiba Core Duo-512-60- VR, BR, BK Medan asli - biru. Ex angkat Th. 2001-2002 Htm. BU. Hrg. 77Jt. DANA CEPAT DVDCDRW-Wifi-14 CSV rp. 3.750Jt LCD Laptop Xware BlueCoreduo 12 inc + RW=Rp. 3.9Jt 14 Wide Rp. 1.3Jt. * 15 WXGA Rp. 1.1Jt. Canon: Foto copy color + prin + scan 775rb CENTRAL, DISPENSER, MENGECAT TUMPAT/ SAL. AIR DAIHATSU Classy Warna merah maron Karyawan. Power, Sub woofer lengkap Tape. Mobil siap pakai. Hub. 0813 6150 3449 Hub. HP. 0813 6212 2339 Jaminan BPKB Semua Tahun. Processor Laptop Cel 1.6=250Rb/ Fm/Fd 2 gb=99rb/ADAPTOR/Pendingin: latop Centrino 1.73/2.0=480/625 Rb Byon C2Duo2.2/2/120/W.Cam/Gforce 512=Rp. 4.5Jt KULKAS/JUAL BELI AC BEKAS, DLL 845.8996 Thn. 94. Kondisi siap pakai. Katana Long. Warna HEADSET-MOUSE-ACCESORIS LENGKAP Laptop 12 Inchi + DVD RW +Webcam + Crystal Brite HP. 0812 605 3690 0812.631.6631 hitam Thn. 89. Kondisi siap pakai. harga 28,5Jt. Hub. 0812 6306 0005 / 77582555 MITSUBISHI BARU TOYOTA Kijang Kapsul LGX So- lar Thn. 2001/2002. Sgt mulus, orisinil, Proses Cepat, Syarat Ringan. OBRAL LAPTOP BESAR-BESARAN 7352833 Bergaransi/ Setia Luhur 160 F Bawa Pulang L300 Angs. 3Jt-an. T 120 ss, Colt 110, 125 PS, Pajero Sport, L200,... silver metalic, S. Pakai. Hrg. 125Jt. Hub. (061) 77052032 - Promo habis-habisan, banjir hadiah, harga fantastis DAIHATSU Feroza Thn. 94. Warna biru, BK Nego Abis. Hub. 061-9135 6484 murahnya, kwalitas no. 1 import Jepang, Medan asli. Mobil masih original. Bangku Serius Hub. (061) 76728071 / 0812 653 3319 0815 3476 7327 merk terkenal. Toshiba, Fujitsu, Acer, Nec, Harga Mulai Bursa Bursa 2 sudah ke depan. Mobil siap pakai. Jl. Gaperta HP. Dijamin & Bergaransi Service & Rp. Gg. Pemb. No. 52B. Telp. 77652 697 MITSUBISHI Lancer SL ‘82 Dijual. Hijau TOYOTA Super Kijang G Biru Dijual. Th. 1993, BUTUH DANA CEPAT !!! DAN CEPA ANA Sparepart. Segera miliki & Kunjungi ELEKTRONIK PERCETAKAN met BK Pjg. AC/TP/VR. Mesin & Body mulus, Km. 236.175 Jarang pakai. Tangan kedua, Pameran kami. Mencoba, Cari Info & Test Khusus Untuk Nasabah DAIHATSU BARU PAKET AKHIR TAHUN Xenia.........................DP Mulai 16 Jt-an original. Hrg. Rp. 16,5Jt (bs tt spd mtr). Hub. 0813 7695 8645 - 061. 68741303 Power Steering, Central Lock, Cat asli. Hub. 0813 709 336 49 - 061.736 0289 Macat Dari Bank sampai puas oke2 saja. Support by: - ALTECOM Medan Mall Lt. Dsr - 0812 6455 7274 Jt-an JUAL-BELI PS 1, 2, 3 TV, Keyboard, Mixer, Power, Laptop, LCD Projector, Handycam, Camera, Kulkas, M. Cuci, Tape compo, LCD, dll Hub. MARKET Terios........................DP Mulai 19 Jt-an Proses Cepat & Gampang - ALSI COM Medan Plaza Lt. Dsr - 0852 6109 4014 ELECTRONIC Telp. 821.0097 - 6690.0693 Gran Max Minibus...DP Mulai 12 Jt-an MERCY Boxer E 200 Thn. 87/88 Mdl TOYOTA Twincam 1.6 Dijual. Pinjaman Max 1/2 Miliar - LC COM Millenium Lt. Dsr - 0813 7071 1319 Jl. Setia Budi No. 424 B dekat Simp. Ring Road Luxio..........................DP Mulai 6 Jt-an MP. El Sunroof, Silver. BK Mdn Ex Warna hitam, Thn. ‘90. VR 17”. Hub.: Susan - LAS COM - HOT COM Aksara Lt. Dsr Paladium Lt. Dsr - 0812 6892 3700 - 0813 7666 9353 Hub. PT. Capella Medan, Josua AC, KULKAS, M. CUCI, P. CLINER, GENSET (061) 77004944 / 0812 6311 0820 Mutasi Rp. 36Jt. Hub. 7786 3981 AC, Tape, BK Medan. Harga 081-397-065-678 - SIM COM Binjai Super Mall - 0813 6125 4113 WASPADA AC, 1 Pk, 1,5 Pk, 2 Pk=1,3Jt s/d =1,9Jt. AC Air Nego. Hub. 061-77558008 # DAIHATSU PAKET IDUL ADHA # NISSAN PROMO AKHIR TAHUN Cash Back Habis + Hadiah menarik - 0812 6571 856 xpress Cooler= 975rb. Kulkas 1 Pt=450rb s/d =900rb, 2pt=650rb s/d=1,3Jt, K. Mini = 500rb. K. 2 Pt. Jumbo= 2 jt. M. Cuci, 2tb=600rb, 1tb=900rb s/ LUXIO DP Hanya 5 Jt, Angs 4 Jt-an lainnya + bunga rendah. Info selanjutnya d =1,4jt. P. Cliner = 1,2Jt, Genset, 9000w, 7500W, Hub. 7702 6289 / 0819 7308 2002 BURUAN STOCK TERBATAS THN DP ANGS 1200W=950rb s/d=6000jt. XENIA Li DP 11 Jt, Angs. 3 Jt-an - Kijang LGX Htm, Diesel, BK Mut, Ban Maxxis ‘01 35 Jt 3,6 Jt Bursa TV, PS, DVD, HANDICAM, CAMERA, - Kijang LSX EFI, Biru ‘01 25 Jt 3,2 Jt TERIOS TS - Extra DP 20 Jt-an Angs. 4 Jt-an SUZUKI ESCUDO THN. 1995 - Cherokee 4x4 M/T Biru, BR 31, Velg asli ‘95 20 Jt 2,2 Jt PROYEJTOR, LAPTOP, FAX, KEYBOARD KOMUNIKASI Proses Cpt & Mudah, Hub. Taufik Warna: Biru met/BK Medan asli, lengkap/ - Zebra Espas 1.6 Maroon Met, VS, BR ‘96 14 Jt 1 Jt - Zebra Master Pick Up, Bak 3 Way Hitam ‘04 55 Jt Nego TV, LCD 32” Samsung= 7,5Jt, 53” LCD Proyejtion Sony=7 0811 651 993 - 061 77491993 Jt 34” Sony= 2,5Jt - 32” M. Bishi =2Jt, 20” Baru/ Mulus. Harga 79Jt Nego. HP. 0812 6360 533 - Isuzu Panther Touring, Hitam, Mulus ‘01 125 Jt Nego Bekas=900rb s/d =2,3Jt, 14/21”=300rb s/d 975rb. “DAIHATSU PAKET MURAH” SUZUKI Carry PU HT 2006: 2 Unit Suzuki Carry PU HT 2005: 2 Unit - Isuzu Panther Pick Up 2.4 - Mercy E230, New eyes, Hitam ‘04 75 Jt Nego - Land Cruiser VX Turbo Diesel, 4x4, Mulus ‘96 60 Jt 8 Jt ‘96 47 Jt 3,4 CATUR RELOAD CATUR RELO DVD=260rb, TVDVD Vortable=1,2Jt, PS 1=400rb, PS2=1 Jt, Handicam/Camera=500rb s/d 2,3Jt. Proyejtion Gran Max Pick Up DP 7 Jt’an Angs. 2 Jt-an Suzuki Carry Putih 2004 Hub. SM. Raja 368 Simp. Limun 0812.6336.6155 / 0813.7588.7306 1 Chips All Operator MINI & EFEKTIF Gran Max Minibus DP 16 Jt-an Angs 3 Jt-an Suzuki Carry Minibus 2004 Luxio D M/T DP 7 Jt’an Angs. 4 Jt-an Hub. 7880294 - 786 7522 KEMBAR MOBIL Murah & Lengkap. Xenia 1.0 DLX DP 10Jt An. Angs. 3 Jt-an Transaksi 24 Jam. Ingin Promosikan Terios TX TS X’Tra M/T DP 23 Jt’An Angs 4 Jt’an SUZUKI Escudo 2.0 Thn. 2004. JL. Tritura No. 8-K- 0812 6058 6666 Produk Anda IKLANKAN PRODUK ANDA Sirion D M/T DP 20 J’an Angs. 4 Jt’an Hub. WINDI HP. 0812 6078 052 Coklat met original, Plat BH Jambi - 2 Unit Colt Diesel 4 Roda Free Registrasi Flexi 061 (77402067) Rp. 122Jt. Hub. 0816 3113 953 Th. ‘01/’07, Cantik, Originil, Sehat, Siap Pakai. Min. Deposit 100 RB Harian “DAIHATSU PAKET NOVEMBER MURAH” SUZUKI Vitara Wrn. Hitam Met Dicari Master / RS Xenia DP 20Jt-an atau Angs. 3 Jt-an Sudah lengkap. Terios DP 27Jt-an atau Angs. 4 Jt-an sudah lengkap. Thn. 92. BK Medan asli. Lengkap Sound, TV, CD, Mobil - 2 Unit Fuso PS. 190, 6 Roda Th. ‘00/’01 Hub. (061) 7877531 WASPADA Pick Up DP 7 Jt-an atau Ang. 2 Jt-an + Hadiah Info mulus. Siap pakai. Hub. 061- Coklat, Originil, Sehat, BK Medan, Johor Katelia Indah Media yang Tepat Hub. Astra Daihatsu 0813 6177 3589 / 77943677 7648 5254 - 0813 7528 6050 1 tangan. No. 194 Medan untuk Iklan Anda DP lai mu 5,6 Jt-an* KHUSUS BULAN INI SAJA
  • 21. WASPADA 24 Jumat 13 November 2009 PENDIDIKAN Bursa KOMPLEK PERUM. TERJUN INDAH MARELAN Ingin Personel TLC Berjuang LOKASI JL. A. SANI MUTHALIB NO. 1 PSR. IV KURSUS KOMPUTER CEPAT KELURAHAN TERJUN MARELAN Promosikan Lawan Flu Babi LPK PAULINE - - Aplikasi Window XP/ Internet................ 200 Rb (2 minggu) Komputer Aplikasi Perkantoran Lengkap350 Rb (1 bulan) Produk - - Autocad 2D/ 3D/ 3D Max......................... 300 Rb (10 hari) SAP/ EBTAB (Tehnik Sipil)....................... 400 Rb (10 hari) Anda Maraknya penyebaran virus H1N1 atau biasa - Merakit Komputer/ Lengkap................... 400 Rb (6 hari) - Autocad 2D + 3D + 3D Max/ SAP............. 1,2 Jt (4 bulan) disebut flu babi belum ber- - Desain Grafis Komplit............................. 500 Rb (1 bulan) - Bhs. Inggris............................................ 400 Rb (Paket) henti. Personel TLC, Tionne Daftar langsung belajar, Waktu Bebas, Tanpa batas usia Jl. Sei Batang Hari Ujung 170 Medan Wa t k i n s k i n i t e n g a h Telp. 844.2158 - 844.2159 Website: berjuang melawan virus EXECUTIVE PRIVATE LES MASIH TERSEDIA & SIAP HUNI TYPE 36......... 3 UNIT - SHM - AIR PAM Media tersebut. Penyanyi punya nama SD Membimbing Siswa, SD, SMP, SMA : Semua mata pelajaran TYPE 45......... 2 UNIT TYPE 90......... 1 UNIT - PLN 900 WATT - MUSHOLLA yang Tepat pendek T-Boz itu awalnya SMP, SMA : Matematika, Fisika, Kimia, English Dibimbing oleh Tentor berkompeten dan berpengalaman, Serta mengutamakan KESEMPATAN DAPAT CICILAN DP: 48 BULAN TERBATAS SAMPAI AKHIR NOVEMBER 2009 untuk mengaku mengalami gang-guan tenggorokan. kwalitas, Bersedia datang ke rumah Harga murah dan Bersahabat HUBUNGI: Iklan Anda B u k a n h a n y a T- B o z , Hubungi: 0813.9628.4867 HP. 0813.6119.8067 - 0813.7094.8836 - 0813.7597.6445 putrinya, Cha-se Anela INGIN LULUS TEST CPNS 2009? Rolison pun demi-kian. RUMAH DIJUAL 2½ TINGKAT RUMAH DIJUAL CEPAT (B.U) RUMAH Dijual di Tanjung Anom, LT. ± 525, Bursa Masih buka group baru: Uk. 8x15 (SHM) di Jl. Mawar 12 Dekat Brayan CENTER (SHM) P. 51, LB. ±121, Peminat hub. 0813.7639.3546 Bursa Pelantun hits ‘Scrub’ itu - Super Intensive CPNS, membahas soal CPNS, dan tips dan trik menjawal soal dengan cepat, tepat No. 75, Perumnas Helvetia, Hrg Rp. 185 PERABOT PERKEBUNAN akhirnya mengajak Chase L. 12 Jl. Bambu No. 50, Bisa untuk - 0852.9774.3596 dan akurat. Materi lengkap (TPU, TBS, TSK) Lama: Jt/damai Hub. 0812.637.0981 - berusia 9 tahun ke dokter seminggu, jam 15.00 atau 18.00, BIaya: Rp. 250 Rb. 12X Start: Senin, 16 Nov ‘09 0812.6436.4801 buat Rumah Kontrakkan RUMAH DIJUAL TEMPAHAN MURAH -Lemari pakaian 3 pintu Sungkai asli Rp. 1.500.000 tempahan DIJUAL spesialis telinga, hidung - Try Out: Minggu, 15 Nov ‘09, Jam: 15.00-17.35 Pekarangannya luas Dijual kayu durian 40 Ton, Barang - A d a S o a l / M o d u l C P N S , berisi teori dan soal- RUMAH DIJUAL Hub. 0852.9700.1251 Jl. Rantang No. 17 (Ayahanda), Luas -Kursi Sofa Kulit 3 ,2 1 pakai Spring Rp. 1.300.000 dan tenggorokan. Setelah diperiksa Chase disebut menderita flu Hub Telp. (061) 6618116 - 6616802 soal Prediksi, Pengetahuan Umum + Skolastik Luas Tanah ± 287m², Bangunan ± Tanah 397m², SHM, Harga 1 M (nego) sampai di tempat pakai SKAU sementara T-Boz positif flu babi. NB. - Tutor Kwalitas S1/ S2, berpengalaman/ PNS 8x15m, Fasilitas: Listrik, Lt. Keramik, 900 Hub. (061) 456.4575 HP. 0816.310.4703 - Kantor buka jam 14.00 W, 3 KT, 3 KM, Air Sumur jernih (Elec- RUMAH DIJUAL (061) 9117.5154 SPRING BED DIJUAL MURAH Hub. 0852.9777.9615 “Saya membuat perjanjian agar putri saya tinggal bersama Hubungi: Gratia. Jamin Ginting 303, Pasar Sore ibu saya. Saya harus diam di rumah dan menjauhi semua orang,” P. Bulan (061) 7769.5393/ 0812.6086.9938 tric pump), Lokasi Jl. Eka Warni Kel. Gdg. Jl. Laksana No. 70, 1½ Tkt, Spring Bed 6 kaki 2 lapis Rp. 1.100.000 Johor, dekat dgn Masjid, Sekolah TK, LT. 605m², 5 KT, 4 KM, SHM, Spring Bed 5 kaki 2 lapis Rp. 1.075.000 DIJUAL BIBIT SAWIT DXP ujar T-Boz dikutip dari Contactmusic, Kamis (12/11). Khusus Muslim Hub. (061) 7680.8066/ TANAH Spring Bed 4 kaki 2 lapis Rp. 1.000.000 Dan Dumpj Sertificate Umur 9 bulan, Masih cerita T-Boz, empat hari kemudian kondisi tubuhnya Bursa 0813.5110.1266, Harga nego Garasi luas (Bs 4 mobil) Hub. TA N A H D i j u a l d i J l . B a l a m S e i Spring Bed 3 kaki 2 lapis Spring Bed 3 kaki Dorong Rp. 900.000 Rp. 1.000.000 Sebayak 20.000 pokok (TP) bertambah parah. Setelah diperiksa dokternya, ia langsung dilarikan LOWONGAN KERJA DIJUAL CEPAT 0812.830.2630 - 0819.843.894 Sikambing B. Medan, Luas ± 1.424m, Garansi Per 10 tahun Hub. 061-661.8116 - 661.6802 Hubungi. Ir. Unggul HP. 0813.9650.5059 ke rumah sakit. Ia mengaku kesulitan bernafas, namun detak Peminat silahkan hubungi Amri HP. DIBUTUHKAN WANITA (GADIS/ JANDA) Ruko Gandeng di Simpang Unimed 0811.647.434, Maaf Tanpa perantara Flexi (061) 7715.5364 jantungnya sangatlah kuat. Jaga anak, Perawat Gaji Rp. 500 - 1 Jt/ Jl. Willem Iskandar Medan, Harga RUMAH VILLA BATU ASRI Alamat Jl. Sudirman No. 25 Stabat bln (bersih) Hub. “CAHAYA” (061) Hrg Rp. 170 Jt, SHM, Blok B No. 8, LT. “Ini sudah berlangsung sekitar 9-12 hari. Saya memakan semua dibawah nilai Appraisal Bank, Cocok TANAH Kaplingan, SHM, 11,5x26,5m 7670.0079 HP. 0812.6514.3676 6x17m², 3 KT, 2 KM, 1 RT, 1 Mkn, Dpr, obat dan jamu juga suplemen untuk membantu cepat sembuh,” DICARI TUKANG PANGKAS untuk segala jenis usaha, Siapa cepat T. Jmr, Carport, 2 Mobil, Lt. Granit, Listrik, Jl. Bajak II H Gg. Villa, Lebar jalan 7M, Serius hub. 7750.7040 (061) Bursa jelasnya. dia dapat Hub. 0813.7562.6777 PAM (dibantu KPR, Tanpa uang muka PELUANG BISNIS Berpengalaman, Jaminan tinggi Hubungi lsgn KPR) Serius hub. Bpk. Adi (061) Bukan hanya T-Boz terserang virus flu babi. Sebelumnya segera: 0812.6484.8409 - 0813.9797.1377 Jl. Gajah Mada Simpang Sei Wampu DIJUAL RUMAH CEPAT 7648.1585- 0812.6588.6977 DIJUAL personel Backstreet Boys, Brian Littrell dan bintang ‘Harry Potter’ DICARI Jl. Bunga Asoka /Jl. Bunga Baldu I No. 10 Blok XIII (Lurusan Puskesmas) HUNIAN AL-BAROKAH Kebun sawit 10 Ha, Umur 8 tahun, DEPOT AIR MINUM Rupert Grint pun mengalami peristiwa serupa.(dth) Pasangan suami/ istri untuk Asam Kumbang Medan. Jarak dari PKS 8 Km, SK Camat Kalau mau pasang mengelola rumah kost di Medan, LT. 10x15 = 150M. LB. 7,5 x 12 = 90 M (MUSLIM/ PANCING) Hub. 0852.9777.9615 murah dan bagus Fas. PAM, PLN dan Telp. Status Tanah Belanja Barangnya Aja syarat: Rajin & bersedia tinggal di Sertifikat. SHM Hub. Telp. 8216362 Jl. Mekah No. 16, LT. 5x20m², Segala perlengkapan Bursa PIJAT LULUR tempat Hub. (061) 7785.0030 HP. 0813 6155 6695 - 0813 6141 8018 LB. 80m², 3 KT, 2 KM, Granit, Air TANAH KAVLING DIJUAL Depot isi ulang R.O dan PENGOBATAN PAM, PLN, Hrg 210 Jt, SK Cmt Uk. 10x30m², 15x30m², 11x22m²: Hexagonal DAN REFLEKSI ADA JOB BID. PENDDK PLAYGROUP/ TK Hub. (061) 822.3818 - 7690.3888 Jl. Bunga Terompet II A, Ringroad Min. SLTA, Cpt krj, Usia max. 35 thn RUMAH 2½ LANTAI DIJUAL Ngumban Surbakti - Psr. V Koserna “PANDAN PUTIH” “PAND ANDAN BUTUH ALAT BANTU DENGAR? ALAT BANTU Hub. MELTRA HEARING AID MELTRA SAVIRA RUMAH DISEWAKAN Hub HP. 0852.6269.9002 - 0812.8891.0847 Hub. 081361 309280/ 77642 832 Hub. Jl. KH. Wahid Hasyim 92 Medan Ikut dengan perabotan, 3 Kmr Jl. Kediri No. 36 Medan Tel. 4516161 Tp. 4533.875 - 456.9269 Jl. Karya Wisata Tidur dan 3 Kmr Mandi, SHM, Jl. Iskandar Muda No. 2 Lhokseumawe, Fas. 7 KT, 4 KM, TANAH DIJUAL PENGOBATAN ALAT VITAL PLN, Jl. Eka Rasmi (Komp. Harga Model PIJAT & URUT RAHMAT JL. MANDALA BY PASS SAMPING BRI No. 23 A Johor Tp. 786.1690 Medan Halaman sgt luas, Lokasi strategis, LT. 984m², SK Camat Jl. Pinus Johor Town House), Blok C 12 Untuk kantor, mess, Tmpt tinggal Ter Murah Terbaru HP. 0813.8201.4747 HUB. 0812.6047.6830 Sudut, Jl. Perwakilan Kel. TERIMA PANGGILAN DICARI GURU Hub. 0813.6014.0084 ALAMAT: Untuk Pondok Pesantren, beberapa orang Hubungi : Ibu Catharine Ust/ Ustzh, Diutamakan yang bisa 0813.7524.8000 - 0812.6064.5000 Pulo Brayan, Bengkel Baru, JL. SETIA BUDI TANJUNG SARI MDN berbahasa Arab dan Inggris S1/ D3, bagi RUKO 350 JUTA DAN TYPE 45 Kec. Medan Timur, Medan KRISNA WATER yg berminat antar surat lamaran ke: DP 20% di Griya Ladang Bursa PELUANG BISNIS Jl. Karya Bakti No. 103 Medan Johor DIBINJAI Harga nego MATERI BANGUNAN FD Dari jam-08.00 s/d 12.00 Wib atau Hub Bambu, Jl. Jamin Ginting 1. Pemasangan Depot Air Minum HP. Ustzh Aisya, SE 0813.6267.7766 Hub. (061) 7787.6570 Dengan Sistem Filtrasi & Ro Dijual Rumah dan Tanah di Km. 14 Medan Rp. 22 Jt s/d 38Jt CD DICARI OPERATOR KOMPUTER Jl. P. Diponegoro No. 47 Hub. 821.3007/ 0812.6356.735 TANAH MURAH 2. Air Pegunungan 6700 s/d 7000 Liter KIRIMKAN... Wanita blm berkeluarga, biasa Binjai, Luas Tanah 15x218m: Rp. 230.000 / Tangki RUMAH DIJUAL KHUSUS MUSLIM mengoperasikan komputer, Bisa kerja full time & Shift, Jujur & Pekerja 3270m², Pinggir jalan besar, Dijual cepat Rumah Permanen Uk. Tnh 15,5x20m (SHM), Uk. Rmh 10,5x11m, 10X26M Menyediakan Mesin RO dan Yamaha Hubungi: DATA IKLAN ANDA keras, Berdomisili di Medan Lamaran antar langsung: Jl. Rumah Potong Hewan Ada kebun rambutan Harga Rp. 350.000/m Kmr Tdr 4, Kmr Mandi 2, Air PAM, Listrik, Garasi mbl besar Jl. Menteng VII Gg. Patriot No. 7 Mdn RP. 10.500.000 CV. HYDRO UTAMA Jl. Kapt. Muslim No. 53-d Medan DALAM BENTUK Komp. Ikes No. 127 Mabar Medan Jam: 14.00 s/d 16.00 Wib Paling lambat 16 November 2009 Hub. 0878.6868.8884 0812.6555.5596 Hub. Sumarman HP. 0812.6085.4025 Pemilik langsung, Hrg damai DISEWAKAN LOKASI DESA SEI MENCIRIM KEC. SUNGGAL, TANAH TINGGI, RATA, BEBAS BANJIR, Telp. (061) 8457879 / (061) 77839790 HP. 0812 600 5410 DIGITAL Keterangan lebih lengkap IKLAN LOWONGAN KERJA Dibutuhkan tenaga kerja/ karyawan bergerak dibidang perbengkelan bersedia SAKSIKAN PAMERAN KAMI 1 Unit Rumah Koppel GRATIS BIBIT RAMBUTAN, silahkan hubungi: DI ATRIUM PLAZA MEDAN FAIR TERCECER TELPON : 061 - 4576602 ditempatkan di Psr. Merah, Pdk Kelapa, Setia (2 Kmr Tidur, R. Tamu, Budi, posisi sebagai: 1. Kasir (Wanita), SMP/ SMA sederajat DARI TGL. 09 S/D 15 NOVEMBER ‘09 MAHONI, JAMBU 2. Doorsmeer (Cuci mobil) TAMAN GRAND PERMATA HIJAU R. Makan Dapur) TERCECER 3. Kp. Mekanik (Berpengalaman) 4. Cat mobil (Body Car) TAMAN PERMATA HIJAU Jl. Penampungan I No. 35 B HANYA 30 KAPLING 1 (Satu) Buah BPKB Spd. Motor asli, BK 2630 GF. FAX : 061 - 4561347 Jl. Ileng Marelan An. Tan King Sun Alias Sunar. Alamat. Jl. PB II 5. Tk. Bubut (Jl. Kapt. Muslim belakang Lamaran diantar ke: Type: 36, 45, 55, 65 Fasilitas: PLN, PDAM, Sertifikat, IMB, Taman HUB. H. SALIMIK Gg. Lapangan II No. 9 Medan Sunggal. * Format: JPG - TIFF (Photoshop) BENGKEL STAR SERVICE Asrama Zipur) Jl. Setia Budi Psr. V No. 435/ 88-S Kolam Rekreasi, Mesjid, Lap. Tennis HP. 0813.7042.2100 0812.601.8160 - 7693.7740 TERCECER TAMAN JOHOR MAS 1 (Satu) Bh BPKB Mobil BK 9483 CB. An. HP. 0813.6125.3678 Bpk. Ronald Simanjuntak, SE, MBA Jl. Sidodadi - Eka Surya - Johor JL. BINJAI KM. 15,4 NO. 7 AB DISKI Fauzi Akmal. Mits. L300. No. Rangka: DIBUTUHKAN SEGERA Kami dari perusahaan Entertainment Type: 55/ 112, 65/ 120 Dekat Sekolah Yayasan Taman Harapan III RUMAH DIJUAL Bursa MHMLOPU 397K005485 No. Mesin: 4056C-C98166. Hub. 0812 6017 765 Ingin membutuhkan tenaga kerja di bidang: 1. ASISTEN MANAGER DISCOUNT S/D 20 JUTA Jl. Sembada VI No. 17 Kel. Padang BUSANA / AKSESORIS TERCECER/HILANG Promosikan 2. RECEPTIONIST Bulan Selayang II, Kec. Medan Produk SELAMA PAMERAN Sekitar Jl. Garuda Raya P. Mandala. Sebuah 3. PR Sertifikat HGB No. 2145 An. Legiman. Alamat Jl. 4. WAITRESS Tuntungan, Medan, LT. 300m², LB. PECI MAHKOTA Murai V No. 375 P. Mandala Medan. Bagi yang Anda Dengan syarat-syarat sebagai berikut: menemukan tolong antarkan ke alamat tsb diatas. - Wanita max. 28 thn, untuk point 1 - Wanita max. 25 thn, untuk point 2, 3, 4 213m², Lantai 2, SHM, Fas. Listrik MENJUAL PECI TEMPAHAN - Min. tamatan SMU/ sederajat (tidak sedang kuliah) - Berpenampilan menarik, ramah tamah & loyalitas 1300 Watt, Air PDAM, Telephon Berbagai Model Dan Warna TERCECER terhadap perusahaan - Mempunyai jiwa kepemimpinan, untuk point 1 Jl. Prof. H.M. Yamin SH. No. 340 / Jl. Serdang 1 (Satu) Buah BPKB Asli STNK BK 649962 - Mempunyai tantangan untuk meningkatkan Harga nego Hub. (061) 7787.6570 Depan Gg. Sadu Medan a/n. Fitriani. Sekitar G. Subroto. penjualan untuk point 3, 4 - Bersedia kerja shift SURYAMAS PROPERTY GROUP Kirimkan CV dan beserta pas photo terakhir 3x4: 2 lembar, diantar langsung ke alamat Jl. Kapten Muslim No. 101 Hotline: RUMAH DIJUAL Bursa TERCECER Media 1 BPKB Mobil Suzuki Katana Thn. 90 BK Gedung Millenium Plaza Lt. V de Brand Karaoke, WIWIT: 0813.7606.2830 - (061) 7795.0955 JASA 1578 AY a/n. Sabar M. Siregar. Sekitar tuliskan posisi yang diinginkan di sudut kiri amplop. Setiap lamaran yang masuk langsung di Interview IRFAN: 0813.6100.7012 - (061) 7791.2296 LT. 236m², LB. 98m², SHM, Listrik L. Pakam - Penara. Hub. 0816 310 4197 900 Watt, PDAM, Telephon, Lok. CV. AMDAL ABADI HILANG yang Tepat LOWONGAN KERJA SEGERA DIBANGUN PENGEMBANGAN PERUMAHAN PErm. Villa Belibis, Blok C Berpengalaman, menger- jakan AMDAL, UKL-UPL, DPPL, Buku BPKB Mobil BK 696 LP. Kijang untuk Dibutuhkan segera staf pengajar: No. 8 & No. 9, Harga nego Thn. 1983. Dan BPKB Honda BK MA-FI-KI-BIO-ING-IND-GEO- TAMAN HARAPAN INDAH Dapat di KPR kan IZIN LA, IPAL, DLL Telp. (061) 844.8182 5077 PX thn. 2001. Atas nama Dpt Diperoleh di Sumatera - Aceh Iklan Anda JL. PASAR II SETIABUDI TANJUNG SARI HP. 0812.657.5588 Poniman Jl. Besitang Gg. Damai. SEJ-EKO-SOS Hub. (061) 7787.6570 No. 69 P. Brandan Hub: (061) 7365429 - 7362887 Dengan syarat sebagai berikut: 1. Bersedia mengikuti tes tertulis dan Bursa TERCECER presentase mengajar KECANTIKAN Hak Guna Bangunan No. 2. Sarjana PTN 305 Kelurahan Mesjid, SIAPA YANG ANDA KENAL?!!! Kecamatan Medan Kota 3. Bersedia ditempatkan Se P. Jawa, An. Hendra Cipta. Tercecer Se P. Sumatera, Se P. Kalimantan Serius mau turun/ naik berat 3 - 50 Kg? !!! di Jl. Medan T. Tinggi. atau Se Indonesia BONUS: PAGAR, TERALIS JENDELA Aman, alami, tanpa efek samping !!! KAMI BUKA KEMBALI DENGAN JUMLAH TERBATAS, FAKTA BERBICARA !! TERCECER 4. Honor yang akan diberikan mulai 1 (Satu) Buah Surat Ganti Kerugian KAWASAN STRATEGIS DEKAT RINGROAD dari Rp. 1,5 Jt s/d Rp. 2,5 Jt HUB: GARANSI UANG KEMBALI a/n. Abu Razak Thaib. No. 006 / 3/ LINA 061-77552137 KALAU TIDAK 1979. Dan Surat keterangan Tanah Kirimkan surat lamaran lengkap KANTOR 061-8221447 ADA HASIL No. 100815 a/n. Abd. Khalid Lbs. beserta foto terbaru ke: JESSY 061-77117439 Dgn alamat di Sei Rampah. Jl. Jend. Sudirman No. 63 BC FAKHRUL 061-30086484 TAUFIK 081370533912 KEHILANGAN Binjai 1 BPKB Spd. Motor No. BK 3635 HL Paling lambat tanggal 21 Nov 2009 a/n. Syahpria Felani. Alamat Jl. Seksama No. 144 B Medan Denai. Jangan Lewatkan Interaktif langsung Cantumkan no. Telp/ HP yang bisa dihubungi Jangan biarkan lingkar perut Anda dengan PASAK BUMI di DELI TV Setiap lebih dari 10cm hati2 resiko ke TERCECER JL. KLAMBIR V NO. 152 Sabtu Malam Pkl. 22.30 Wib (Live) 1 (Satu) Buah BPKB Asli No. A2242840-G. STNK DIBUTUHKAN 061-6846 2888 jantung Untuk Konsultasi & Tes Kadar Lemak BK 546 LZ a/n. Hj. Masniari Siregar. Alamat Jl. HM. Yamin Gg. Klambir No. 93 Medan. KP. LALANG MEDAN Call Center: 0818 090 73481 Sebuah Perusahaan Multinasional yang 061- 6846 3888 GRATIS !!! Hub segera: sedang berkembang, membutuhkan TERCECER KOMPLEK Ennie : 0817.9832.708 - (061) 7787.8143 1 (Satu) Buah BPKB Asli STNK BK 5678A. tenaga terampil & kreatif untuk posisi: JS : 0819.3346.6100 Marelan Mas Pengobatan Alat Vital H. Suhendar A/n. Junan. Alamat B. Katamso No. MARKETING PROMOTION Kelurahan Terjun, Pasar I Marelan ( 230 B. Kel. Sei Mati Medan. Type 36, 45, 54, 70 & Ruko Dengan persyaratan sebagai berikut: TELAH TERCECER Peluang Investasi Peluang Investasi - Pendidikan minimum SMU lebih Masa Depan Masa Depan Tanpa Bursa 1 Berkas Asli Surat Pembagian Pusaka Tanah yang diketahui oleh Lurah Rengas Pulau Wilayah Pemko Medan Wilayah Pemko Medan DP Coy... TRAVEL / WISATA Marelan atas nama HM. Yahya tertanggal disukai S1 - Perempuan/ Laki-laki 19 Mei 2004. Luas tanah +/- 2145 Mtr. Yang Besar dan panjang di tempat Klinik H. Suhendar di bawah READY STOCK terletak di Jl. Eling Lingk. 01 Kel. Rgs. Pulau Marelan. Tercecer pada tgl. 14 -06-2008. Tidak ada hasil, Mahar kembali kontrol dan pengawasan langsung - Rajin, kreatif, ulet, jujur & bertanggung disekitar Jl. KL. Yos Sudarso sampai Jl. Marelan Ditangani secara profesional H. SUHENDAR jawab Raya sampai saat ini belum ditemukan. - Dapat berkomunikasi dengan baik Bulan Alami bukan suntik, menggunakan Promosi HILANG metode terapi dan ramuan tradisional, Diberitahukan kepada masyarakat - Memiliki kendaraan dan SIM C Cukup Bayar untuk berhati-hati terhadap pengobatan (khusus Medan) Booking Fee Rp. 5 Juta Asli Surat Tanah SK. Lurah Paling aman tidak ada efek samping - Diutamakan yang berpengalaman Sudah Punya Rumah Sudah Punya Rumah a/n. Alm. H. Nurzafa Khatib. H. Suhendar sudah di kenal sebagai pakar sejenis yang mengaku-ngaku kerabat (KPR BTN, BNI 46, DLL)* (KPR BTN, BNI 46, DLL)* - Penempatan untuk Medan, Kunjungi Pameran Kami Ukuran: 3,30/10/6,60/ kejantanan yang sudah berpengalaman, atau saudara, soal cara boleh sama Pekan Baru, Bengkulu dan Bangka Medan Plaza Lt. I 10,70M x 7/12,10/14,80 M. sanggup mengatasi keluhan alat vital khusus tapi keahlian yang membedakan Belitung, Aceh Tanggal 12 s/d 15 Nov 2009 Yang terletak dibelakang pria, memperbesar, memperpanjang *Syarat dan KEtentuan Berlaku Rumah Jl. M. Taufik No. (garansi), meningkatkan Untuk keluhan dan pengaduan silahkan Surat lamaran lengkap beserta pas foto Office: (061) 453.6567 - 451.5956 kekerasan, tambah Mahar hubungi langsung: Contact Person: 61 Lk. VI. Kel. T. Rejo. Rp. 500 ribu terbaru ukuran 3x4: 1 lembar dikirim 0813.9690.0054 - 0813.6108.0700 kuat dan tahan lama H. SUHENDAR HP. 0812.131.6364 0813.9605.0096 - 0813.7637.0123 M. Perjuangan. dalam berhubungan ke: Harian WASPADA Dengan Kode Jl. Tempuling No. 43 B - Serdang MINI & EFEKTIF “9000”, selambat-lambatnya 1 minggu (masuk Gg. Sado) Medan sejak iklan ini diterbitkan Telp. (061) 663.4220 Saksikan !!! Bursa IKLANKAN Interaktif bersama Bpk. H. SUHENDAR di TVRI Nasional Medan. Setiap Sabtu PROPERTY PRODUK ANDA Malam Minggu Pukul 20.00 WIB Informasi Pembaca PENGOBATAN BALAI PENGOBATAN TRADISIONAL Bursa Property ALAT VITAL ALAT VITAL GR : Garasi KM : Kamar Mandi LB : Luas Bangunan LT : Luas Tanah MAK EROT DITANGANI OLEH AHLINYA: M. SUHERDI KP : Kamar Pembantu RM : Ruang Makan DITANGANI DARI PELABUHAN RATU SUKABUMI JABAR KT : Kamar Tidur SHM: Sertifikat Hak Milik RT : Ruang Tamu HAJI TEJA SYAIFUL Terapi keperkasaan seksualitas Pria hasil permanen tanpa Bila Anda ingin periksa jangan salah masuk. Disini tempatnya, Carilah yang benar-benar asli. Perwira efek samping, alami, bebas pantangan, untuk semua usia yang sempurnya ya disini tempatnya yang lebih joss. Bergaransi seumur hidup tanpa efek samping. DIJUAL CEPAT Pastikan anda menjadi laki-laki yang luar biasa. Hasil langsung reaksi ditempat, cukup satu kali berobat 1 Unit Rumah Kondisi 90% Selesai. Kalau anda penasaran, ikuti terapi ini berlaku untuk semua Agama, ras, dll, Legenda pengobatan Mak MENANGANI KELUHAN: MENAMBAH UKURAN Jl. Eka Suka Depan Gang Eka Suka Erot sudah tidak diragukan lagi, ribuan pasien sudah tertolong dan sudah disembuhkan di sluruh kota- - Panjang: 13, 14, 15, 16, 17, 18, 19, 20 cm kota di Indonesia, bahkan sampai kemancanagara dari keluhan laki-0laki seperti: Ganguan ereksi, 9 Gedung Johor. Ukuran tanah 15 penyakit kelamin secara medis sudah disembuhkan. - Besar: 3,5. 4,5. 5. 5,5. 6 diameter x 24 M2. Ukuran rumah 12 x 16 M2. - Memperkeras, Tahan lama Terapi Mak Erot ini mengutamakan ramuan. Do’a-do’a, pemijatan dan minyak poles. Tanpa bahan - Ejakulasi dini, Mani encer Kamar 4 buah, Garasi 1 buah, SHM, kimia dan tanpa perbedaan, tanpa efek samping. Jangan biarkan masalah anda berlarut-larut. Bagi - Impotensi, Lemah syahwat wanita yang ingin punya keturunan, mau memperkencang dan memperbesar payudara disinilah tempatnya IMB. Hub.0878.6829.4842 Menangani Keluhan Pria & Wanita - Diabetes, kencing manis/ batu Juga melayani problem asmara, mempercepat jodoh, MINI & EFEKTIF KHUSUS PRIA DIJUAL SEGERA - Ejakulasi dini KHUSUS WANITA - Ingin punya keturunan pengasihan, penglaris, buka aura, pasang susuk, dll Rumah Petak di Jl. Sekip Gg. Penghulu - Impotensi - Memperkencang dan memperbesar payudara ALAMAT KELINIK TETAP: - Memperbesar, panjang - Mengembalikan keperawanan Jl. SM. Raja Masuk ke Jl. Utama No. 18 Medan 4x16m, SHM, Air, Listrik - Keras, Tahan lama - Mengobati keputihan Dari Toko Roti Majestik ±100meter Harga Rp. 175 Jt/nego Hub. 7772.7887, Jam 9.00-17.00 IKLANKAN HP 0812.403.8333 . Terdaftar Dinkes No. 448 Hak Paten No. 00.2004.09965.10041 Izin Kejaksaan: B/DSP.5/12/2008 Izin Dinkes: No. 448/0649/I/2008 Hari kerja, Maaf tanpa perantara PRODUK ANDA Jl. Laksana No. 55J masuk dari Jl. Amaliun YUKI Simpang Raya Medan (Praktek Tetap) HP 0812.6388.7999 . Buka setiap hari