7jan Aceh
Upcoming SlideShare
Loading in...5

Like this? Share it with your network


7jan Aceh






Total Views
Views on SlideShare
Embed Views



0 Embeds 0

No embeds


Upload Details

Uploaded via as Adobe PDF

Usage Rights

© All Rights Reserved

Report content

Flagged as inappropriate Flag as inappropriate
Flag as inappropriate

Select your reason for flagging this presentation as inappropriate.

  • Full Name Full Name Comment goes here.
    Are you sure you want to
    Your message goes here
Post Comment
Edit your comment

7jan Aceh Document Transcript

  • 1. WASPADA Kamis 7 Januari 2010 Nusantara 3 KPK Periksa Dua Pejabat BI Terkait Century JAKARTA (Antara): Komisi Pemberantasan Sebelumnya, pelaksana tugas sementara Korupsi (KPK), Rabu (6/1), memeriksa dua Ketua KPK, Tumpak Hatorangan Pangga-bean pejabat Bank Indonesia (BI), Direktur Penga- mengatakan penyelidik KPK membutuhkan wasan Budi Armanto dan pegawai Direkto- banyak keterangan dari berbagai pihak untuk rat Pengawasan Pahla Santosa, dalam tahap mengusut kasus Bank Century. “Salah satunya penyelidikan kasus Bank Century. “Keduanya kete-rangan yang berkaitan dengan bailout,” dimintai keterangan dalam penyelidikan kasus kata Tumpak. Bank Century,” kata Juru Bicara KPK, Johan Kasus Bank Century bermula 20 November Budi di Jakarta, Rabu. 2008, ketika BI melalui Rapat Dewan Gubernur Sampai pukul 13:30, Johan belum menetapkan Bank Century sebagai bank gagal memberikan konfirmasi apakah kedua orang berdampak sistemik yang kemudian disam- itu memenuhi panggilan KPK atau tidak. Namun paikan kepada Menteri Keuangan selaku Ketua berdasarkan pantauan, sekira pukul 13:00 Komite Stabilitas Sistem Keuangan (KSSK) beberapa orang berkemeja putih mendatangi melalui sebuah surat rahasia. gedung KPK. Sejumlah sumber mengatakan, KSSK lalu mengadakan rapat mulia pukul mereka adalah pegawai BI. 01:00, 21 November 2008 dan dilanjutkan dengan Dalam kasus Bank Century, KPK sudah rapat tertutup pukul 04:00 sampai 06:00. memeriksa sejum-lah pihak, termasuk mantan Berdasarkan audit BPK, rapat tertutup dihadiri Sekretaris Komite Stabilitas Sistem Keuangan Sri Mulyani sebagai Ketua KSSK, Raden Pardede (KSSK) Raden Pardede yang diperiksa dalam selaku Sekretaris KSSK dan Gubernur BI hal dokumen yang diserahkan oleh Menteri Boediono sebagai anggota KSSK. Keuangan Sri Mulyani kepada KPK dalam kasus Rapat kemudian ditindak-lanjuti dengan itu. “Kami ke sini menindaklanjuti dokumen rapat Komite Koordinasi yang dihadiri Ketua yang diserahkan Menkeu kepada KPK pada 30 KSSK, Gubernur BI, dan Dewan Komisioner November lalu,” kata Raden setelah diperiks Lembaga Penjamin Simpanan (LPS). Peserta KPK. rapat sepakat menyatakan Bank Century sebagai Dia menjelaskan, tim penye-lidik KPK bank gagal berdampak sistemik dan me-nyetujui meminta keterangan dalam soal penanganan aliran dana penanganan Bank Century melalui Bank Century, khususnya mengenai peran KSSK. LPS. Dia tidak merinci dokumen yang diserahkan BPK menyimpulkan, BI ti-dak memberikan Antara Menkeu dan hanya menjelas-kan, kedatangan- data mutakhir mengenai kondisi Bank Cen- BUKU GUS DUR: Pedagang buku di pasar buku Cikapundung memerlihatkan sejumlah buku tentang Gus Dur di Bandung, Jawa Barat, Rabu (6/1). Buku- nya ke KPK adalah tahap awal yang akan di- tury sehingga terjadi peningkatan biaya buku tentang Gus Dur kini mulai dicari orang guna memahami sosok almarhum yang tengah diperjuangkan menjadi Pahlawan Nasional. tindaklanjuti dengan permintaan keterangan penanganan Bank Century dari semula Rp632 tahap selanjutnya. miliar menjadi Rp6,7 triliun. Hari Ini KPK Periksa DPR Minta Bupati Taput Tinjau Penempatan Dokter Puskesmas JAKARTA (Waspada): Anggota DPR dari kesalahan cukup besar, dan pemutasian itu Anggodo Widjojo Fraksi Partai Gerakan Indonesia Raya (Gerindra) cendurung dilakukan hanya karena faktor suka daerah pemilihan Sumut, Martin Hutabarat atau tidak suka. meminta Bupati Tapanuli Utara bijaksana dan Menurut Tom, seorang dokter spesialis tentu meninjau kembali penempatan seorang dokter tidak akan dapat berbuat apa-apa bila spesialis kandungan di Puskesmas. ditempatkan di Puskesmas yang tidak memiliki “Kita berharap penempatan dokter spesialis alat-alat lengkap, khususnya alat melakukan Antara ditempatkan pada rumah sakit yang memiliki operasi. Padahal, penempatan dokter spesialis JAKARTA (Antara): Komisi huan dari Anggodo tentang diduga telah menghalangi menjelaskan, orang-orang itu alat lengkap, sehingga sang dokter dapat kandungan di daerah-daerah merupakan Pemberantasan Korupsi (KPK) ketidakhadirannya pada upaya pemberantasan korupsi. adalah pihak berperkara dalam Anggodo Widjojo menerapkan keahliannya,” ujar Martin program pemerintah untuk menekan tingkat akan memeriksa pengusaha panggilan pertama. Oleh karena Perwakilan Tim Pembela kasus dugaan suap proyek menjawab Waspada,Rabu (6/1) di DPR Jakarta, angka kematian Ibu dan anak. Anggodo Widjojo hari ini, itu KPK memutuskan untuk Suara Rakyat Anti Kriminalisasi, Sistem Komunikasi Radio pembicaraan yang diputar di terkait pemutasian Andre Hutabarat, SpOG, Dia meminta DPRD Taput segera bertindak Kamis (7/1) dalam kasus melayangkan panggilan kedua. Sugeng Teguh Santoso menga- Terpadu (SKRT). Mahkamah Konstitusi,” kata dokter ahli kandungan ke Puskesmas di dan memanggil Bupati untuk mempertanyakan dugaan percobaan penyuapan “Saya kira sebagai warga negara takan, Anggodo dilaporkan Tim pembela menjelaskan, Sugeng. Siborong-borong. alasan memutasikan seorang dokter spesialis dan menghalangi penyidikan yang baik, harus kooperatif,” bersama tiga orang lain, yaitu para terlapor telah mempersulit Tim pembela juga meminta yang sedang dilakukan KPK. Menurut anggota Komisi III DPR itu, jika ke Puskesmas. kata Johan. Anggoro Widjojo, Putra Nevo upaya hukum yang dilakukan KPK mengusut nama-nama “Kita sudah kirimkan pang- A. Prayogo, dan David Angka penempatan dokter spesialis di Puskesmas, maka Andre Hutabarat, SpOG dihubungi Waspada Anggodo Widjojo adalah KPK dengan melarikan diri ke penegak hukum yang disebut gilan, akan dimintai kete- Wijaya. jelas merupakan kerugian, sebab seorang dokter melalui telefon, mengaku tidak mengerti dan adik Anggoro Widjojo, orang luar negeri dan berupaya dalam rekaman pembicaraan rangan Kamis besok,” kata “Mereka telah berusaha dan diduga bekerjasama ahli tidak akan dapat berbuat apa apa di tidak mengetahui kesalahannya sehinggaa yang sudah ditetapkan sebagai menyuap serta bekerjasama Juru Bicara KPK Johan Budi tersangka oleh KPK dalam ka- mencegah, merintangi atau sejumlah penegak hukum. “Hal dengan keempat terlapor untuk Puskesmas yang tidak memiliki alat-alat operasi. dimutasi dari RSU Tarutung ke Puskesmas ketika ditanya wartawan di sus dugaan suap proyek Sistem menggagalkan secara langsung itu terungkap dalam rekaman menghalangi tugas KPK. Disamping itu, penempatan yang tidak pas akan Siborong-borong. Jakarta, Rabu (6/1). Komunikasi Radio Terpadu di atau tidak langsung penyidikan, membuat sang dokter keluar dari Taput dan “Kalau saya ditempatkan di puskesmas, tentu Departemen Kehutanan. Nama penuntutan, dan pemeriksaan pindah ke kota, dimana di kota seorang dokter tidak dapat berbuat apa-apa, karena alat-alat Panggilan ini adalah pang- Anggodo mencuat dalam kasus dalam pidana korupsi,” kata Satgas Bertugas Petakan spesialis sangat tinggi nilai jualnya. yang saya butuhkan, khususnya melakukan gilan kedua bagi Anggodo. Se- dugaan suap kepada pimpinan Sugeng. “Jangan sampai dokter spesialis yang operasi tidak dimiliki puskesmas,” kata dia. belumnya dia tidak memenuhi KPK. Menurut Sugeng, perbua- Modus Operandi “Markus” ditempatkan di daerah-daerah akhirnya keluar Padahal sebut Andre, penempatan dirinya panggilan KPK untuk diperiksa Sebelumnya, Tim Pembela tan itu adalah pelanggaran dan kembali ke kota karena penempatannya ke RSU Tarutung pada 2000 untuk menekan JAKARTA (Antara): Satuan Tugas (Satgas) pemberantasan 31 Desember 2009. Suara Rakyat Anti Kriminalisasi hukum, seperti diatur dalam mafia hukum akan memetakan modus operandi mafia hukum yang tidak pas,” ujarnya. angka kematian ibu dan anak. “Jadi kalau di Johan menjelaskan, KPK melaporkan pengusaha Ang- pasal 21 UU Pemberantasan untuk mengungkap praktik makelar kasus (markus), kata Ketua Direktur Eksekutif Komite Pemantau dan puskesmas saya tentu hanya akan dapat tidak menerima pemberita- godo Widjojo ke KPK karena Tindak Pidana Korupsi. Sugeng Satgas, Kuntoro Mangunsubroto di Mabes Polri, Jakarta Selatan, Pemberdayaan Parlemen Indonesia (KP3I), Tom menonton dikala seorang ibu sedang kesusahan Rabu (6/1). Pasaribu menilai tindakan Bupati Taput yang melahirkan, dan tidak dapat bertidak cepat memutasikan dokter ahli kandungan dari rumah melakukan operasi akibat ketidakadaan alat,” Menko Kesra Luncurkan Dia mengungkapkan, pemetaan modus operandi markus merupakan program jangka pendek. “Pelaksanaannya selama tiga bulan.” Satgas juga menyusun program jangka menengah sakit Tarutung ke Puskesmas merupakan katanya.(aya) Program Raskin 2010 dengan evaluasi selama satu tahun yang menitikberatkan pada pelembagaan secara transparan. Salah satu upayanya dengan pemuatan Surat Pemberita- Anggota Pansus: Proses Pemberian BANDUNG (Antara): Men- ko Kesra Agung Laksono mendapat persetujuan DPR dengan alokasi 156 Kg/Rumah kata Agung. Dia menyebutkan, jumlah huan Perkembangan Hasil Penyelidikan (SP2HP) secara re- gular dan pengawasan potensi penarikan pungutan. Sedangkan Ijin Prinsip Merger Tidak Layak meluncurkan Program Raskin Tangga Sasaran (RTS) per tahun subsidi Raskin 2010 sebesar program jangka panjang evaluasi dua tahunan meliputi JAKARTA (Waspada): Anggota Pansus Hak pengendali Bank Century. “Saya tidak 2010 di Gedung Sate, Bandung, atau setara dengan 13 kilogram/ Rp11,4 triliun. Jumlah itu menu- pembenahan sistem regenerasi dan rekrutmen sumber daya Angket Century, Melchias Marcus Mekeng dari mengetahui masalah Chinkara, karena tahun Rabu (6/1) sekaligus menandai bulan per RTS dengan alokasi run dari subsidi 2009 sebesar manusia (SDM), serta pemberlakuan insentif berdasarkan kinerja Partai Golkar menilai proses pemberian ijin 2001 saya belum menjadi anggota Dewan penyaluran pertama beras penyaluran 12 bulan. Menko Rp12,9 triliun. Meski demikian, (renumerasi). prinsip merger tidak layak dan tidak berdasarkan Gubernur BI,” ujarnya dihadapan Pansus Angket bersubsidi pada Januari 2010. Kesra mengusulkan adanya subsidi 2010 ini kemungkinan Khusus pemberlakuan renumerasi, harus menunggu data valid. “Jadi dapat disimpulkan Chinkara Century. Tiga pejabat BI yang memberikan Peluncuran program beras penambahan pagu Raskin naik menjadi Rp13,1 triliun bila persetujuan dari Kementerian Pendayagunaan Aparatur Negara miskin (Raskin) untuk delapan melalui APBN Perubahan 2010 APBNP mendapat persetujuan Capital itu berniat membobol bank tersebut,” keterangan pada rapat Panitia Angket di DPR dan Reformasi Birokrasi. ujar Melchias, saat rapat dengan saksi, Maman juga menyatakan kurang mengetahui proses provinsi yakni Jawa Barat, DKI sehingga Raskin tetap 15 kilo- DPR. Kuntoro menjelaskan, Satgas yang terbentuk 19 November Jakarta, Banten, Lampung, gram per bulan per RTS selama Program Raskin tak hanya Sumantri, Maulana Ibrahim dan Rusli merger tiga bank menjadi Bank Century. 2009 itu memiliki waktu dua tahun melaksanakan pemberantasan Kalimantan Selatan, Kalimantan 12 bulan seperti penyaluran membantu ketahanan pangan Simanjuntak, dipimpin Wakil Ketua Pansus Mantan Deputi Gubernur BI, Maman praktik mafia hukum pada institusi penegak hukum. Barat, Kalimantan Tengah dan 2009. pada tingkat rumah tangga, tapi Satgas memokuskan pencegahan praktik mafia hukum pada Angket Century, Gayus Lumbuun di DPR, Rabu Soemantri mengatakan, pengetahuannya pada Kalimantan Timur. “Perum Bu- Sementara, jumlah pene- juga pada tingkat nasional dua institusi penegak hukum, yakni Polri dan Kejaksaan Agung (6/1). proses merger Bank Danpac, Bank CIC dan log bertugas melakukan penya- rima manfaat Raskin 2010 dengan pembelian gabah yang dengan kerangka besar meliputi reformasi birokrasi melalui Selain itu, pernyataan Maman dianggap Bank Pico menjadi Bank Century sangat minim luran Raskin hingga titik dis- mengalami penurunan dari 19 dihasilkan petani, sehingga bisa perubahan struktural untuk memudahkan perbaikan kultur kerja Melchias sangat aneh. Sebab Maman mengaku karena dirinya tidak bertugas di bidang tribusi, sasarannya keluarga juta RTS pada 2009 menjadi 17.5 memacu produksi beras dalam aparat penegak hukum. tidak mengecek likuiditas ketiga bank itu terkait pengawasan. “Proses merger bank merupakan sangat miskin, miskin dan juta RTS pada periode negeri sehingga swasembada Resiko kapolda rekomendasi Dewan Gubernur. “Ini kontra- tugas bidang pengawasan.” hampir miskin berdasarkan data penyaluran 2010. Dari 17,5 juta beras bisa di pertahankan. Sementara Kapolri Jenderal Pol. Bambang Hendarso Danuri diksi, kenapa bapak memberikan catatan merger Menurut Maman, ketika dia diangkat BPS,” kata Menko Kesra Agung RTS sebanyak 9,8 juta atau 56 Dirut Bulog Soetarto memerintahkan para Kapolda memberantas mafia hukum di tetapi tidak segera mengecek likuditasnya,” menjadi Deputi Gubernur BI Januari 2001, dia Laksono. persen berada di enam provinsi Alimusso menyebutkan, Perum lingkungan kerja. “Kalau peringatan sudah seperti ini masih ada tanyanya. membidangi tugas perijinan dan informasi Pemerintah daerah melak- di Pulau Jawa. siap menyalurkan Raskin 2010 mafia hukum di lingkungan polda, maka risiko ada pada pimpinan Dia heran karena saat Rapat Dewan perbankan. Ketika anggota panitia angket sanakan pengelolaan dan “Setiap bulan ke enam wila- dari gudang-gudang Bulog di itu sendiri,” ujar Bambang. Gubernur (RDG), mereka semua tidak menanyakan perannya dalam memberikan ijin pengawasan penyaluran, yah itu akan mendapat penya- daerah. Dia menyebutkan, Kapolri juga memberlakukan kebijakan untuk memberantas mempertanyakan kualifikasi Chingkara Capital. tiga bank itu menjadi Bank Century, Maman pengangkutan Raskin dari titik luran taskin paling tidak 130 realisasi penyaluran Raskin 2009 mafia hukum, antara lain menggelar perkara terhadap kasus “Ini tidak masuk akal, karena dalam RDG itu mengatakan, keputusan merger itu sudah ada distribusi. Penyaluran ke titik rubu ton. Raskin tak hanya mencapai 97,75 persen. Program yang ditangani dan meningkatkan kinerja pengawas penyidik orangnya pintar-pintar, bahkan doktor semua, sebelum dirinya menjabat yaitu keputusan RDG penerima manfaat dilakukan membantu ketahanan pangan Raskin merupakan tanggung guna melakukan pemeriksaan. dan didukung staf segudang, tetapi tidak tergelitik 17 November 2001 yang menyetujui proses oleh Tim Koordinasi Raskin pada keluarga tapi juga berpe- jawabbersamapemerintahpusat Provinsi dan kabupaten/kota. ngaruh positif terhadap dan daerah dalam rangka pe- siapa Chingkara ini, apakah perusahaan besar merger. “Proses selanjutnya hanya menindak- Program Raskin 2010, telah stabilisasi harga beras di pasar,” nanggulangan kemiskinan. Kurangi Angka Kematian atau perusahaan buatan yang bertujuan lanjuti keputusan RDG itu,” katanya. membobol bank semata,” tanyanya. Dijelaskannya, proses perizinan di BI ada Namun mantan Deputi Gubernur BI, dua bidang yakni di Direktorat Perijinan dan Pendiri PAN: Kongres Batam Ilegal 300 Puskesmas Terima Maulana Ibrahim mengaku tidak tahu-menahu Informasi Perbankan (DPIP) serta di Direktorat soal proses akuisisi Bank Danpac dan Bank Picco Pengawasan. Menurutnya, perijinan yang JAKARTA (Waspada): Salah suara. Disamping itu, adanya berubah, itu baru tuduhan,” ung- Bantuan Rp10 Juta/Bulan oleh Chinkara Capital Ltd (CIC) milik Rafat Ali Rizvi yang kemudian menjadi pemegang saham diberikan pada proses merger Bank Century berasal dari Direktorat Pengawasan.(aya) seorang pendiri Partai Amanat putusan Pengadilan Negeri kap anggota Komisi I DPR itu. JAKARTA (Waspada): 300 Puskesmas di seluruh Indonesia Nasional (PAN), Hatta Taliwang Jakarta Selatan Nomor 1129/ Sedangkan anggota Badan mendapat bantuan masing-masing Rp10 juta per bulan, mulai menilai Kongres PAN di Batam, Pdt.G/2008/PN.Jaksel tanggal Arbitrase PAN, Husein Hamid Januari 2010. Tujuannya meningkatkan kesehatan ibu dan anak, 8-10 Januari 2009 ilegal atau 5 Februari 2009 menyatakan AD/ meminta Menteri Hukum dan sekaligus mengurangi angka kematian ibu melahirkan maupun tidak sah, karena tidak mem- ART PAN sekarang tidak sah. HAM Patrialis Akbar yang juga angka kematian anak. punyai landasan hukum. “Putusan pengadilan kader PAN untuk segera “Ini untuk mengoptimalkan infrastruktur yang ada, dalam Mereka mengancam akan tersebut final dan mengikat. menjalankan putusan PN Jaksel. hal ini puskesmas secara langsung, meski secara teknis tidak menggelar kongres tandingan Seharusnya pengurus DPP PN Jaksel memutuskan bahwa dibayarkan setiap bulan,” kata Menko Kesra Agung Laksono, di Jakarta, April mendatang. melaporkan ke Depkumham hasil Kongres PAN II Semarang usai Rakor Kesra tingkat menteri, Selasa (5/1) malam di Jakarta. Alasan Kongres PAN di Ba- untuk segera diperbaiki, tapi bertentangan dengan hukum Agung mengatakan, bantuan itu sifatnya masih percobaan tam ilegal, berdasarkan Kongres tidak dilaporkan,” tegas Hatta. dan tidak berkekuatan tetap. di 300 kecamatan di tujuh provinsi. Karenanya diharapkan dalam PAN II di Semarang 2005 lalu, Wakil Sekretaris Jenderal Sebelumnya kata Husein, satu hingga dua tahun mendatang, program ini sudah bisa dilakukan dimana disebutkan ada PAN, Muhammad Najib menilai Dirjen Administrasi Hukum dan untuk sekira 8.500 puskesmas atau kecamatan. pelanggaran dan penyimpangan putusan PN Jakarta Selatan, 5 Undang-Undang (AHU) Mengenai kenapa bantuan tidak berupa penambahan tenaga dilakukan pengurus PAN seka- Februari 2009 yang memutus- Depkumham telah meminta dokter, paramedis atau obat-obatan, Agung mengatakan, dengan rang. “Pengurus PAN sekarang kan AD/ART PAN hasil Kongres pengurus DPP PAN untuk bantuan yang diterima langsung diharapkan pemanfaatannya tidak mengakui Badan Abitrase, II PAN Semarang tidak sah menyerahkan AD/ART partai lebih optimal selaras dengan kebutuhan masing-masing Puskesmas dan dengan seenaknya me- merupakan kesalahan prose- yang asli, namun permintaan yang disesuaikan dengan panduan yang ada. masukkan dan mengubah AD/ dur hukum. “Putusan PN Ja- itu tidak dipenuhi oleh DPP. Bantuan yang bersumber APBN itu untuk mengoptimalkan ART partai,” ujar Ketua Majelis karta Selatan merupakan “Artinya hasil Kongres PAN III peran Puskesmas, sehingga pada tingkat pengobatan tertentu Penasihat PAN di Nusa Tenggara kesalahan prosedur hukum, di Batam juga cacat hukum dan cukup dilakukan di Puskesmas. Barat itu kepada wartawan di sebab pengadilan tidak mem- ilegal. Itu bahaya bagi mereka,” “Dengan demikian pasien tidak perlu lagi dirujuk ke rumah DPR Jakarta, Rabu (6/1). berikan hak kepada pihak lain katanya. sakit tingkat kabupaten atau kota, bahkan rumah sakit tipe A,” Bagi pengurus PAN di ba- untuk menyampaikan pen- Ditanya bagaimana sikap tambahnya. wah kepemimpinan Soetrisno dapat,” kata Najib. Amien Rais terkait AD/ART Mengenai pengawasan, Menko Kesra didampingi Sesmenko Bachir, kata Hatta, adanya Memang katamya, ada palsu tapi masih digunakan, Kesra, Indroyono Soesilo mengemukakan, itu sudah menjadi Badan Abitrase dianggap pasal-pasal yang berubah dalam bahkan hingga Kongres III PAN bagian dari proyek percontohan bantuan Puskesmas. mengganggu kinerja pengurus AD/ART partai, namun peruba- di Batam nanti ? Husein menga- “Tentu dinas kesehatan setempat yang akan mengontrol dan DPP PAN. Akibatnya DPD yang han itu tidak mengganggu dan takan, Amien Rais diberikan mengawasi, termasuk lembaga pengawas,” kata dia menambahkan, biasanya memberikan tiga Kongres III PAN tetap dilakukan informasi yang salah soal dana untuk percobaan ini sekitar Rp30 miliar. Sementara bila suara, kini hanya diberikan dua di Batam. “Ada pasal-pasal yang tersebut.(aya) secara keseluruhan bisa mencapai Rp1,5 triliun. (dianw)
  • 2. 4 Luar Negeri WASPADA Kamis 7 Januari 2010 Oposisi Prancis Ambil Pemberontak Kolombia Sikap Tentang Burqa Bunuh Gubernur PARIS, Prancis (Antara/AFP): Kebijakan untuk melarang penutup muka Islam, burqa, di Perancis, memperoleh tantangan Rabu (6/ Dan Kecam Presiden 1) ketika pihak oposisi sosialis secara resmi menentang rencana BOGOTA, Kolombia (Antara/Reuters): Pemberontak sayap pemerintah untuk melarang itu. kiri Kolombia mengatakan mereka membunuh seorang gubernur Pengumuman yang dilakukan oleh pihak sosialis itu —yang provinsi tak lama setelah ditangkap bulan lalu, daripada dia berusaha anggotanya sebelumnya telah mengungkapkan perbedaan pendapat korupsi seperti yang direncanakannya. tentang isu itu— dikeluarkan satu hari setelah Presiden Nicolas Angkatan Bersenjata Revolusioner Kolombia (FARC) mengatakan Sarkozy membuka peluang bagi parlemen untuk melarang Selasa (5/1), dalam pernyataannya, bahwa Gubernur Luis Cuellar penggunaan penutup muka, yang dikenal sebagai burqa atau niqab. dari provinsi hutan selatan Caqueta — yang bersekongkol dengan Partai Sosialis menentang penggunaan burqa namun ‘tidak milisi paramiliter sayap kanan yang dibentuk pada 1980-an — untuk mendukung’ mengesahan pelarangan secara hukum, yang akan memerangi pemberontak. memberikan ketidak konsistenan pada ‘hukum ad hoc,’ menurut “Meskipun ada fakta kaitan antara gubernur dan paramiliter jurubicara Benoit Hamon kepada stasiun radio RTL. yang bertujuan untuk mempertahankannya, bukan untuk mem- “Kami menentang burqa karena merupakan penjara bagi bunuhnya atau meminta uang tebusan, namun mengajukannya perempuan dan tidak ada tempatnya di bumi Prancis,” katanya. ke pengadilan karena korupsi,” kata para gerilyawan di dalam “Namun sebuah hukum ad hoc tidak mengantisipasi dampak.” pernyataan yang disiarkan di jejaring www.anncol.eu, yang secara Dia menambahkan bahwa, “bukan urusan negara untuk teratur melakukan komunikasi untuk FARC. menghakimi apa yang benar atau salah dari ayat suci ... Kita seharusnya Pejabat berumur 69 tahun itu dicomot dari rumahnya pada tidak membuat hukum ketika belum jelas bagaimana penerapannya.” 21 Desember. Pemerintah dan keluarga Cuellar menduga bahwa Sarkozy sebelumnya mengatakan bahwa burqa tidak diterima dia menolak untuk bekerjasama dengan para penculik dan di Prancis namun tidak turut dalam perdebatan mengenai bagaimana mengeksekusinyapadasaatorang-orangbersenjatamencarikelompok parlemen harus menetapkannya. Pemimpin parlemen dari partai yang dekat dengannya. sayap kanannya Jean-Francopois Cope telah mengatakan bahwa Teori tersebut didukung oleh pernyataan FARC, yang mengatakan: dia akan mengusulkan sebuah rancangan undang-undang bulan “peristiwa ini tak diinginkan dan kejadian yang tragis merupakan ini untuk melarang penggunaan burqa di tempat umum untuk konsekuensi langsung terhadap perintah yang diberikan oleh Presiden melindungi Prancis dari para ‘ekstrimis.’ Alvaro Uribe untuk menyelamatkan sandera dari kekerasan.” Selasa, Sarkozy mengemukakan mengenai peluang adanya Para penculik mendobrak pintu rumah Cuellar, membunuh kebijakan tidak mengikat parlemen tentang itu dan mengatakan seorang polisi pengawal dan menyeret gubernur ke dalam jip yang bahwa dia tidak menentang parlemen, menurut anggota partai sudah menunggu. Lehernya digorok dan tubuhnya ditemukan kurang sayap kanannya. dari 24 jam kemudian di dekat kendaraan yang hancur terbakar. Berita itu mengejutkan rakyat Kolombia dan memunculkan Polisi Yaman Tahan kembali kenangan hari-hari berdarah konflik yang berlangsung lama, ketika gerilyawan dan paramiliter saling meledakkan bom, menculik dan pembantaian menjadi judul berita tiap hari di surat- Pemimpin Penting Al Qaida MENYELIDIKI The Associated Press Masyarakat, petugas kepolisian dan para penyelidik berdiri di lokasi ledakan di suratkabar. Ini adalah penclikan politik terbesar sejak Uribe berkuasa sejak 2002. SANA’A,Yaman (Antara/AFP):PolisiYaman Rabu (6/1) menahan kantor polisi lalulintas di pinggiran Makhachkala, ibukota Dagestan, Rusia, Rabu seorang pemimpin penting Al Qaida yang diduga berada dibelakang LEDAKAN DI (6/1). Papan reklame yang rusak (tengah atas) bertulisan DPS GIBDD (satu singkatan ancaman-ancamanyangmenyebabkansejumlahmisiasingmenutup pintu-pintu mereka, kata seorang pejabat keamanan. MAKHACHKALA, 6 Rusia untuk Dinas Patroli Jalan - Polisi Lalulintas). Seorang pengebom bunuhdiri meledakkan bom yang di kantor polisi di daerah bergolak Rusia di Kaukasus Utara Bom Tewaskan 6 Polisi Rusia Mohammed al AHanq terhindar dari penahanan Senin dalam satu operasi pasukan keamanan di Arhab, 40km utara Sana’a, tempat TEWAS Rabu, yang menewaskan sekurang-kuragnya enam orang dan mencederai 16 lainnya, MOSKOW, Rusia (Antara/AFP): Sebuah mobil yang berisikan bom menabrak sebuah kendaraan polisii, Rabu (6/1) dan meledak, kata polisi. dua anggota keluarganya tewas dan tiga orang lainnya menewaskan enam polisi dan mencederai 14 lainnya di Republik cedera.”Mohammed al Hanq dan dua orang lainnya yang cedera Dagestan, Rusia , kata kantor berita Interfax mengutip pernyataan ditangkap d sebuah rumah sakit provinsi Amran,” utara Sana’a, seorang pejabat. kata pejabat itu.Mereka ditemukan di sebuah rumah sakit di Reedah, Laporan sebelumnya mengatakan empat polisi tewas akibat Amran, katanya. ASTangguhkan Pemindahan Kedutaan Amerika Serikat yang ditutup dua hari lalu atas alasan keamanan karena ancaman al Qaida terhadap kepentingan- kepentingan asing , menyatakan bahwa dengan “operasi keamanan yang “berhasil” di utara ibu kota itu pihaknya memulai kembali ledakan bom di wilayah Kaukasus Utara itu. Juru bicara pusat medis darurat mengatakan jumlah korban mungkin bertambah. Ledakan itu terjadi pukul 08:00 waktu setempat di depan markasbesar polisi lalu lintas, Makhachkala, ibukota Dagestan, kata seorang perwira polisi kepada Interfax. Tahanan Guantanamo kegiatannya, Selasa. Kedutaan-kedutaan Inggris dan Prancis yang juga ditutup, memulai kembali kegiatan mereka, Rabu. Pembunuhan Songsong Kunjungan Mobil polisi itu ditabrak mobil yang membawa bom ketika berusahamemasukipintugerbang,katapejabatitudanmenambahkan para personil polisi “mengorban jiwa mereka untuk mencegah satu serangan teroris dengan jumlah korban lebih banyak.” Para penyelidik sedang memeriksa lokasi ledakan itu. WASHINGTON (Antara/ gagasan yang baik,” jurubicara waktusatutahununtukmenutup 23 tahun yang diduga telah Kekhawatiran meningkat bagi serangan-serangan gerilyawan PM Abishit Ke Thailand Selatan AFP): Gedung Putih Gedung Putih Robert Gibbs mengatakan pada wartawan fasilitas itu, yang berakhir bulan ini.Hampir separuh dari 198 menerima pelatihan al Qaida di Yaman, telah menambah masa- yang meningkat di seluruh wilayah Kaukasus Rusia , tempat para gerilyawan Islam memerangi pihak aparat lokal yang pro Kremlin NARATHIWAT, Thaliand (Antara/AFP): Kelompok bersenjata Selasa (5/1). “Kami tidak akan tahanan yang tinggal di Teluk lah Obama yang telah menderita dan pasukan keamanan Rusia dalam satu pemberontakan. Rabu (6/1) menembak mati dua warga sipil di Thailand Selatan mengatakan, AS telah memindahkan orang lagi ke Guantanamo adalah dariYaman. karenaupayanyauntukmenutup yang kacau sehari menjelang kunjungan PM Abhisiti Vejjajiva, kata Guantanamo,” kata Gibbs. polisi. Seorang pria Buddha tewas dii provinsi Pattani Rabu pagi memutuskan untuk menangguhkan pemindahan Tidak jelas berapa lama Tujuh tahanan Yaman telah dikirim pulang oleh pemerintah Teluk Guantanamo. Pada Sabtu, Obama untuk Kebakaran Tambang Batubara dalam satu serangan ketika ia sedang mengirim suku cadang ke penangguhan pemindahan yang Obama, termasuk enam tahanan pertama kali menuduh al Qaida sebuah bengkel perbaikan sepeda motor, kata mereka. Sebelumnya seorang pria bersenjata yang mengendarai sepeda tawanan di Teluk disebutkan Gibbs itu akan berakhir. pada Desember. Beberapa di Semenanjung Arab (AQAP), China Menewaskan 25 Orang tahanan yang lain telah dipulang- cabang kelompok Osama bin motor menembak mati seorang wanita Muslim yang menjadi milisi Guantanamo ke Yaman, Namun dia menyatakan BEIJING, China (Antara/Reuters): Paling tidak 25 orang tewas kan pada masa pemerintahan Laden yang bermarkas diYaman, di provinsi Narathiwat ketika sedang dalam perjalanan ke sebuah keputusan itu akan menambah akibat kebakaran di satu terowongan tambang China Tengah dan menyusul rencana untuk George W. Bush. mentargetkan pesawat North- kantor distrik lokal, kata polisi. jumlah tawanan dari kamp itu tiga lainnya terperangkap, kata media resmi Rabu (6/1). Peristiwa Gugus tugas tingkat tinggi west yang membawa 290 orang Aksi perlawanan di wilayah yang berpenduduk mayoritas Muslim pengeboman sebuah pesawat yang dapat dipindahkan ke Pusat itu merupakan musibah terbaru yang melanda industri pertambangan pemerintah Obama sedang ketika pesawat itu mendekati paling berbahaya di dunia itu. yang berbatasan dengan Malaysia itu meletus Januari 2004 dan PenjaraThompsondiIllinoisyang mengolah para tawanan yang Detroit. sejauh ini telah menewaskan lebih dari 4.100 orang. AS yang tampaknya digagas telah dipilih oleh pemerintah Kecelakaan itu terjadi di Daerah Xiantan, provinsi Hunan , ketika tersisa di Guantanamo, termasuk Tiga senator AS mem- kabel-kabel bawah tanah terbakar, kata kantor berita Abhisit , yang mengakui dia gagal membendung gelombang di negara Arab itu. untuk menahan para tawanan kerusuhan di wilayah selatan itu sejak dia memangku jabatan setahun beberapa tersangka pelaku teror peringatkan pekan lalu mengenai Xinhua.Walaupun 43 pekerja tambang selamat kondisi-kondisi Teluk Guantanamo. lalu , menurut rencana akan melakukan kunjungan sehari ke tiga Sebaru-barunya Minggu, yang paling dicari, untuk me- kemungkinan bencana keaman- mencemaskan. provinsi paling selatan itu, Kamis. pejabat penting anti-terorisme mutuskan nasib mereka. anjikaWashingtonmemindahkan “Pekerjaan penyelamatan sangat sulit, dengan gas beracun PM itu akan mengunjungi provinsi-provinsi Narathiwat, Yala Pemerintah Presiden Barack Obama, John Brennan, Beberapa tawanan akan tahanan kembali keYaman tanpa sangat banyak di terowongan setelah kebakaran itu,” kata Xinhua dan Pattani di mana dia akan meresmikan sebuah jalan, menaman Obama telah mendapat tekanan mengatakanbahwaASakanterus menghadapi pengadilan di jaminan dari Sanaa bahwa mengutip pernyataanWang Shuhe, wakil ketua Badan Keselamatan pohon dan mengunjungi kebun percontohan. Aksi kekerasan hebat dari pengktitik di dalam memulangkan pata tahanan hadapan pengadilan militer dan mereka tidak akan kembali ke Tambang Batubara Negara. meningkat dalam enam tahun belakangan ini di wilayah itu dengan negeri dan beberapa anggota Guantanamo ke Yaman, “pada sipil, dan sejumlah yang lain akan medan tempur. Laporan itu menambahkan tambang batubara itu dikelola swasta sejumlah ledakan bom, penembakan dan bahkan penikaman, tetapi parlemen yang bersahabat untuk waktuyangtepatdanlangkahyang ditahan untuk jangka waktu tak Para senator itu — termasuk dan memiliki 180 karyawan. Perusahaan meningkatkan dua kali kelompok garis keras itu tidak pernah secara terbuka menjelaskan tidak mengirim lagi tawanan ke tepatdandengancarayangtepat” . terbatas karena mereka dianggap JohnMcCaindaripartaiRepublik, lipat produksi tahunannya 60.000 ton. aksi-aksi mereka. Yaman, karena khawatir mereka Keputusan untuk menang- terlalu berbahaya untuk dibebas- yang dikalahkan oleh Obama China memiliki industri pertambangan batubara yang paling Ketegangan muncul dipermukaan di selatan sejak Thailand akanmasukkembaliketerorisme. guhkan pemindahan itu akan kan tapi tidak dapat diadili karena dalam pemilihan presiden 2008 banyak menimbulkan korban jiwa di dunia dengan lebih dari 3.000 yang berpenduduk mayoritas beragama Buddha menganeksasi “Sementara kita tetap ber- melemparkan rencana Obama bukti terhadap mereka tidak — mengatakan Said Ali al-Shihri, orang tewas akibat banjir, ledakan, ambruk dan kecelakaan lain bekas kesultanan Melayu yang beragama Islam tahun 1902. komitmen untuk menutup untuk menutup kamp tersebut cukup atau tercemar. yang mereka lukiskan sebagai dalam tahun 2008 saja. Abhisit , yang mengunjungi wilayah itu sebulan lalu bersama fasilitas itu, keputusan dibuat ke ketidakmenentuan lagi. Seranganpesawatjetpenum- “wakil AQAP dalam waktu lama”, Satu ledakan gas di sebuah tambang batubara di China Timurlaut dengan sejawat Malaysianya mengakui ia“kecewa” dengan kemajuan bahwa mulai sekarang pemin- Beberapa pejabat mengakui ia pang pada Hari Natal yang gagal ditahandiGuantanamotapitelah November lalu menewaskan paling tidak 104 orang. Dibandingkan untuk mengurangi aksi kekerasan saat ia merampungkan satu dahan lagi ke Yaman bukan tidak akan dapat menenuhi batas oleh seorang pria Nigeria berusia dibebaskan pada 2007. dengan pekerjaan manual lainnya,para pekerja tambang batu bara tahun memerintah, Desember lalu. China memperoleh gaji yang relatif tinggi.. Dampak Pemeriksaan Ekstra Yang Diminta AS: Penumpang Pesawat Menuju AS Dapat Jalani Pemeriksaan 7 Jam The Associated Press LAGOS, Nigeria (AP): Dam- keras. banyak penerbangan inter- Pakistan,AranSaudi,Somaliaand A daftar teroris dan daftar lara- pak pemberlakuan pengamanan AS menuntut agar bandara nasionalsejakpengebomangagal Yaman. ngan terbang setelah meninjau Para pekerja menyekop tambahan di sejumlah bandara tertentu melakukan screening itu. Para penumpang yang tiba database tersangka teroris. salju di lapangan basket yang dicurigai sebagai lintasan lebih hati-hati dan ketat bagi Para penumpang pesawat di sejumlah bandara AS dengan Pria yang ditangkap hari sebuah sekolah teroris, pihak keamanan terpaksa warga dari atau orang-orang yang dari Stockholm ke Newark, New penerbangan internasional diwa- Natal yang lalu, Umar Farouk menengah di Beijing, menerapkan pemeriksaan ekstra terbang dari 14 negara yang Jersey, digeledah ketat di gerbang jibkan menjalani pemeriksaan Abdulmutallab, ada di dalam China, Rabu (6/1). ketat dan tak urung di beberapa keamanannya dianggap berisiko. bandara, kata Mark Biddle, salah dengan metode screening luas database bersama kira-kira Ibukota China bandara, pemeriksaan itu dapat Namun pengetatan peraturan seorang penumpang. Dia me- — dan mereka dipisahkan antara 550.000 tersangka teror lainnya dibersihkan dari berlangsung berjam-jam. AS nampaknya kadang-kadang ngatakan tidak ada penumpang pria dan wanita. sejak November lalu. Namun tumpukan salju Senin Di Nigeria, salah satu negara baik,kadang-kadangburukSenin. yang dinyatakan dapat perhatian Lydia Habhab, seorang kalangan pejabat mengatakan setelah mengalami badai yang masuk dalam daftar AS “Semuanya masih nampak khusus. konsultan World Bank yang pemerintah tidak cukup infor- salju akhir pekan lalu, untukmenerapkanpengamanan sama. Tidak ada pengamanan Namun bandara di Lebanon, terbang dari Prancis ke Amster- masi untuk memasukkannya ke yang menyebabkan tambahan, terjadi antrian pan- ekstradisini,”kataseorangpejabat SyriadanLibya,semuanyanegara dam dan kemudian ke Detroit, daftar larangan terbang. banyak sekolah ditutup jang di hari pertama pember- penerbangan di Lebanon, salah yang ada dalam daftar AS, mengatakan dia telah jadi subjek Sementara itu, Kuba, Selasa, di Beijing dan lebih 300.000 orang lakuanaturanbaruitu.DiBandara satunegarayangadadalamdaftar nampaknya tidak ada perubahan scanning tubuh penuh dan menyampaikan satu protes dikerahkan untuk Lagos, Mine Oniovosa, seorang AS. kentara dalam penggunaan barang-baragnya dibuka lebar resmi pada peraturan baru Ame- membersihkan salju. mahasiswa24tahunmengatakan Pemerintah Presiden Barack screening. dan diperiksa. rika Serikat untuk memperketat dia telah diberitahu agar datang Obama memerintahkan peru- Dan beberapa pemerintah Keamanan tambahan itu pemeriksaan di keamanan bagi ke bandara tujuh jam lebih awal bahanitusetelahapayangmenu- Eropa, termasuk Jerman, Prancis disebabkan penerbangannya penumpang pesawat yang dari jadwal keberangkatannya ke Atlanta. rut pihak berwenang merupakan satu usaha gagal oleh pemuda danSpanyol,mengatakanmereka masih mempelajari peraturan akan berangkat satu jam lebih lambat dari jadwalnya, kata melakukan perjalanan dari atau melalui Kuba dan 13 negara yang Pewaris Johnson And Johnson Seorang pejabat Nigeria menjanjikan bahwa siapa saja hanya akan menjalani pemerik- Nigeria untuk meledakkan satu pesawat yang terbang dari Amsterdam ke Detroit, AS, pada itu sebelum memperketat keamanan lebih jauh dari pada langkah yang mereka ambil Habhab, yang berasal dari Detroit dan kini tinggal di Washington. “Saya secara pribadi merasa lain. Menteri Luar Negeri Kuba mengatakan bahwa pihaknya Ditemukan Tewas Di Los Angeles saan biasa di bandara interna- Hari Natal. setelah serangan gagal Natal lalu terusik, namun saya memahami memanggil Jonathan Farrar, yang NEWYORK, AS (Antara/AFP): Casey Johnson, di belakang kegiatan usaha raksasa farmasi dan sional di negara itu. Dinas Keamanan Perhubu- itu. mengapa prosedur itu perlu,” memimpin Seksi Kepentingan 30, wanita pewaris perusahaan Johnson and produk kesehatan Johnson and Johnson. Ayahnya, Johson, telah ditemukan tewas di Los Angeles, Woody Johnson, memiliki tim sepakbola New Di Lagos, para penjaga yang ngan AS (TSA) mengatakan “Kami akan terus beker- katanya. AS di Kedutaan Besar Swiss di kata jurubicara keluarga kekaisaran bisnis itu. York Jets dan pada Minggu baru saja merayakan mengenakansarungtangankaret peningkatanteknikscreeningakan jasamadenganpenerbangankami Jika langkah pengamanan itu Havana guna menyerahkan “Keluarga Johnson berduka atas kehilangan kemajuan dalam babak play-off NFL. melakukan penyisiran pada tas- mencakup pemeriksaan tubuh dan mitra internasional kami tidak dituruti, TSA-AS dapat me- keberatan itu. secara tragis pewaris dan meminta keleluasaan Casey dilaporkan memiliki hubungan yang tas penumpang, menghabiskan menyeluruh, penggeledahan untuk meyakinkan mereka ngenakan sanksi atas perusahaan “Kami menolak aksi jahat pribadi mereka tak diganggu selama masa yang bermasalah dengan ayahnya dan menderita waktunya kira-kirta satu menit barang bawaan, scanning tubuh memenuhi standar keamanan penerbangan bersangkutan, kata baru yang dilakukan pemerintah sangat sulit ini,” kata jurubicara tersebut. diabetes. Kehidupan asmaranya seringkali lebih lama untuk memeriksa penuhdanpenggunaanteknologi internasional danTSA,” kata Greg seorang pejabat TSA.Sanksi yang AS ini yang memasukkan Kuba Casey, yang pesta minuman keras dan percek- melibatkan pertengkaran terbuka dengan pacar barang tentengan. pendeteksi bahan peledak. Soule, jurubicara TSA dari AS. dikenakan dapat berupa pada apa yang disebut sebagai cokannya dengan pacar lesbiannya secara rutin lesbiannya, termasuk dengan Courtenay Semel, Di hari pertama pember- Para penumpang yang tiba Di antara ke-14 negara itu, peringatan, denda dan yang lebih daftar negara yang mendukung mengisi halaman tabloid, ditemukan tewas pada putri mantan CEOYahoo!, Terry Semel, demikian lakuan screening lebih ketat yang dengan penerbangan interna- empat adalah Kuba, Iran, Sudan berat lagi, pesawat dari perusa- terorisme,” kata pesan itu. Senin, demikian laporan TMZ dan laman lain laporan New York Post. diperintahkan AS bagi para sional melaporkan Senin, mereka dan Syria, yang dianggap haanpenerbanganbersangkutan Harian resmi Kuba Granma berita pesohor. Belum ada keterangan mengenai Hubungannya yang paling akhir ialah dengan penyebab kematiannya. sesama bintang tayangan realita TV Tila Tequila. penumpang pesawat dari negara telah digeledah satu per satu dan pemerintah AS sebagai negara dapat dilarang terbang ke AS. mengritik kebijakan baru Sebagaimana dikutip TMZ, beberapa sumber New York Post melaporkan bahwa Tequila tertentu, beberapa bandara di barang bawaan mereka diperiksa spansor terorisme. Daftar itu juga Pejabat intelijen AS mengata- Amerika Serikat itu Senin, dengan penegak hukum mengatakan Casey mungkin mengirim surat elektronik, “Semua orang, tolong seluruh dunia mengakui mereka dengan tangan — langkah- mencakup Afghanistan, Aljazair, kan pemerintah telah menying- menyebutnya sebagai“paranoid telah meninggal beberapa hari sebelum mayatnya berdoa buat ‘istri saya,’ Casey Johnson. Dia telah belum mengambil tindakan langkahyangdiberlakukandalam Irak, Lebanon, Libya, Nigeria, kirkan nama puluhan orang dari anti-teroris”.(m07) ditemukan. Casey adalah bagian dari keluarga meninggal.”
  • 3. WASPADA Kamis 7 Januari 2010 Sport 5 Barcelona Vs Sevilla 1-2 Pep Ngaku Salah Rotasi MADRID (Waspada): Pelatih Barcelona Josep ‘Pep’ Guardiola mengaku salah dalam merotasi pemain, sehingga pasukannya kalah 1- 2 dari Sevilla, Selasa (Rabu WIB) di Nou Camp Stadium. “Kekalahan itu terjadi karena saya membuat kesalahan. Saya merotasi skuad, karena hal itu memang harus dilakukan demi eurosport fisik pemain,” ungkap Pep dalam Hasrat balas dendam Craig Bellamy terhadap John O’Shea cs terkendala cuaca. Marca, Rabu (6/1). AP Kekalahan pada leg pertama Gelandang Barcelona Rafael Marquez (kanan) saling berjibaku dengan bek Sevilla Julien Escude di Nou Camp Stadium, Selasa Piala Raja Spanyol itu merupakan (Rabu WIB). Salju Juga Tunda kekalahan pertama El Barca sejak Mei2009diseluruhajang.“Semua dan mereka melakukan tekanan NamunSevillayanglebihawal bek Gabriel Milito sebagai starter, JadwalKamis,7January(GMT): yang membuat kami kesulitan,” mendapatkan gol. Diego Perotti setelah pemain Argentina itu pemain pantas tampil, semua ingin bermain. Apalagi kami tak Vallecano (II) v Mallorca (1900) tutur Presiden Barca Joan membangun serangan dengan pulih dari cedera ligamen lutut pernahmengeluhsejakmenjuarai Hercules(II)vOsasuna (1900) Laporta kepada Canal Plus. kencang dari rusuk kiri dan tahunan. “Saya kira terlalu dini untuk meneruskannya kepada Capel, “Ini sudah saya impikan, Derbi Manchester banyak ajang,” papar Pep. Malaga v Getafe (2100) Dengan kekalahan ini, El menyebut hasil ini sebagai akhir yang sedang tidak terkawal. tampil di stadion dan para Blaugrana berarti mesti menang era kami.Tapi setiap orang bebas Ibrahimovic mampu keluar pendukung.Sayangnya,itusedikit dengan dua bola pada leg kedua menyatakan apa yang sedang dari perangkap offside. Dia terganggu dengan hasil buruk,” di markas Sevilla, 13 Januari Capel menit 59. Ibrahimovic kami hadapi,” tambah Laporta. mengejar bola yang melayang tutur Milito kekpada AS. LONDON ( Waspada): alasan serupa. Trafford, kami akan menurunkan mendatang. melepaskan tembakan keras 18 Barca mendominasi per- dari Rafael Marquez, lantas “Kenyataannya saya merasa Buruknya cuaca yang melanda Piala Liga merupakan tropi banner itu. Ini tahun terakhir Gol Diego Capel dan Alvaro menit jelang pertandingan usai. mainan pada babak pertama dan mengelabuikiperManuelSanchez sangat baik sekarang. Sayang kawasan Inggris juga membuat pertama yang ingin direbut banner itu terpampang di sana, Negredo yang memastikan suk- Tetapi Los Azulgranas tidak Lionel Messi sempat menembak untuk menyamakan kedudukan. memangmasihsedikitcanggung, laga derbi Manchester antara City manajer anyar Manchester City karenakamiakanmemenangkan ses tim tamu atas sang penyan- dapat mempertahankan posi- dengan keras ke arah gawang Namun hasil imbang itu hanya tapi itu akan berubah menjadi dengan United pada leg pertama Roberto Mancini. tropi,” tekad Mancini. dang gelar. Striker Zlatan Ibra- sinya, setelah Negredo menam- lawan. Pep bahkan menurunkan bertahan dua menit. lebih positif pada setiap semifinal Piala Liga terpaksa “Kami sudah sampai di semi- Hubungan City yang hampa himovic sempat menyamakan bah satu angka lagi untuk Sevilla pemain pengganti Ibrahimovic Dalam duel tersebut, Pep pertandingan,”optimismeMilito. ditunda. final Carling Cup dan masih gelar dan United yang gelarnya kedudukan setelah gebrakan menit 74. “Sevilla pantas menang untuk menambah daya tekanan. buat pertama kali memainkan (h01/marca/canal/as) Laga antara pasukan Roberto bertahan di FA Cup. Jika kami semakin banyak, semakin Mancini melawan anak buah Sir bermain bagus dan penuh kon- memanas saat keduanya harus Alex Ferguson itu sejatinya sentrasi, sangat mungkin kami bertemu di semifinal Piala Liga. dilaksanakan Rabu (6/1), namun Federasi Sepabola (FA) Inggris memutuskan duel ditunda sampai ke final,” ucap Mancini dalam TribalFootball. Hasrat juara Mancini bahkan September lalu di Liga Premier, derbi Manchester juga diwarnai beberapa insiden. Toure Terbaik Mourinho Tak Butuh Vieira menjadi 19 Januari mendatang. Leg kedua pun terpaksa mundurseminggudanbaruakan makin besar, karena adanya banner ‘Stretford End’ yang ter- pampang di markas MU, Stadion Palingmenghebohkanadalah saat striker City Craig Bellamy yang mencetak dua gol, menon- Pantai Gading ROMA (Waspada): Patrick Vieirahampirpastimeninggalkan Inter Milan dalam usahanya digelar pada 27 Januari. Laga Old Trafford, bermakna ejekan jok wasit karena kesal atas waktu MADRID (Antara/ mendapatkan kembali tempat- pertama semifinal lainnya antara bagi The Citizens yang tak pernah injury-timeyang sangat panjang Reuters): Gelandang nya di tim Piala Dunia Perancis. Blackburn Rovers melawan lagi meraih tropi sejak 1976 silam. hingga mereka kalah 3-4 di Old Yaya Toure menjadi Upaya itu mesti segera dilakukan- AstonVilla juga ditunda dengan “Saat kami datang ke Old Trafford. (h01/bb/tf) PemainTerbaik Pantai nya, karenaVieira tak dibutuhkan Gading tahun ini, alenatorre Inter Jose Mourinho. ungkap Barcelona Ditanya tentang kesempatan dalam lamannyaa gelandang berusia 33 tahun yang Klasemen Liga Premier jarang diturunkan itu untuk tetap www.fcbarcelona.com, Chelsea 20 14 3 3 45-16 45 Rabu (6/1). di San Siro, Mourinho malah Man United 20 14 1 5 45-18 43 Adik Habib Kolo mengatakan; “Sangat sedikit.” Arsenal 19 13 2 4 51-21 41 “Tetapi selama dia bersama Toure itu terbaik Tottenham 20 11 4 5 42-22 37 kami, saya percaya profesionalis- dengan mengalahkan Man City 19 9 8 2 38-27 35 menya,” tambah pelatih asal penyerang Chelsea Aston Villa 20 10 5 5 29-18 35 Portugal itu, seperti dilansir Didier Drogba yang Reuters, Rabu (6/1). Liverpool 20 10 3 7 37-25 33 menjadi pesaing Birmingham20 9 5 6 20-18 32 Vieira kalah bersaing dengan utamanya. Dejan Stankovic, Esteban Fulham 20 7 6 7 26-22 27 Gelandang ber- Stoke City 20 6 6 8 18-25 24 CambiassomaupunThiagoSilva, usia 26 tahun yang saat sehingga belakangan terus Sunderland 20 6 5 9 28-31 23 ini sedang bersiap Everton 19 5 7 7 26-32 22 dikaitkan dengan Manchester untuk bela negara di City dan Olympique Lyon. Blackburn 20 5 6 9 20-35 21 Piala Afrika 2010 ter- Burnley 20 5 5 10 22-40 20 Kepergiannya dalam waktu sebut, telah mem- dekat dapat, menurut Mourinho, Wolves 20 5 4 11 17-36 19 bantu El Barca meme- the sun justru dapat mendorong I Wigan Ath 19 5 4 10 21-44 19 Didier Drogba (kiri) kalah bersaing nangi enam gelar Nerazzurri untuk segera mencari West Ham 20 4 6 10 28-37 18 dengan Yaya Toure (kanan). Bolton 18 4 6 8 26-36 18 sepanjang tahun 2009. pengganti pada bursa transfer Hull City 20 4 6 10 20-42 18 AP Masih seputar Januari ini. Pantai Gading, pelatih sportsillustrated Portsmouth 20 4 2 14 18-32 14 Striker Stoke City Tuncay Sanli histeria merayakan golnya ke gawang Mantan bos Vieira di Arse- Fulham di Britannia Stadium, Selasa (Rabu WIB). Vahid Halilhodzic mengkhawatirkan kondisi Drogba yang akan nal, ArseneWenger, merasa kaget Jose Mourinho tidak bisa memberikan garansi tampil kepada berhadapan dengan Burkina Faso pekan depan di Piala Afrika. bintangPerancisitutidakterpakai Patrick Vieira (kanan). Halilhodzic tak yakin Drogba fit 100%, setelah terus dimaksimalkan hingga kini kian dekat untuk pemain baru pada posisi itu,” lain. Tapi ini kesempatan baik Stoke Lengkapi Chelsea di Liga Premier dan Liga Champions. “Kami sangat mengkhawatirkan stamina para pemain pemain seperti Drogba, yang berlaga hampir setiap pekan. Menurut saya, tidak realistis jika seorang pemain berlaga dua partai dalam tiga pindah ke City of Manchester Stadium. “Saya akan selalu menghor- mati Vieira atas semua yang beber Wenger. The Professor pun yakin, The Citizens merupakan peluang untuknya,” lanjut Wenger. “Saya yakin, dia masih sangat efektif di Liga Premier. Sebab, dia bagus bagiVieira.“Saya kaget klub telah bebas cedera selama tiga Derita Fulham hari,” ucap Halilhodzic. “Makanya, sepuluh hari lalu saya ke Inggris untuk memintanya istirahat. Drogba hanya manusia biasa, bukan mesin,” tegasnya lagi. dilakukan dan diraihnya bersama Arsenal. Tapi kami memiliki banyakpemainmudadiposisinya dan tidak terlalu membutuhkan yang berpeluang besar menda- patkannya adalah Manchester City. “Pasalnya,Vieira lebih sering dihubungkan dengan klub-klub hinggaempatbulanterakhir.Inilah yang dibutuhkanVieira,” katanya menambahkan. (h01/rtr/tf) LONDON (Waspada): Stoke musim ini. Ini hari yang berat dengan cepat menambah gol City melengkapi derita Fulham untuk kami,” keluh Hodgson. Stokesetelahmendapatbolahasil dengan kemenangan 3-2 pada “Kamidipaksamenarikkeluar tendangan bebas Matthew Ethe- laga Liga Premier di stadion Brede Hangeland pada masa rington menit 34. Angka ketiga bersalju Britannia, Selasa (Rabu istirahat, karena cedera lutut. lahir melalui Mamady Sidibe. WIB). Kami juga kehilangan Zamora Tapi tim tamu bangkit Selain pulang tanpa poin, di babak kedua, sehingga men- mempertipiskekalahannyamenit Fulhampundipastikankehilangan derita kekalahan,” katanya 61 melalui Damien Duff. Lima jasa penyerang andalannya menambahkan. menit jelang bubaran, Cint Bobby Zamora yang menderita Laga liga satu-satunya pada Dempsey menambah satu gol cedera parah pada lengannya. malam itu berlangsung dalam lagi bagi Cottagers. Skor jadi 3- “Sepertinyaadadislokasi,tapi kondisi di bawah nol derajat 2 dan bertahan sampai usai duel. sayabelumtahuapakahitutulang celcius. Namun kemenangan per- lengan atau bahu. Yang pasti Tuan rumah Stoke kelihatan tama Stoke dalam enam partai cederanya cukup parah,” ungkap sudahpastimenangketikasempat liga itu juga harus dibayar mahal pelatih Roy Hodgson, seperti memimpin 3-0 pada babak dengan Sanli. dikutip dari BBC, Rabu (6/1). pertama. Penyerang Turki itu harus Bomber berusia 28 tahun Tuncay Sanli membuka gol ditarik keluar menit 42 setelah yang sudah mencetak 11 gol lewat tendangan jarak pendek hamstringnya bermasalah lagi tersebut, cedera akibat ditekel menit 12. Pertahanan The dan terpaksa menjalani Abdoulaye Faye menit 54. “Kami Cottagers yang memprihatinkan, pemindaian kemarin. kecewa, sebab dia bermain baik membuat Abdoulaye Faye (h01/bbc/ap) Problem Catur TTS Topik Olahraga Mendatar 6. Alat pemukul tenismeja Menurun 1. Pemimpin pertandingan S u d o ku Apa satu langkah jitu Putih yang akan membuat mati lawannya 7. Tempat pembukaan PON III 2. Terdiri dari beberapa Isi kotak kosong dengan angka 1 sampai 9. Tidak boleh ada dalam enam langkah. Jawaban lihat halaman dua. tahun 1953 di Medan pemain pengulangan angka mendatar, menurun, maupun di dalam Jawaban di halaman 2. 8. Tangguh 3. Nama depan pecatur kotak 3x3 bergaris tebal. Tidak ada keterlibatan matematika, 10. Angka terkenal Indonesia hanya membutuhkan pertimbangan dan logika. 12. Istilah dalam catur 4. Bakat Tingkat kesulitan hari ini: sedang (***). Jawabanhalaman8. di kolom dua. 14. Pimpinan organisasi 5. Jenis olahraga peras otak olahraga 6. Langkah salah dalam 15. Jenis olahraga bola kecil catur 7 6 8 9 pakai raket 7. Jenis olahraga si kulit 18. Dibawa keliling menjelang Olimpiade bundar 9. Kerjasama tim (bahasa 1 3 9 6 4 19. Permainan bola kaki pakai net 21. Istilah dalam golf Inggris) 11. Jaring 5 6 22. Klub sepakbola Inggris 12. Nama petinju si “leher besi” dibintangi Ronaldo 24. Negara Eropa juara 13. Salah satu negeri gudang atlit 16. Catatan prestasi 5 3 1 4 7 sepakbola dunia 1974 17. Gelar dalam catur 25.Jenis olahraga Piala Thomas 20. Petinju legendaris dari 9 7 5 28. Di dalam tubuh yang sehat AS sebelumnya bernama terdapat jiwa yang sehat (bahasa latin) Cassius Clay 23. Salah satu klub 6 7 4 2 3 30. Jenis olahraga sepakbola di lapangan kecil sepakbola Italia 26. Putaran dalam balap 7 4 31. Negara Eropa pencipta total 27. Perjanjian dengan football 32. Eliminasi pemain bayaran 28. Manchester United Fans 4 7 3 8 5 33. Klub sepakbola Inggris salah satu musuh MU Club 29. Pelatih (bahasa Inggris) 2 8 7 6
  • 4. 6 Sport WASPADA Kamis 7 Januari 2010 Merah Putih Masuk Kotak sudah mengantongi tujuh poin. hun itu nekad memasuki la- JAKARTA (Waspada): Pupuslah harapan Indone- sia untuk tampil di Piala Asia Qatar 2011. Kekalahan Kini, mereka tinggal bertarung pangan dan menyerang perta- all-out pada partai pamungkas hanan Oman. 1-2 dari Oman dalam lanjutan kualifikasi Grup B ketika menjamu Kuwait di Sultan Insiden ini terjadi di masa turnamen empat tahunan ini di Stadion Utama Qaboos Sports Complex, 3 Ma- injury time babak kedua. Dari Gelora Bung Karno Senayan Jakarta, Rabu (6/1) ret mendatang. sisi selatan lapangan, pria Oman lebih dulu membuka tersebut lolos dari pengamatan malam, menutup pintu bagi Merah Putih ikut ambil keunggulan pada menit ke-31 petugas keamanan dan masuk bagian. lewat gol Fawzi Basheer, se- lapangan. Dia lalu menguasai belum Boaz Salossa menyama- bola hingga kotak penalti Oman. Sebenarnya, Indonesia turut selalu ikut. Kegagalan ini kan skor menjelang turun mi- Kiper Oman, Ali Al Habsi, pun masih menyisakan satu pertan- pun membuat Indonesia sema- num. Tapi di babak kedua, tersenyum sambil mengambil dingan lagi melawan Australia kin tenggelam di dasar klasemen Oman memastikan kemena- posisi untuk menghalau ten- pada 3 Maret mendatang di sementara karena baru me- ngannya lewat gol Ismail Sulai- dangan sang suporter. Suncorp Stadium. Tetapi, keka- ngumpulkan tiga poin dari lima man pada menit ke-52. Tendangan tersebut akhir- lahan ini memastikan pasukan pertandingan. Mereka terpaut nya mampu ditahan Al Habsi, Benny Dollo tersingkir karena empat angka dari Kuwait dan Penonton Nekad sehingga gagal pula usahanya tak mungkin lagi menggeser dua Australia. Di saat timnas menemui dalam ‘membantu’ Bambang tim teratas. Bagi Oman, tambahan tiga jalan buntu dalam usahanya Pamungkas cs menjebol ga- Kekalahan ini juga meru- poin ini memiliki arti yang sa- mengejar ketinggalan, seorang wang Oman. Selang beberapa pakan pertama kalinya bagi In- ngat penting. Pasalnya, tim be- pendukung Merah Putih me- detik, dia pun diringkus polisi donesia absen di ajang Piala Asia sutan pelatih Claude Le Roy ini mutuskan ‘turun tangan’. Se- tanpa perlawanan. setelah empat kali berturut- menguak harapan lolos karena orang pria berusia sekitar 30 ta- (m33/ant/vvn) Reuters Striker Indonesia, Boaz Salossa (7), berhasil melewati hadangan pemain belakang Oman sekaligus mencetak satu-satunya gol bagi skuad Merah Putih dalam laga kualifikasi Piala Asia 2011 di Jakarta, Rabu (6/1) malam. Waspada/ist di Qatar, setelah ditaklukkan mampu menyamakan kedu- Gol kontroversial Persita Tangerang ke gawang PSMS Medan, Selasa (5/1) lalu. Kendati wasit melihat Ilham Jaya Kesuma dan seorang rekannya berposisi offside, gol tersebut dianggap sah. Alasan Klise Bendol Oman 2-1 di Stadion Utama Gelora Bung Karno, Rabu dukan di akhir babak pertama. Sayangnya, gol Ismail Sulaiman (6/1) malam. Atas kekalahan di babak kedua memupuskan Chico Maradona Susul Saha JAKARTA (Waspada): Tim nasional Indonesia dipastikan gagal tampil di putaran final Piala Asia 2011 yang akan digelar itu, sekali lagi pelatih Benny Dolo berkilah. Menurut Bendol, faktor persiapan yang minim dan ba- ambisi Indonesia tampil empat kali berturut-turut di Piala Asia. “Budi Sudarsono ditarik ke- luar karena sejak awal dia me- BOGOR (Waspada): Chico jalan lain bagi manajemen ke- Nyeck maupun Denny untuk meraih kemenangan atas Persi- nyaknya pemain yang cedera mang tidak dalam kondisi fit, Maradona menyusul Ikpefua cuali mendatangkan Chico yang menambah solidnya pertaha- kabo dan Semen Padang. Sui- serta absennya Ismed Sofyan dia mengalami cedera lutut, na- Osas Marvellous Saha ke Bogor ditinggal di Medan. Demikian nan PSMS,” ujar Benny seraya min juga bersyukur kepada ma- dan Maman Abdurahman mun menurut tim dokter dia untuk bergabung dengan skuad kata Asisten Manajer PSMS Drs berharap PSMS bisa meraih hasil najemen dan pengurus yang be- menjadi alasan penampilan bisa tampil karena memang kita PSMS Medan menghadapi Benny Tomasoa di Hotel Cibi- maksimal guna mewujudkan gitu tanggap menanggapi ke- buruk Merah Putih. membutuhkan dia,” jelas Benny. Persikabo, Jumat (8/1) besok. nong II Bogor, Rabu (6/1). raihan 18 poin di putaran per- butuhan tim dengan men- “Kita hanya memiliki waktu Sementara itu, pelatih Adapun hal tersebut setelah Usai mendatangkan Saha tama. datangkan dua pemain yang sedikit dalam mempersiapkan Oman, Claude Marie Francois Ayam Kinantan dipastikan sehari sebelumnya sebagai upa- “Selain memenangkan per- sebelumnya ditinggal itu. laga ini, baru mulai tanggal 24 Le Roy mengakui gol Boaz ter- kehilangan dua pemain bela- ya menutupi lemahnya kolek- tandingan dengan Persikabo, Setibanya di Bogor, Chico Desember, sementara masih jadi karena pemain belakangnya kangnya, Nyeck Nyobe dan tivitas lini serang tim Ayam Ki- PSMS juga harus mengalahkan menyatakan siap tampil di la- ada beberapa libur nasional gagal mengantisipasi datangnya Denny Wahyudi, akibat aku- nantan, kini barisan belakang Semen Padang di Stadion Te- pangan. “Saya bukan hanya siap yang membuat persiapan tim serangan Indonesia. mulasi kartu kuning saat meng- menjadi lemah pasca kehi- ladan Medan, 12 Januari men- membela PSMS, tetapi juga siap tidak maksimal,” tegas Benny “Kami lengah, karena Boaz hadapi Persita di Stadion Ben- langan Nyeck. datang,” lanjut Benny. membawa tim kebanggaan ma- dalam jumpa persnya. bisa mencuri gol, tapi secara teng Tangerang Selasa (5/1) lalu. “Chico yang juga karyawan Sependapat dengan Benny, syarakat Medan ini meme- inilah.com Dalam laga tersebut, Oman keseluruhan kami tampil bagus,” Menutupi kurangnya pe- Bank Sumut itu diharapkan pelatih Suimin Dihardja juga nangkan pertandingan mela- Kiper Oman Ali Al Habsi tersenyum ketika seorang suporter sempat memimpin terlebih imbuh pelatih asal Perancis ini. main belakang PSMS, tidak ada dapat mengisi kekosongan berharap Jecky Pasarella cs bisa wan Persikabo,” tuturnya. (m24) Indonesia memasuki lapangan. dahulu, namun Boaz Salossa (m33/ini) Waspada/Austin Antariksa Kiper ketiga PSMS Medan, Irwin Ramadhana, layak diberi kesempatan tampil. Anak Medan Minta PSMS Serius BOGOR (Waspada): Warga tambang ini menghimbau agar ping itu, Suimin atau pelatih perlihatkan penurunan dalam asal Medan di Jakarta dan seki- pemain tetap mengandalkan kiper Jamaluddin Hutauruk ha- penampilannya. “Irwin, man- tarnya berharap PSMS Medan fanatisme tinggi dan tampil rus berani menurunkan penjaga tan kiper Persikabo, pasti termo- mampu bermain lebih serius ngotot sepanjang pertandingan. gawang ketiga Irwin Rama- tivasi ingin memperlihatkan saat menghadapi Persikabo di Secara terpisah, anak Medan dhana. kemampuannya dalam de- Stadion Persikabo Bogor pada lainnya Ali Gultom dan Mu- Ini dikarenakan dua penjaga butnya membela PSMS kepada lanjutan kompetisi Divisi Utama hammad Juansyah mengingat- gawang inti yakni Sony Guna- publik Bogor dan manajemen,” Liga Indonesia 2009/2010, kan Tri Yudha Handoko cs wan dan M Halim kerap mem- tambah Juan.(m24) Jumat (8/1) besok. bahwa kekalahan dari Persikabo “Kami benar-benar kecewa akan memperkecil peluang atas kekalahan PSMS di Tange- PSMS lolos ke babak delapan rang dan itu bisa terobati bila besar. anak-anak Ayam Kinantan me- “Jadi tidak ada istilah lagi nang melawan Persikabo,” ujar kalah dari Persikabo yang per- Akir di Hotel Cibinong Bogor, nah ditangani pelatih Suimin Rabu (6/1), saat mengunjungi Dihardja tersebut,” tukas ofisial dan pemain PSMS. Gultom. Penggemar berat Ayam Ki- Juansyah menyatakan, Sui- nantan itu berjanji akan datang min sudah tahu apa yang akan ke Bogor pada pertandingan diperbuatnya, karena mengenal bersama dengan anak-anak betul karakter dan bentuk per- Medan lainnya. Pengusaha mainan lawan terakhir. Di sam- Benny Hadiri Panggilan PT LI BOGOR (Waspada): Asisten mengadukan Solihin cs dengan Manajer Tim PSMS Medan, Drs menyertakan beberapa bukti, Benny Tomasoa, akan meme- di antaranya sebuah foto dan nuhi panggilan PT Liga Indo- rekaman pertandingan,” kata nesia (LI) di sekretariat PSSI di mantan penjaga gawang PSMS Jakarta, Kamis (7/1) ini. itu. Demikian disampaikan Bukti tersebut adalah re- Benny kepada Waspada di Bo- kaman gambar foto dan re- gor, Rabu (6/1). Adapun pang- kaman video yang diambil gilan ini terkait laporan PSMS seorang reporter televisi dan tentang buruknya kinerja wasit juru foto yang meliput pertan- Solihin (Jatim) yang memimpin dingan, agar menjadi bahan pertandingan antara Persita pertimbangan bagi PT LI dalam kontra PSMS, Selasa (5/1) lalu. hal ini Komisi Disiplin (Komdis) “PSMS tidak main-main PSSI. (m24) Waspada/Austin Antariksa
  • 5. WASPADA Rabu 6 Januari 2010 Sport 7 6 Cabor SEAG Di GBK JAKARTA (Antara): Enam cabang olahraga SEA Games 2011 akan dipertandingkan di kawasan Gelora Bung (Lapangan Tenis Senayan), sepak bola (Stadion Utama GBK). Untuk menjadi tempat pelaksanaan, Menegpora Naikkan Gaji Pelatih Ragunan Karno Jakarta. menurut Nigara, pihaknya akan melakukan Direktur Operasional Badan Pengelola renovasi tempat lomba. “Secara fisik Gelora Bung Karno M Nigara di Jakarta, renovasi akan dilaksanakan Maret,” katanya. Rabu (6/1) mengatakan, enam cabor ini Ia menjelaskan, diantaranya GBK akan sesuai dengan ditunjuknya Jakarta sebagai mengganti rumput Stadion Utama GBK. salah satu kota yang menjadi tuan rumah “Sudah 13 tahun belum diganti,” ujarnya SEA Games 2011. lagi. Nigara mengatakan, enam cabang Untuk Istora juga dilakukan renovasi olahraga itu adalah sepak bola, futsal, besar-besaran untuk ac, lampu, toilet, dan JAKARTA (Antara): menjalani pendidikan di Sekolah anggar, tenis, tenis meja dan bulu tangkis. lantai. Di Jakarta sendiri akan berlangsung Olahraga Ragunan. Menteri Negara Pemuda dan “Uang saku dinaikkan dari Futsal akan dilaksanakan di Hall Tenis 10 cabang olahraga. Selain Jakarta, tuan Indoor, anggar (Hall Basket), bulutangkis rumah lainnya yakni Semarang, Bandung Olahraga (Menegpora) Andi Rp300 ribu menjadi Rp500 ribu/ (Istora), tenis meja (Pintu 5), tenis dan Palembang. Mallarangeng menaikkan gaji bulan,” katanya di hadapan atlet yang menjalani pendidikan. pelatih yang selama ini Atlet binaan Kementerian membina atlet di Sekolah Pemuda dan Olah Raga yang saat Bupati Sergai Lepas Olahraga Ragunan Jakarta. ini menjalani pendidikan kurang lebih 203 siswa mulai dari tingkat SD hingga SMA. Mereka adalah “Untuk membina olahraga atlet dari 18 cabang olahraga, di Peserta Gerak Jalan yang bagus, maka diperlukan kesejahteraan yang bagus pula,” katanya saat meninjau Sekolah antaranyaatletik,basket,voli,bulu tangkis dan renang. Sedangkanatletyangmenjadi SEI RAMPAH (Waspada): Bupati Sergai jarak lebih kurang 3 kilometer. Start dari Olahraga Ragunan, Rabu (6/1). binaan Dinas Pemuda dan Olah HT Erry Nuradi didampingi Wabup H lapangan kebun Sry Pamela dan finish di Gaji pelatih yang bertugas Raga DKI Jakarta sebanyak 110 Soekirman, Kadisdik Rifai Bakri Tanjung, obyek Wisata Batu Nongol. membina atlet-atlet muda di atlet dari 11 cabang olah raga. Kadispora Joni Walker Manik dan Camat Dalam arahannya, Erry Nuradi menga- sekolah olah raga terbesar di Adapun luas areal sekolah Sipispis Akmal melepas 3500 peserta dari 65 takan penting menjaga kebersamaan dari Indonesia itu adalah Rp 2,6 juta/ tersebut mencapai 17 hektar. regu gerak jalan beregu dan jalan santai di seluruh stakeholder yang ada. Kebersama- bulan. Melihat kondisi itu Sekolah Olahraga Ragunan lapangan Perkebunan PTPN 3 Sry Pamela, an itu adalah salah satu bagian yang sangat Menegpora menaikkan menjadi merupakan salah satu tempat Desa Buluh Duri, Kec Sipispis, Rabu (6/1). penting untuk mencapai sukses. sekitar Rp5 juta/bulan. mendidik atlet-atlet muda Indo- Kegiatan dalam rangka memeriahkan Kemudian, Erry menambahkan Selainmenaikkangajipelatih, nesia. Atlet yang menjalani pen- dan menyambut HUT Kabupaten Serdang kegiatan berolahraga akan menjadikan mantan juru bicara Presiden itu didikan di sekolah tersebut meru- Bedagai ke-VI ini diikuti jajaran Dinas tubuh sehat plus jiwa sehat. Saat itu juga, juga menaikkan uang saku bagi pakan pilihan yang mempunyai Pendidikan, siswa SMP-SMA serta Bupati menyampaikan salam olahraga yang atlet binaan Kementerian kemampuan dan keahlian pada masyarakat umum. Gerak jalan menempuh dijawab ”Sportif” oleh para peserta. (a07) Pemuda dan Olah Raga yang cabang-cabangolahragatertentu. wordpress.com Waspada/Eddi Gultom Bupati Sergai HT Erry Nuradi didampingi Wabup H Soekirman melepas peserta gerak jalan beregu dan jalan santai di lapangan sepakbola PTPN 3 Kebun Sry Pamela, Kecamatan Sipispis, Rabu (6/1). Polri, TNI, Satpol PP Olahraga Bersama BINJAI (Waspada): Gabungan Polri, TNI serta Satpol PP Pemko Binjai memeriahkan olahraga bersama yang didahului gerak jalan bersama menuju Mapolresta Binjai di kota tersebut, Rabu (6/1). Pakaian olahraga berbeda dari setiap satuan menjadi perhatian warga Kota Binjai. Sesampai di lapangan Mapolresta Binjai, dilakukan silaturahim dengan hiburan musim yang berlangsung meriah dan penuh kekeluargaan. Kasat Serse Mapolresta Binjai, AKP HM Taufik SE Mhum didamping Pasi Intel Kodim 0203 Langkat/ Binjai, Kapten Bosman Manik SH menjelaskan acara olahraga bersama itu merupakan kegiatan rutin untuk mempersatukan semangat kebersamaan dalan menjalan tugas semua tim dari kesatuan-kesatuan. Turut hadir di antaranya Danrem 022/PT Kol Kav Wahardono, Dandim 0203 Binjai Letkol Inf Widjanarko, Kasat Brimob Kombes Pol Ferdianto Biticaca serta Danyon Raider, Danyon Arhanudse Binjai, Dan Brimob juga Sekda Kota Binjai Drs H Iqbal Pulungan serta Kapolresta Binjai AKBP Robert Kennedy SIk SH. (a04) Waspada/Nazelian Tanjung Kelihatan Danrem 022/PT Kol KavWahardono didampingi Kasat Brimob Poldasu Kombes Drs Ferdianto Bitticaca nyanyi bersama.
  • 6. 8 Sport WASPADA Kamis 7 Januari 2009 AP Rockets Gagal Meluncur Federer, Nadal Kompak LOS ANGELES, AS (Was- Di Dallas, Mavericks me- nangan terakhir yang diraih DOHA ( Waspada): pada): Los Angeles Lakers suk- naklukkan Detroits Pistons Pistons musim ini terjadi Roger Federer dan Rafael ses mengemas kemenangan 98-93 sekaligus melengkapi pada akhir tahun lalu saat me- Nadal belum menemui ketiga mereka di tahun 2010 derita tim tamu yang meng- nekuk Golden State Warriors masalah di Turnamen setelah mengalahkan Hou- alami 10 kekalahan beruntun. 104-95, Desember 2009. Qatar Terbuka dan me- ston Rockets 88-79 dalam lan- Kekalahan ini pun merupa- Di Charlotte, Bobcats kem- laju ke babak kedua sete- jutan kompetisi NBA di Sta- kan catatan terburuk Pistons bali meraup kemenangan di lah mengalahkan lawan- ples Center, Rabu (6/1). sejak musim 1993-1994. tiga pertandingan terakhir- lawannya di babak perta- Andrew Bynum menge- Sebelumnya, dalam enam nya. Setelah Miami Heat dan ma, Rabu (6/1). mas 11 poin di kuarter akhir tahun terakhir, Pistons tak Cleveland Cavaliers, kini Petenis nomor satu untuk mengamankan keme- pernah menelan 10 kekala- giliran Chicago Bulls dibekuk dan dua dunia tersebut nangan Lakers. Secara total, han secara beruntun. Keme- 113-108. (m33/ap) berhasil menang mudah Bynum mengemas 24 poin di babak pertama. Fede- dan mengungguli Kobe Bryant rer berhasil melumat pe- yang hanya mengoleksi 22 Hasil lain tenis Belgia Christophe angka. Selain itu, Lamar Odom Rochus 6-1, 6-2, sedang- juga membantu Lakers de- Indiana Pacers vs Orlando Magic 97-90 kan Nadal menang 6-3, ngan 17 poin 19 rebound. Washington Wizards vs Philadelphia 76ers 104-97 6-3 atas petenis Italia AP Di pertandingan ini, La- Milwaukee Bucks vs New Jersey Nets 98-76 Simone Bolelli. kers kembali diperkuat Ron Denver Nuggets vs Golden State Warriors 123-122 “Saya mendapat latihan yang bagus di Abu Dhabi dan bisa Artest yang sempat absen di Memphis Grizzlies vs Portland T’blazers 109-105 menciptakan poin. Ini sangat bagus untuk mendapatkan hasil lima pertandingan sebelum- Phoenix Suns vs Sacramento Kings 113-109 positif,” papar Federer. (m33/ap) nya karena cedera. Penentu Inggris PERTH, Australia (Waspa- da): Duet Andy Murray dan petenis muda Laura Robson KOMISI PEMILIHAN UMUM berhasil mengantarkan Ing- KABUPATEN TOBA SAMOSIR gris meraih kemenangan 2-1 atas Jerman di ajang Piala PENGUMUMAN Hopman 2009, Rabu (6/1). NOMOR: 270/10/KPU-TS/2010 Kemenangan Inggris di- tentukan dalam partai ganda TENTANG campuran. Di dalam laga ter- PENGUMUMAN PENDAFTARAN BAKAL CALON sebut, Murray dan Robson PERSEORANGAN PEMILIHAN UMUM menang 6-3, 6-2 atas Philipp KEPALA DAERAH DAN WAKIL KEPALA DAERAH Kohlschreiber dan Sabine KABUPATEN TOBA SAMOSIR TAHUN 2010 Lisicki. Dalam Rangka Pelaksanaan Pemilihan Umum Kepala Daerah dan Sebelummya, Lisicki me- Wakil Kepala Daerah Kabupaten Toba Samosir Tahun 2010, Komisi nang 7-6 (5), 6-3 atas Robson Pemilihan Umum Kabupaten Toba Samosir membuka pendaftaran Bakal Pasangan Calon Bupati dan Wakil Bupati dari Perseorangan: dan Murray mengalahkan Kohlschreiber 6-4, 6-2. Keme- 1. Pendaftaran Bakal Pasangan Calon Perseorangan dimulai tanggal 07 Januari 2010 s/d 14 Januari 2010, Pukul 09.00 wib s/d 16.00 wib nangan ini membuka kesem- patan bagi Inggris untuk tam- 2. Tempat Pendaftaran : Kantor Komisi Pemilihan Umum Kabupaten pil di laga final pada Sabtu (9/ Toba Samosir, Jln DI.Panjaitan No.1B Balige-Toba Samosir 1) mendatang. 3. Untuk informasi lebih lanjut dapat menghubungi kantor Komisi Dari Grup A, Spanyol me- Pemilihan Umum Kabupaten Toba Samosir, Jln. DI. Panjaitan No.1B Balige-Toba Samosir Telp/Fax : 0632-322401 miliki kesempatan lolos ke fi- nal cukup besar setelah ber- Balige, 06 Januari 2010 hasil menuai dua kemena- Komisi Pemilihan Umum Kabupaten Toba Samosir ngan atas Amerika Serikat dan KETUA, Rumania. (m33/ini) LAMPITA MORINA SIREGAR, SE
  • 7. WASPADA Kamis 7 Januari 2010 Medan Metropolitan 9 Penderita Gangguan Jiwa Meningkat 50 Persen Pasien RSJD Pengangguran MEDAN (Waspada): Tahun 2010 ini Mengantisipasi lonjakan “Tekanan ekonomi dan diperkirakan jumlah penderita gangguan jiwa pasien yang mengalami gang- tekanan sosial yang dirasakan guan kejiwaan di tahun 2010 sangat mengganggu kehidupan meningkat. Banyak hal yang menjadi penyebab, ini, lanjutnya, pihak RSJD te- sosial. Sempitnya lapangan salah satunya, lapangan pekerjaan yang minim lah mengantisipasinya sejak pekerjaan menjadikan banyak dan kondisi ekonomi tidak stabil. Jika ini masih tiga tahun lalu. “Kami memu- orang menjadi pengangguran. terjadi akan banyak orang yang mengalami stres tuskan untuk datang ke Pus- Sehingga rasa percaya diri me- karena menghadapi persoalan hidup terutama kesmas di daerah-daerah yang reka akan hilang. Karena pe- ada di Sumut dan mengecek kerjaan, tak hanya memenuhi dalam mencari lapangan pekerjaan. pasien di sana. Pasien tidak kebutuhan hidup semata, tapi perlu langsung ke rumah sakit juga harga diri,” kata Parlindu- Pengangguran menjadi kata Gultom, itupun tergantung jiwa ini,” imbuhnya. ngan via telepon, Rabu (6/1). salah satu pemicu seseorang kepribadian, kondisi internal Dengan begitu, katanya, Pesan Parlindungan, ada mengalami gangguan kejiwaan. atau fisik, pengetahuan dan antisipasi ini sangat efektif tiga hal untuk mencegah me- Di Rumah Sakit Jiwa Daerah harta orang tersebut. untuk membantu pasien yang ningkatnya jumlah gangguan (RSJD) Pemprovsu sekarang ter- “Kalau dia stres atau pe- berasal dari luar kota atau jauh kejiwaan pada di tahun ini, yaitu dapat 420 pasien yang mengala- ngangguran karena harta bapak dari lokasi rumah sakit. “Sebe- pertama, pemerintah harus mi gangguan jiwa yang kini atau orang tuanya banyak, lum ini dilakukan, dulu setiap menciptakan lapangan pekerja- dirawat di rumah sakit jiwa ter- mungkin tak jadi masalah.Yang hari sebanyak 100 pasien tiap an secara massal seperti pem- sebut. Dari 420 pasien itu, seba- menjadi masalah, kalau dia di- hari yang berobat jalan, tapi bangunan jalan seperti program nyak 50 persen lebihnya para pecat, tapi yang menjadi tang- sekarang hanya 60 sampai 70 PNPM, kedua, pemerintah Waspada/ME Ginting pasiennya berlatarbelakang gungan dia banyak, ditambah tidak memiliki pekerjaan atau lagi harga bahan pokok mening- orang yang rawat jalan. Daripa- harus menciptakan iklim yang MEMBONGKAR: Petugas Sat Pol PP Kota Medan mengangkut semua bangunan pedagang di Titi Gantung yang sudah dibongkar pengangguran. kat. Inilah yang menimbulkan da mereka jauh-jauh ke sini, kondusif. Sebab, agar pengusa- oleh pemiliknya dengan menggunakan truk, Rabu (6/1). “Saat ini sebagian besar kecemasan, rasa malu, ketaku- lebih baik kami yang ke sana,” ha tidak lari dan mau mena- pasien latarbelakangnya tidak tan, putus asa, stres dan sebagai- ujarnya sembari mengatakan namkan modalnya. Dan ketiga, memiliki pekerjaan, kira-kira sekitar lima puluh persen lebih. Selebihnya lagi karena masalah nya. Sehingga akan mengalami gangguan jiwa, baik berat maupun ringan.,” terang Dapot. total pasien di RSJD tahun 2009 mencapai 5.040 orang. Ciptakan tumbuhkan rasa percaya diri pada diri kita. Pengangguran, lanjutnya, harus dapat perha- Kios-kios Titi Gantung Dibongkar perceraian, narkoba dan lain- Untuk mencegah para pe- lapangan kerja tian serius dari pemerintah. nya,” kata Plt Direktur RSJD Pem- ngangguran atau korban pemu- Sementara itu, anggota Menurut Parlindungan, Pedagang Menangis propsu Dr. Dapot P Gultom, SpKJ tusan hubungan kerja (PHK) DPD RI asal Sumut Parlindung- bertambahnya tingkat pe- kepada Waspada, Rabu (6/1). agar tidak mengalami gangguan an Purba percaya dan yakin apa ngangguran berarti bertambah MEDAN (Waspada): Petu- gusuran itu sangat tidak wajar caan di tempat ini. Jadi, peda- membersihkannya. Menurut Gultom, ganggu- kejiwaan, Gultom mengatakan yang dikatakan Plt direktur RSJD pula orang yang mengalami gas Sat Pol PP Kota Medan be- bila Pemko tidak mempunyai gang tidak kehilangan mata Secara terpisah, Kepala Ba- an kejiwaan pada orang yang agar para pengangguran diberi Pemprovsu tersebut tentang gangguan kejiwaan. RSJ akan kerjasama dengan Muspika solusi kepada pedagang. Karena pencaharian,” sebutnya. gian Humas Pemko Medan pengangguran atau yang baru dukungan dari keluarga, pem- meningkatnya jumlah pende- kewalahan mengatasi ini se- Medan Barat dan Medan Timur selama ini, lanjutnya, perda- Demikian juga dikatakan Hanas Hasibuan menegaskan, di-PHK tidak langsung keliha- bentukan iman dan mental rita gangguan jiwa di tahun 2010 mua sebab bangsal yang dise- membongkar belasan lapak gangan buku di Titi Gantung su- Ahmad yang juga pedagang penataan pedagang di kawasan tan begitu saja. Minimal mema- para pengangguran atau kor- jika lapangan pekerjaan dan diakan pemerintah akan tidak pedagang Titi Gantung, Rabu dah tidak asing lagi bagi masya- buku. Dia memaparkan, dirinya Titi Gantung sifatnya untuk kan waktu sampai 6 bulan. Tapi, ban PHK dari pemuka agama. kondisi ekonomi belum stabil. cukup menampungnya. (cmai) (6/1). Pembongkaran itu ber- rakat Sumatera Utara. sangat setuju bila Pj Walikota membersihkan selain pedagang langsung aman, walaupun “Sejak zaman Pak Abdillah Medan berniat kembali mem- buku, menertibkan bangunan pedagang sempat meneteskan sudah ada pedagang buku di Titi buka lokasi tersebut. Hal ini liar serta menggusur pedagang Pengangkatan Pejabat RS Pirngadi Dievaluasi air mata karena kehilangan mata pencahariannya. Gantung. Saat itu terjadi peng- gusuran ke Lapangan Merdeka, merupakan langkah maju bagi warga Kota Medan. tuak di lokasi itu. “Pemko sudah komitmen Poniran salah seorang namun kami tidak bisa ikut ka- “Siapa yang tak kenal de- tidak melarang pedagang buku, MEDAN (Waspada): Pen- tersebut. PH. Direktur RSU Dr. Pirngadi Di tempat yang sama, PH. pedagang buku mengatakan, rena tempatnya tidak mencu- ngan Titi Gantung sebagai tem- kami juga akan membuat ta- jabat Walikota Medan Rahud- Menurut Rushakim, ada di dr. Dewi F Syahnan, SpTHT dan . Direktur RSU Dr. Pirngadi Me- dirinya sangat terkejut dengan kupi,” ungkapnya. pat jual buku, pasti banyak orang man bacaan rakyat yang nanti- man Harahap menginstruk- antara calon pejabat eselon IV Wakil Direktur yang membi- dan dr. Dewi F Syahnan, SpTHT . kebijakan Pemko menggusur Untuk itu, tambahnya, sudah mengenal. Para calon nya dijaga. Sebelum penggusu- sikan Pelaksana Harian (PH) yang akan dilantik tersebut dangi Sumber Daya Manusia mengatakan kepada Waspada, para pedagang yang ada di Titi pihaknya meminta kepada pejabat juga banyak membeli ran ini dilakukan, terlebih da- Direktur RSU Dr. Pirngadi dr. dinilai tidak tepat untuk mendu- (SDM) segera melakukan eva- pihaknya belum melakukan Gantung. Karena menurut dia, Pemko agar tetap memberikan buku di tempat ini,” ucapnya. hulu Pemko sudah memberi- Dewi F. Syahnan, SpTHT agar duki jabatannya. Bahkan ada luasi terhadap pejabat eselon evaluasi terhadap pejabat ese- pedagang disana sudah berta- izin kepada para pedagang Camat Medan Barat Parda- kan surat kepada semua peda- mengevaluasi rencana peng- pula pejabat yang sempat IV yang akan dilantik tersebut. lon IV yang akan dilantik terse- hun-tahun lamanya berjualan untuk berjualan buku di tempat maean Siregar mengatakan, gang,”ucapnya. angkatan pejabat eselon IV di diambil alih jabatannya pada “Terkait masalah pejabat but. “Belum ada evaluasi. Saya untuk mencukupi kebutuhan tersebut. Menurutnya, kalau sejumlah pedagang dilarang Sebelumnya, Penjabat Wa- lingkungan rumah sakit tersebut. kepemimpinan Direktur RSU eselon IV RSU Dr. Pirngadi yang akan melapor dulu ke Pemko rumah tangganya. memang Pemko ingin menata berdagang di Titi Gantung likota Medan Rahudman Hal itu ditegaskan Rahud- Dr. Pirngadi yang lalu, kini tidak sesuai, saya serahkan Medan,” ujarnya. “Siapa yang tidak mengenal lokasi itu sebaiknya digunakan karena bertentangan dengan Harahap berjanji akan kembali man setelah melakukan dialog dikembalikan lagi. kepada Direktur dan Wakil Kasubbag TU Titi Gantung sebagai tempat sebagai taman bacaan. peraturan. Setelah penggusuran memungsikan keberadaan Titi dengan jajaran pimpinan, peja- Karena itu, Rushakim me- Direktur yang membidangi Sementara itu, informasi jualan buku,” kata Poniran. “Kami sangat setuju kalau tersebut, pihaknya segera mela- Gantung, sebuah situs sejarah bat stuktural, pejabat fungsional nyampaikan kepada Pj.Walikota SDM untuk melakukan eva- yang diperolehWaspada di lapa- Untuk itu, lanjutnya, peng- Pemko membuka taman ba- kukan gotong royong untuk di kota ini. (h10) dan staf RSU Dr. Pirngadi Me- mengapa pengangkatan peja- luasi,” ujar Rahudman. ngan, salah satu jabatan yang dan di ruang rapat rumah sakit bat eselon IV tersebut tidak Ketika ditanya wartawan akan diserahterimakan adalah tersebut, Rabu (6/1). melalui proses pengusulan dari tentang Badan Pertimbangan Kepala Sub Bagian Tata Usaha Dalam pertemuan itu, Ke- manajemen RSU Dr. Pirngadi Jabatan dan Kepangkatan (Ba- (Kasubbag TU) RSU Dr. Pirngadi pala Satuan Medis Fungsional atau fit and propper test sehing- perkajat) yang terkesan tidak Medan. Rencananya, jabatan (SMF) Obstetri dan Ginekologi ga pejabat yang akan ditempat- berfungsi dalam menyeleksi struktural itu akan diduduki RSU Dr. Pirngadi Medan dr. kan tersebut benar-benar sesuai pejabat yang akan dilantik, oleh pejabat dari kelompok Rushakim Lubis, SpOG me- dengan kemampuan dan kom- Rahudman dengan tegas fungsional dan tidak memiliki nyinggung tentang rencana petensinya. membantahnya. “Baperjakat pengalaman administrasi di pengangkatan pejabat eselon Menanggapi permasalahan sudah menjalankan fungsinya,” rumah sakit tersebut. IV di lingkungan rumah sakit tersebut, Rahudman meminta tegas Rahudman. Rencana pengangkatan pe- jabat fungsional untuk mendu- duki jabatan Kasubbag TU ini diwarnai komentar miring dari kalangan pegawai di lingkungan RSU Dr. Pirngadi Medan. “Ini membuktikan bahwa penem- patan pejabat tersebut tidak disesuaikan dengan kemam- puan dan kompetensinya. Seharusnya, dilakukan seleksi untuk mencari pejabat yang benar-benar mampu menja- lankan fungsi administrasi rumah sakit,” ujar seorang pega- wai yang tidak ingin disebutkan identitasnya. Menurutnya, masih banyak pejabat dan staf struktural RSU Dr. Pirngadi yang sudah ber- pengalaman di bidang adminis- trasi tersebut. Anehnya, pihak Pemko Medan justru memilih pejabat fungsional yang tidak Waspada/David Swayana memiliki pengalaman ad- BERI PENGARAHAN: Pj.Walikota Medan Drs. H. Rahudman Harahap, MM memberi pengarahan ministrasi di RSU Dr. Pirngadi kepada jajaran pimpinan dan staf RSU Dr. Pirngadi di ruang rapat rumah sakit tersebut, Rabu untuk mengisi jabatan struk- (6/1). tural tersebut.(m26) Sumut Dilanda Udara Kotor MEDAN (Waspada) : Kawa- udara di kawasan Medan masih menyebabkan terjadinya udara Fikar, pekerja Bandara Polonia. san Sumatera Utara akan me- tergolong normal hanya pe- kotor karena masih ada hujan Menurutnya, peningkatan suhu masuki musim kemarau pada ningkatan suhu sedikit saja dari lokal dan fluktuasi awan-awan panas Selasa malam belum Pebruari 2010, ditandai me- bulan Desember 2009, pening- dapat menetralkan kondisi mempengaruhi ketenangan ningkatnya suhu udara panas katan suhu maksimum antara udara di daerah Sumut bahkan warga dibanding suhu udara bahkan muncul titik-titik api ke- 32 hingga 33 derajat Celcius. kawasan Medan. panas yang biasa terjadi saat bakaran hutan. Yang parahnya Kondisi demikian belum Hal yang sama dibenarkan musim kemarau. (m32) lagi akibat kebakaran hutan dan minimnya peluang curah hujan menimbulkan asap tebal dan udara kotor di sejumlah daerah Gedung Poltekkes Mulai Rampung di Sumatera Utara. MEDAN (Waspada): Pem- ujarnya. dan anggaran untuk asrama Firman, S.Com, Kepala data bangunan gedung untuk kegia- Keterangan itu sebagai ja- mahasiswa sebesar Rp14 miliar, dan informasi (Datin) pada tan mahasiswa Politeknik waban aksi Sentral Organisasi juga tidak selesai sampai saat Badan Meteorologi, Klimatologi Kesehatan (Poltekkes) Depkes Mahasiswa Anti Korupsi (Soma- ini. Mereka mengatakan, ada dan Geofisika (BMKG) Wilayah Medan mulai rampung, tinggal si) Sumut ke Poltekkes Medan indikasi korupsi dalam proyek I stasiun Bandara Polonia Me- menunggu tambahan anggaran Jalan Jamin Ginting Km 13,5 pembangunan itu. dan kepada Waspada di ban- untuk tahap akhir (finishing). Medan Tuntungan, Rabu (6/1) Menanggapi tudingan itu, dara itu, Rabu (6/1). “Tahap awal pengerjaan proyek, siang. Dalam aksinya, para pen- Zainuddin di damping Humas Kata Firman, pengalaman sekaligus pembebasan tanah demo mengatakan, pembangu- Poltekkes Medan, Habiaran tahun-tahun sebelumnya, ra- dengan anggaran Rp7 miliar nan Poltekkes pada 2006 deng- Harahap menyebutkan, untuk tusan titik api kebakaran hu- pada 2006 telah selesai dilaksa- an anggaran Rp7 miliar tertun- kasus kebocoran anggaran nakan,” kata panitia pelaksana da, atau tidak selesai. Padahal sudah sampai ke ranah hukum. tan, baik dari Riau dan perba- proyek pembangunan Poltek- kata mereka, anggaran untuk “Kita akui ada kelalaian, tasan kawasan Sumatera Utara kes Medan Zainuddin Harahap itu sudah ditambah Rp2,5 miliar. sehingga terjadi kebocoran bahkan Aceh selalu terpantau kepada wartawan di Medan, Mereka juga mengatakan, anggaran dilakukan pelaksana melalui satelit National Ocea- Rabu (6/1). pembangunan mushalla, ruang proyek. Namun masalah ini nografic Asmoferik (NOA) Anggaran tahap awal itu, Akbid dan asrama pada proyek sudah diserahkan ke proses hu- Amerika. lanjutnya, selain pembebasan lanjutan 2007 yang dilakukan kum, dan kami sebagai panitia Bahkan, akibat meningkat lahan, untuk membangun kan- PT Care Indonesia dengan ang- membidangi administrasi sudah asap tebal dan udara kotor dari tor, asrama dan ruang kuliah. garan Rp13,5 miliar juga tidak pula mendapat sanksi dari Dir- Sumatera Utara dan kawasan Diakui Zainuddin, ada penam- selesai. Juga ada indikasi kebo- jen Depkes dengan penundaan lainnya di Sumatera, tidak bahan anggaran Rp2,5 miliar corananggaranRp1,1miliar,yang kenaikan pangkat,” ujarnya. jarang dikeluhkan masyarakat dari PAPBN untuk merampung- ‘dijebol’ di BRI Iskandar Muda. Tentang lanjutan proyek negara tetangga Malaysia. Me- kan proyek tahap pertama itu. Kemudian pekerjaan lan- 2009, kata Zainuddin, sudah reka selalu menuduh Indonesia “Tetapi tidak ada kecurangan jutan tahun 2009 untuk penye- selesai dilaksanakan. “Pagu dari mengekspor asap ke sana. dari pihak kita dalam penge- lesaian aula, mushalla, asrama pusat untuk proyek lanjutan itu Menurut Firman, untuk saat luaran anggaran. Kita bisa mahasiswa dan ruang Akbid Rp14 miliar dan sudah selesai se- ini awal Januari 2010, kondisi mempertanggungjawabkannya,” dengan anggaran Rp9 miliar suai yang direncanakan. (m11)
  • 8. 10 Medan Metropolitan WASPADA Kamis 7 Januari 2010 Elpiji 12 Kg Langka Ibu-ibu Panik Masak Pakai Solar Dan Kayu Bakar MEDAN (Waspada): Sebagian besar tidak marak,” ujarnya. suplai sebesar 500 MT. dari kilang swasta di Pangkalan Maksimalkan suplai “Memang terjadi kenaikan Susu sebesar 30 MT per hari. masyarakat mulai panik dengan kelangkaan Humas PT Pertamina Rus- konsumsi elpiji sejak konversi “Sedangkan untuk minyak minyak tanah dan elpiji di Kota Medan. tam Aji menyatakan PT Perta- dan penarikan minyak tanah tanah non subsidi sudah ada se- mina sedang mengupayakan bersubsidi, sehingga pihaknya kitar 130 penyalur yang tersebar Beberapa warga ada yang ikut serta sepertinya ada indi- untuk memaksimalkan suplai memprioritaskan pengisian 3 di lima kabupaten/kota, selan- menggunakan bahan bakar kasi untuk menaikkan elpiji 12 elpiji di kota Medan. Dimana kg disbanding 12 kg,” lanjutnya. jutnya sejak Selasa (5/1) konsul- alternatif dan ada juga yang kg,” katanya. saat ini untuk kebutuhan Untuk saat ini, lanjut tan pencacah konversi telah terpaksa menggunakan elpiji. Hal itu dibenarkan Bariah, normal bagi Sumatera Utara Rustam, stok elpiji di Pangkalan melakukan penyisiran ulang di Meski gas ada terjual di pasaran, pedagang kelontong di daerah berkisar 290 MT. “Dengan Susu dan Tandem sekitar 1.100 kota Medan bagi warga yang harganya meningkat 20 s/d 25 Dinas Perindustrian dan Per- perincian per hari untuk elpiji MT, dan besok (Kamis, 7/1) belum mendapatkan paket persen dari harga sebelumnya. dagangan Sumut (Disperindag- 12 kg dan 50 kg sebanyak 150 akan ada tanker Asean Gas perdana tersebut,” ujarnya. “Bagaimana kami tidak su) bahwa dengan ketiadaan MT, 3 kg sebanyak 100 MT, dan dengan membawa elpiji sekitar Dengan kondisi ini, lanjut- panik, elpiji 12 kg kosong. Mi- minyak tanah bersubsidi digan- bulk berkisar 40 MT,” ujarnya. 1300 MT, dan Sabtu (9/1) akan nya, pihaknya akan terus nyak tanah hilang. Kami harus ti dengan subsidi hal itu mem- Sejak Senin dan Selasa, ada juga kapal Gas Sumatera meningkatkan kinerja untuk kemana-mana mencari gas, buatnya mengganti bahan lanjutnya, penyaluran sudah membawa elpiji 1300 MT segera memasok kekosongan harganya pun Rp100 ribu s/d bakar untuk usahanya. Kondisi mencapai 400 MT per hari, berasal dari Instalasi Tanjung bahan bakar minyak (BBM) Rp113 ribu per tabung dengan ini menyebabkan kita memakai sedangkan utnuk hari Rabu (6/ Uban, Kepulauan Riau. Dan ada khususnya bagi daerah yang Waspada/ME Ginting isi 12 kg di tempat eceran se- bahan bakar alternatif, yaitu 1) ini akan ada penambahan juga suplai elpiji juga berasal kekurangan. (m38) MASUK INTI KOTA: Truk pengangkut bahan material melebihi tonase masih bebas melintas dangkan di sejumlah SPBU ber- dengan memakai solar dan di Jalan SM Raja masuk ke inti Kota Medan, Selasa (5/1). Truk melebihi tonase ini merupakan salah harga sekitar Rp95 ribu per ta- bung,” kata Amir seorang pendu- duk Medan Johor, Rabu (6/1). bensin untuk menjadi bahan bakar kompor. Hal itu dilakukan karena Waspada Online Sayangkan satu penyebab terjadinya kerusakan jalan di Kota Medan. Namun, Pemko tidak mampu menindaknya. Dia menyatakan, selain harga yang melambung tinggi, dari sebelumnya Rp79 ribu s/ harga minyak tanah tanpa subsidi yang mencapai Rp8.500 per liter, sedangkan memakai CSR Bukan Prioritas 559.683 Siswa Ikuti UN 2010 d Rp83 ribu per tabung menjadi bensin dan solar hanya Rp4.500 MEDAN (Waspada): Meski Rp113 ribu per tabung juga isi per liter sehingga dapat meng- yang terkandung di dalam hemat dua kali lipat. Corporate Social Responsibility Peserta UASBN 272.327 Siswa atau CSR merupakan tanggung tabung tidak sesuai standar. “Metode pemakaiannya “Ketika dipasang ke kompor adalah dengan menggabung- jawab sosial perusahaan di bi- MEDAN (Waspada): Ber- Disdik Sumut dari 33 kabu- luar biasa (SMPLB) dilaksana- dengan memakai alat pengukur kan keduanya dimana perban- dang sumber daya alam, Was- dasarkan data estimasi Dinas paten dan kota di Sumut. kan pada mulai 29 Maret dan tabung, isi tabung hanya 6,5 kg, dingan empat berbanding satu, pada Online tetap menjalan- Pendidikan (Disdik) Provinsi Dijelaskan Bahrumsyah, ujian susulan 5 April 2010, se- begitu pula ketika diganti hanya walaupun warna sedikit kebiru- kannya sebagai agenda utama Sumatera Utara, jumlah pe- untuk kelulusan UN tahun ini, dangkan untuk ujian ulangan terdapat 7 kg,” ujarnya. biruan namun dapat mengatasi tahun 2010. serta yang akan mengikuti Departemen pendidikan na- 17-20 Mei 2010. Sementara pe- Amir berharap kepolisian mahalnya harga minyak tanah,” Pemimpin Redaksi dan Wa- kil Pemimpin Umum Waspada Ujian Nasional (UN) pada per- sional (Depdiknas) menetap- laksanaan UASBN untuk ting- dan PT Pertamina segera mela- ujarnya. tengahan Maret 2010 di selu- kan empat kriteria kelulusan kat SD/MI dan SDLB pada 4- kukan penyelidikan agar praktik Sedangkan pemeliharaan, Online, Avian Tumengkol, me- manipulasi isi tabung dapat lanjutnya, karena hal ini ter- nyayangkan CSR belum menj- ruh kabupaten/kota di Sumut siswa peserta UN, yakni pene- 5 Mei dan untuk ujian ulangan diungkap. paksa dilakukan, pembersihan adi perhatian di Sumut. sebanyak 559.683 siswa. tapan standar nilai kelulusan tanggal 10-12 Mei 2010. “Kita sangat kecewa setelah kompor dilakukan seminggu “Sangat disayangkan bah- Hal tersebut dikatakan Ke- dengan batas minimal 5,50 Mengenai standarisasi ke- dilakukan konversi ini tidak saja sekali. “Kalau tidak dilakukan wa program CSR di Sumut be- pala Dinas Pendidikan Sumut dan tiga di antaranya berda- lulusan, kata Bahrumsyah, minyak tanah yang hilang dan pembersihan maka kerak yang lum menjadi perhatian perusa- Drs. H. Bahrumsyah, MM di- sarkan penilaian sekolah. rata-rata nilai 5,50 terhadap kini menjadi mahal, elpiji pun ada di dalamnya membuat api haan-perusahaan,” katanya, dampingi Pj. Sekretaris Disdik Pelaksanaan UN 2010 ber- 6 mata pelajaran yang di UN- Rabu (6/1). Sumut Edward Sinaga dan ke- dasarkan Revisi Peraturan kan, minimal nilai 4,00 untuk Waspada Online Ratusan Botol Miras Diamankan Banyak pengusaha, lanjut Avian, yang menganggap bah- Perwakilan CSRDI Waspada Online Bidang Kesehatan, Grace tua pendataan UN Anang Wi- Menteri Pendidikan Nasional dua mata pelajaran dan nilai Setiawan, S.Ked, mengunjungi pasien di RS Pirngadi Medan, baru- bowo kepada wartawan di (Permendiknas) Nomor 84/ 4,25 untuk dua mata pelajaran MEDAN (Waspada): Ratusan botol minuman keras berbagai wa CSR hanyalah menghabis- Kantor Disdik Sumut Jl. T. Cik 2009 yang sebelumnya deng- lainnya dengan ketentuan ni- merek diamankan Polsekta Medan Baru, dalam razia di tiga lokasi baru ini. kan anggaran tanpa meng- Di Tiro Medan, Rabu (6/1). an peraturan Nomor 75/2009. lai mata pelajaran lainnya ha- berbeda. untungkan usahanya. Padahal perusahaan-perusahaan untuk & Development Initiative) Demikian dikatakan Kapolsekta Medan Baru AKP M Adenan Dia menjelaskan, seba- UN untuk tingkat SMA/ rus bisa memenuhi nilai rata- seharusnya bukan itu yang lebih memperhatikan kualitas sangat menilai penting bahwa nyak 559.683 siswa yang akan MA/SMK dilaksanakan pada rata yang telah ditetapkan. Se- AS, SH,SIK kepada Waspada, Rabu (6/1). Menurutnya, razia ini dilaku- esensinya. kehidupan masyarakat yang program CSR bisa mendorong kan terhadap para penjual minuman keras (miras) tanpa izin. mengikuti UN tersebut terdiri tanggal 22-26 Maret menda- dangkan nilai ujian kompetensi “CSR itu adalah kepedulian miskin dan terbelakang. kemajuan masyarakat. atas 247.898 siswa SMA, 63.815 tang dan ujian susulan pada 29 bagi siswa SMK harus 7.00. Lokasi jualan miras terkena razia di Jalan Gatot Subroto, KH Wahid Hasyim, kawasan Petisah. Sementara miras yang diamankan sosial bukan kepentingan usa- “Tentu, pemerintah juga ha- “Maka itu, meski kami siswa SMK dan 247.970 siswa Maret, sedangkan ujian ulangan Bagi siswa dinyatakan ti- antara lain merek Wisky, Vodka, Wisky Peshope. “Polisi selain ha. Tentu akan ada dampak pa- rus serius membuktikan bahwa perusahaan media namun SMP/SMPLB/MTs. Sedang- pada 10-14 Mei 2010. Sekolah dak lulus UN dapat mengikuti menyita miras juga mengambil keterangan pemilik usaha tersebut,” da usaha tapi seharusnya esensi memang tujuan bersama ini tetap kami jalankan program utama adalah nilai sosial peru- menjadi perhatian dan juga sosial demi kepentingan kan untuk SD/MI/SDLB yang Menengah Atas Luar Biasa ujian ulangan, dan yang tidak kata Adenan. akan mengikuti Ujian Akhir (SMALB) UN pada 22-24 Maret lulus penilaian sekolah maka Disebutkannya, razia tersebut dilancarkan sesuai instruksi sahaan,” ujarnya. dijalankan oleh pemerintah masyarakat terbelakang dan Selain itu, pemerintah dae- sebagairole model,” tegas Avian. kemajuan masyarakat Sumut Sekolah Berstandar Nasional sedangkan ujian ulangan kebijakan ujian ulangan seko- Kapoltabes Medan, Kombes Pol Drs Imam Margono. “Razia miras dilaksanakan untuk mengantisipasi gangguan Kamtibmas,” rah juga perlu berperan dalam Waspada Online, lanjutnya, ke depan,” demikian Avian (UASBN) sebanyak 272.327 tanggal 29-31 Maret 2010. lah tersebut ditentukan seko- ungkap Adenan sembari menambahkan kini pihaknya masih mensukseskan CSR di Sumut. melalui pr ogram CSRDI menjelaskan keprihatinannya peserta. Jumlah tersebut ber- Untuk UN SMP/MTs dan lah yang bersangkutan,” jelas mendata lokasi miras.(m31) Pemda harus bisa mendorong (Corporate Social Responsibility terhadap CSR. (m33) dasarkan data yang masuk ke sekolah menengah pertama Bahrumsyah. (m41) Perjuangan Masyarakat Penggarap Terganjal Di BUMN Laporan Aidi Yursal hasil dengan menguasai lahan tanaman produktif, jelas sema- pembentukan Tim Tanah dengan perjuangan kami kare- dengan status kemilikan tanah kin menarik perhatian Menteri gabungan oleh DPRD Sumut, na bagian dari misi pemerin- TUNTUTAN kelompok ma- bersertifikat. Kominfom itu untuk turut beberapa ketua kelompok ma- tahannya; Rakyat tidak lapar, syarakat penggarap untuk Apalagi kini yang menjadi mempelajarinya guna mem- syarakat penggarap seperti Rakyat tidak miskin, Rakyat mendapatkan bagian tertentu Menteri BUMN Dr.Ir.H.Mustafa bantu penyelesaian lahan yang Mahmud Karim dari Binjai, Bu- tidak bodoh, Rakyat tidak sakit lahan PTPN II sudah dianggap Abu Bakar itu adalah putra masih bermasalah itu. ya dari Kabupaten Deliserdang dan Rakyat mempunyai masa berhasil. Karena lahan seluas terbaik bangsa dari etnis Aceh Andaikata Menteri Komin- dan Paeran dari Kabupaten depan,” ucap Karim. 5873,03 hektar yang habis Hak yang juga saudara dan tetangga fom berhasil melunakkan hati Langkat telah menanggapi lain. Mereka dari kelompok Guna Usaha sejak tahun 2000 baik masyarakat Sumatera uta- Menteri BUMN untuk menja- Pada prinsipnya mereka kelom- penggarap itu mengaku bahwa sudah tidak diperpanjang lagi ra, tentu akan semakin mem- wab 14 materi pertanyaan wa- pok penggarap itu menyambut perjuangan mereka untuk men- oleh pemerintah melalui Badan perdalam keyakinan masya- wancara tertulis itu, Waspada baik gagasan pembentukan capai keberhasilan tinggal Pertanahan Nasional (BPN). rakat penggarap. Terutama me- akan memuatnya pada edisi Tim Tanah gabungan itu. selangkah lagi, yaitu menunggu Namun perjuangan mereka nyangkut penyelesaian masa- lain sehingga kelompok masya- Namun mereka meminta agar izin pelepasan aset dari Kemen- belum berakhir. Karena untuk lah lahan eks HGU PTPN II de- rakat menggarap bisa tahu dan tugas tim itu jangan mulai dari terian BUMN. Mereka sangat mendapatkan kepastian hak ngan harapan, Menteri Mustafa memahami dari isi jawaban bawah lagi, tetapi harus sebagai memuji kepemimpinan man- kemilikan tanah bersertifikat Abu Bakar bisa mengeluarkan Menteri BUMN tentang masa- lanjutan dari tugas Tim B Plus tan Gubsu almarhum T.Rizal masih harus melalui proses pe- kebijakan dengan keberpiha- lah lahan eks HGUN PTPN II itu. yang dibentuk semasa Gubernur Nurdin dan Rudolf M Pardede nuh rintangan. Rintangan pa- kan kepada tuntutan dan per- Begitu juga dengan Dewan Sumatera Utara alm T.Rizal karena selama pemerintahan ling dirasakan masyarakat ke- juangan panjang masyarakat Perwakilkan Daerah (DPD) asal Nurdin. Salah satu hasil kerja mereka tercatat sudah lima kali lompok penggarap hingga meng- penggarap. Sumut Parlindungan Purba, Tim B Plus itu adalah menege- menyurati Kementerian BUMN hambat proses lanjutan adalah Begitupun, harapan mereka juga berjanji akan segera me- luarkan ketentuan peruntukan agar bersedia melepaskan aset- ganjalan dari pemilik aset, yaitu kepada Menteri BUMN Mustafa ngadakan rapat dengan DPD kepada masing masing kelom- nya di lahan eks HGU PTPN II, Kementerian BUMN yang ma- Abu Bakar nampaknya bakalan di Jakarta untuk membahas pok penggarap termasuk untuk kendatipun belum membuah- sih tetap bersikukuh pada ke- sulit terwujud apabila masih masalah lahan eks HGU PTPN pemkab Deliserdang dan Kota kan hasil. bijakan untuk tidak menerbit- berjuang dengan menghandal- II itu. “Sebenarnya masalah ini Binjai dan Langkat. Respon Parlindungan Pur- kan izin pelepasan aset pada kan kekuatan sendiri. Untuk itu sudah pernah saya bicarakan “Kita jelas tidak butuhkan ba pun tidak luput dari sikap lahan eks HGU PTPN II itu. mereka sangat memerlukan dengan Sofyan Djalil yang wak- Tim lagi kalau hanya tugasnya pro dan kontra dari kalangan Lahan yang habis HGU itu dukungan melalui peran aktif tu itu menjadi Menteri BUMN, mulai dari bawah yang sudah kelompok penggarap. Sebagai seluas 5873,03 hektar berada dari pihak lain yang punya dan katanya akan membentuk lama disesaikan Tim B Plus orang yang sudah lama per- pada areal perkebunan PTPN pengaruh di pemerintahan. Waspada/Aidi Yursal sebuah perusahaan, PT, untuk yang bertugas selama 2 tahun juang untuk pembebasan lahan II yang berbeda beda, yaitu Apabila dukungan itu benar- Lahan kebun kawasan Desa Petumbak yang sawitnya sudah bermatian dan kini belum jelas menangai pelepasan aset sejak tahun 2000 sampai 2002,” itu, Buya mengaku sangat tidak meliputi kawasan kabupaten benar bisa menyatu dalam statusnya pasca berakhir dan tidak diperpanjang HGU PTPN II, sudah ditanami papaya dan jenis BUMN itu, namun entah kena- kata Mahmud Karim yang setuju apabila ada wacana Deliserdang, Binjai dan Kabu- bentuk satu kekuatan besar tanaman palawija lainnya oleh kelompok masyarakat. pa akhirnya batal, dan Menteri mengingatkan apabila Tim untuk menggiring pihak BUMN paten Langkat. Dari kesemua yang bergerak dari semua arah BUMN sudah berganti dengan Tanah bentukan DPRD Sumut membentuk sebuah perusaha- lahan yang tidak diperpanjang untuk menaklukan apa yang penggarap sudah bagaikan membentuk Tim Tanah yang HGU PTPN II yang berlarut larut Mustafa Abu Bakar,” kata Par- berhasil dibentuk dan tugasnya an khusus yang akan menanga- HGU itu, sebagian besar berada disebut benteng pertahanan kehabisan kamus setelah berba- anggotanya gabungan peme- yang dilatari ganjalan, pihak lindungan Purba yang tadinya mengulangi atau mempersoal- ni aset-aset BUMN, terutama di batas pinggir kota Medan, Kementerian BUMN itu, adalah gai cara dan taktik dilakukan rintah, BPN dan DPRD Sumut. Kementerian BUMN sebagai lebih setuju dengan pembentu- kan tugas Tim B Plus, lebih baik untuk lahan eks HGU PTPN II. atau setidaknya berada pada tidak mustahil, cepat atau dalam mendapatkan izin pe- Hal itu diungkapkan Alamsyah pemilik aset belum bersedia kan perusahaan PT, namun dibubarkan saja tim itu karena Dia mengkuatirkan, apabila radius yang juga bisa diman- lambat, perjuangan masyarakat lepasan aset pada lahan habis Hamdani, SH, anggota Komisi mengeluarkan izin pelepasan dengan pertimbangan lain kini sama sekali akan memperkeruh dibentuk, bukan mempercepat faatkan untuk perluasan ibu- penggarap yang tadinya sudah HGU yang kini sudah dikuasai A DPRD Sumut yang membida- aset pada lahan tersebut. dia lebih menginginkan agar masalah. dan mempermudah penyelesai- kota Sumatera Utara itu. Pun terlanjur termakan tahun, ba- mereka. ngi masalah tanah, bahwa Semula Tifatul melempar- izin pelepasan hak aset itu Apalagi, katanya, anggota an, tetapi sebaliknya akan se- dari semua lahan tersebut ham- kalan merubah menjadi penan- Untuk itu, harapan mereka gagasan pembentukan Tim kan urusan penyelesaian masa- langsung kepada masyarakat. DPRD Sumut periode sekarang makin mempersulit yang ak- pir rata-rata sudah dikuasai tian dalam hitungan detik. mulai ditujukan kepada Tim Tanah itu telah disepakati ketika lah tanah itu kepada Badan Sebagai anggota DPD yang boleh disebut orang-orang baru hirnya memperpanjang perjua- masyarakat penggarap. Malah Kini ada bocoran informasi Komisi II DPR-RI, Komisi A diadakan rapat kerja dengan Pertanahan Nasional (BPN) dan juga dibesarkan karena duku- yang belum mengetahui seluk ngan mereka yang memang mereka juga telah memperoleh yang menyebutkan bahwa pe- DPRD Sumut, Menteri Komuni- pemerintah Sumut dan BPN Kementerian BUMN, tetapi ngan para anggota kelompok beluk perjuangan mereka dari sudah terlanjur panjang. semacam hak dengan memper- nyelesaian lahan tersebut telah kasi dan Informatika, Dewan Sumut sekitar dua bulan lalu. akhirnya dia sangat memahami masyarakat penggarap, Parlin- kelompok penggarap yang su- Apalagi nantinya perusaha- oleh peruntukan dari hasil kerja dimasukkan dalam program Perwakilan Daerah, dan lain- “Pada Januari 2009 sudah ketika disinggung kemungki- dungan mengaku tidak bisa dah dilakukan bertahun tahun, an bentukan BUMN itu mem- Tim B Plus bentukan Gubsu dan 100 hari pemerintahan Presiden lain pihak yang merasa terpang- akan terbentuk Tim Tanah yang nan masalah lahan eks HGU membiarkan perjuangan ma- bahkan puluhan tahun. “Jadi berlakukan pula berbagai ma- BPN. Susilo Bambang Yudhoyono gil dan tergerak hati dalam tugasnya mencari solusi untuk akan menjadi bom waktu bagi syarakat penggarap yang juga Tim Tanah itu sangat tepat di- cam ketentuan dan peraturan Walau sudah tujuh tahun (SBY ) oleh Menteri Negara menyelesaikan masalah lahan menyelesaikan masalah masa- pemerintahan sekarang dan saudara saudaranya itu berla- bentuk apabila tugasnya untuk yang berseberangan misi per- menunggu untuk pelepasan BUMN Mustafa Abu Bakar. Jika yang kini dalam status meng- lah tanah, termasuk lahan eks mendatang apabila tidak segera ma lama, tetapi harus secepat- memohon dan mendesak Men- juangan kelompok penggarap, hak aset dari Kementerian benar informasi itu, dan kepu- ambang dan malah tidak salah HGU PTPN II,” kata Alamsyah dituntaskan. nya diselesaikan. teri BUMN untuk segera mele- terutama menyangkut hitung- BUMN tanpa ada kepastian, na- tusannya sangat berpihak disebut sebagai lahan tidak Hamdani yang turut merasa Apalagi ketika disebut Ke- “Selain saya sendiri dalam paskan asetnya di lahan eks hitungan pelepasan nilai aset, mun masyarakat penggarap kepada masyarakat penggarap, bertuan. prihatin dengan persoalan ta- menterian BUMN itu sangat kapasitas sebagai anggota DPD HGU yang sudah lama kami tentu semakin membuat hati mengaku tidak berhenti ber- itu jelas merupakan bentuk du- Pada kunjungan kerja tim nah di Sumut, khususnya lahan tertutup dalam memberikan akan berjuang untuk itu, tetapi kuasai,” kata Karim yang kem- mereka memberontak, juang. Penggalangan kekuatan kungan langsung dari Menteri Komisi II DPR-RI kunjungan eks HGU PTPN II yang belum informasi kepada pers, terma- akan berupaya menggalang bali menyebutkan hak perun- “Kami ini sudah kepayahan antar sesama kelompok terus BUMN yang sangat mereka kerja ke Kanwil Badan Pertana- jelas status peruntukannya suk permohononan wawancara kekuatan lain untuk sama sama tukan dari Tim B Plus. soal dana, karena sejak berta- dilakukan, namun sayangnya tunggu tunggu. Apalagi duku- han Nasional (BPN) Sumut dan karena masih terkait dengan tertulis ataupun langsung yang menghadap dan memperlunak Dengan belum terbitnya hun tahun atau puluhan tahun belum satupun yang berhasil ngan itu tidak lari dari harapan ke PTPN II Tanjung Morawa aset BUMN. diajukanWapada beberapa hari hati Menteri BUMN Pak Mus- izin pelepasan aset oleh Keme- berjuang, jelas telah menguras menerobos masuk benteng per- mereka, tentu pada akhirnya sekitar akhir 2009 lalu telah Respon lain dalam bentuk lalu kepada Kementerian yang tafa Abu Bakar yang juga bagian neg BUMN, baik Mahmud Ka- tenaga, pikiran dan uang,” kata tahanan kementerian BUMN perjuangan mereka akan me- tercetus gagasan yang lahir pada dukungan dalam penyelesaian berada di bawah Menteri Mus- dari keluarga besar Sumatera rim ataupun Buya dan Paeran Buya yang menggambarkan yang nampaknya sedemikian nuai hasil. Tinggal lagi adalah rangkaian pertemuan. Malah lahan eks HGU itu muncul dari tafa Abu Bakar, Tifatul Sem- Utara agar secepatnya meng- melancarkan kritikan kepada beratnya perjuangan mereka kokoh dibangun sejak semasa proses lanjutan dalam urusan pihak DPR-RI itu sudah mema- Menteri Komunikasi Dan Infor- biring nampaknya seperti tidak ambil keputusan untuk kinerja Gubsu H.Syamsul Arifin, dalam mendapatkan kepastian mantan Menteri BUMN Sofyan administrasi dalam penerbitan sang janji untuk mendesak matika RI Ir.Tifatul Sembiring. bisa menerimanya. menerbitkan izin pelepasan aset SE, sudah 2 tahun memerintah, hak terhadap lahan tersebut. Djalil. sertifikat hak kepemilikan Menteri BUMN agar segera Kendatipun dia tidak menja- “Kalau ada surat ( permoho- itu,” ujarnya serius yang berjanji sampai sekarang belum terlihat Baik Buya, Mahmud Karim Begitupun masyarakat tanah dari BPN. menyelesaikan lahan tersebut. wab pasti bahwa lahan tersebut nan wawancara dengan Ke- akan berjuang sepunuhnya ti keberpihakannya terhadap ataupun Paeran yang menga- penggarap belum habis hara- Namun sebaliknya andai- Dan apabila tidak, bahkan tim akan turut dalam program 100 menterian BUMN Red-) biar tingkat pemerintah pusat. perjuangan kelompok masyara- tasnamakan masyarakat ke- pan. Mereka nampaknya sudah kata informasi itu meleset, Komisi II DPRI-RI itu lebih kon- hari kementerian yang dipim- saya bawa untuk langsung “Ini merupakan PR bagi kat penggarap. Mereka bisa lompok penggarap berharap sejak lama tidak mempersoal- masyarakat penggarap masih sekuen lagi, yakni akan mem- pinnya, namun pada kesempa- disampaikan kepada Menteri saya yang mesti diselesaikan un- membuktikan karena belum kepada pihak-pihak yang ingin kan seberapa panjang perjua- punya harapan dalam memba- berikan sanksi dengan mem- tan acara temu wicara dan BUMN itu,” kata Tifatul Sem- tuk periode ini sebagai hadiah satu pucuk suratpun dilayang- membantu perjuangan mereka ngan yang mesti dilakukan, dan ngun suatu kekuatan besar un- boikot semua rapat dengan silaturahim dengan stake holder biring serius setelah mendengar bagi saudara saudara saya dari kan kepada Kemeneg BUMN agar tidak menghadapkan seberapa besar pikiran, tenaga tuk meruntuhkan kekokohan DPR-RI yang menyangkut Depkominfo di Hotel Grand nama penulis yang berasal dari kelompok penggarap sehingga untuk meminta penerbitan izin mereka kepada persoalan baru, dan dana yang mesti dihabis- “benteng” pertahanan Kemente- masalah BUMN. Angkasa Sabtu (2/1) itu, Tifatul Harian Waspada. Demikian dia punya kepastian hak atas pelepasan aset BUMN di lahan terutama menyangkut dana, kan, namun sasaran mereka ha- rian Negara BUMN, yang sam- Kemudian Komisi A DPRD agak terperanjat ketika diminta pula ketika disinggung masalah lahan yang sudah dikuasai sejak eks HGU PTPN II tersebut. yang apalagi saat ini mereka nya satu, bagaimana perjua- pai sekarang tetap tidak tergo- Sumut pun demikian pula, juga tanggapannya mengenai perbedaan antara hak HGU de- lama itu,” kata Parlindungan. “Sebenarnya Pak H.Syamsul sedang berada dalam kesulitan ngan mereka itu bisa menuai yahkan. Bahkan masyarakat telah menyepakati untuk penyelesaian masalah lahan eks ngan hak aset di lahan tanpa Khusus mengenai gagasan Arifin, SE mesti paham betul ekonomi. (Bersambung)
  • 9. WASPADA Kamis 7 Januari 2010 Medan Metropolitan 11 Pencuri Kerbau Diringkus 164 Tersangka Kasus MEDAN (Waspada): Reskrim Unit Jahtanras Poltabes Togel Masuk Sel Medan mengungkap kasus pencurian hewan ternak berkaki MEDAN (Waspada): Selama setahun, sedikitnya 143 kasus empat yang terjadi, Rabu 7 Oktober 2009 lalu, di kawasan judi toto gelap (togel) berhasil diungkap Reskrim Unit Judi/Sila Pasar XII, Dusun Jambi, Bandar Khalifah, Tembung, Rabu, Poltabes dan mengamankan sedikitnya 164 tersangka terdiri dari (6/1) dinihari. bandar, agen, sub agen dan juru tulis (jurtul). Selain meringkus tersangka Sukardi, 50, warga Pasar 12 Pengungkapan judi togel terbesar ditahun 2009 di Medan, Kebun, Dusun 18 Bandar Khalifah, polisi juga menyita barang adalah pengungkapan praktik judi togel “bilal” dengan menangkap bukti satu ekor kerbau hasil curian dan mobil pick-up BK pengelolanya yang dikenal dengan nama Acu “si ratu togel” yang 9036 CF yang diduga digunakan tersangka untuk mengangkut kini masih menjalani hukuman setelah divonis majelis hakim hewan ternak hasil curian. Pengadilan Negeri (PN) Medan. Kasat Reskrim Poltabes Medan, Kompol Gidion Arif Selain pengungkapan judi togel “bilal”, petugas Reskrim Unit Setyawan, SiK ketika dikonfirmasi melalui Kanit Jahtanras, Judi/Sila Poltabes juga mengungkap jaringan bandar judi togel dengan kode “STM” yang disebut-sebut dikelola oleh oknum AKP Faidir Chan, SH membenarkan penangkapan tersebut. aparat di Simalingkar. “Benar kita ada mengungkap kasus tersebut yang Laporan Permainan judi togel terbesar di Medan ini dapat dibongkar Polisinya (LP) di Mapolsekta Percut Sei Tuan,” kata Faidir. Satuan Reserse Kriminal Poltabes Medan di bawah pimpinan Dijelaskannya, hewan ternak berkaki empat yang dicuri Kasat Reskrim Kompol Gidion Arif Setyawan, SiK dan Kanit Judi/ tersangka milik Huzairi, 42. Tersangka menarik tali pengikat Sila AKP Ronny Nicolaas, SiK. “Pengungkapan ratusan kasus judi kerbau tersebut lalu membawanya pulang. togel tersebut tak terlepas dari peranserta masyarakat yang Sebelumnya hewan ternak berkaki empat tersebut memberikan kontribusi informasi kepada kami,” ujar Ronny. “diangon” pemiliknya di areal perkebunan sawit tak jauh dari Dia menjelaskan, dari ratusan kasus judi togel yang diungkap kediaman korban. Tersangka yang melintas di lokasi itu, sebagian masih dalam proses di Jaksa Penuntut Umum (JPU). melihat kerbau tersebut langsung timbul niat untuk Pada Januari 2009, timnya berhasil mengungkap 10 kasus judi mencurinya. togel dengan tersangka 11 orang, Februari, dua kasus dengan Kemudian dia menarik kerbau itu dan membawanya tersangka dua orang, Maret, 14 kasus dengan tersangka 16 orang, pulang. Tersangka mengaku nekat mencuri kerbau karena April, 9 kasus dengan tersangka 9 orang dan bulan Mei, 20 kasus terlilit hutang. Kerbau itu, menurutnya, diberikan kepada Waspada/Surya Efendi dengan tersangka 24 orang. pemberi hutang. “Dengan menukar kerbau itu, hutang saya SUMUT - HONGARIA: Gubsu H Syamsul Arifin, SE bersama Gubernur Bekes County, Hongaria, Mr Domokos Laseos disaksikan Kemudian Juni, 15 kasus dengan tersangka 17 orang, Juli, 15 lunas pak,” ujar tersangka. Dubes RI untuk Hongaria Mangasi Sihombing (kanan) menandatangani nota kesepahaman (MoU) tentang kerjasama kedua daerah kasus dengan tersangka 15 orang, Agustus, 27 kasus dengan Ditangkap dalam berbagai bidang terutama bidang ekonomi dan budaya di kantor Gubsu Jl. Diponegoro Medan, Rabu (6/1). tersangka 28 orang, September, 14 kasus dengan tersangka 19 Sementara itu di tempat terpisah, Reskrim Unit Jahtanras orang, Oktober, 15 kasus dengan tersangka 20 orang 6 kasus dengan tersangka 6 orang dan Desember, sebanyak 7 kasus dengan jumlah Poltabes Medan juga meringkus seorang buronan Polsekta tersangka yang diamankan sebanyak 7 orang. Sunggal yang disebut-sebut terlibat dalam kasus pencurian dengan pemberatan (curat) di kawasan Jalan Sei Bengawan, Sunggal. Aksi pencurian yang diduga dilakukan tersangka Bobby Wahyudi alias Bobby dilakukan pada 20 Desember 2009. LP Terpidana Demo Anarki Bebas “Semua tersangka yang tertangkap dipersangka dengan pasal 303 KUH-Pidana tentang perjudian. Sampai sekarang ini tim kami masih terus melakukan pemberantasan perjudian di kota Medan,” tegas Ronny. (m39) (laporan polisi) kasus Bobby yang tertuang dalam LP/ 2855/ XII/ 2009/ TBS Sunggal berada di Mapolsekta Medan Sunggal. Hukuman Banyak Berkurang Saat Banding Tewas Akibat Lakalantas Tersangka melakukan pencurian barang berharga milik korban Ruben Simangungsong. (m39) MEDAN ( Waspada): Sebanyak 47 dari 57 oleh hakim tinggi PT Sumut. dengan menjatuhkan huku- MEDAN (Waspada): Abel Tarigan , 40, warga Desa Kinepen, Jatinar Nababan mengakui, man tinggi. Selain itu, untuk Kec. Munthe, Tanah Karo, tewas akibat tabrakan lalulintas di Jalan berkas terpidana kasus demo anarki massa Jamin Ginting Km 50-51 Bandarbaru, Sibolangit, Rabu (6/1) sekira Pencuri Di Tasbi Ditembak pendukung pembentukan Provinsi Tapanuli sebagian besar putusan ban- ding terhadap terpidana turun berkas pelaku utama Chandra Panggabean yang dihukum pk 12.00. Sedangkan sepeda motor korban ringsek. MEDAN (Waspada): Seorang dari lima pelaku pencurian (Protap) sudah masuk ke tingkat banding di dari putusan hakim di PN. delapan tahun penjara, Jatinar Informasi yang diperoleh di lokasi kejadian menyebutkan, spesialis di Kompleks Taman Setia Budi Indah (Tasbi) II Pengadilan Tinggi (PT) Sumatera Utara. Turunnya vonis para terpidana menyatakan berkasnya baru saat itu korban mengendarai sepeda motor Revo BK 5905 SW ditembak polisi kakinya di kawasan Jalan Ringroad dekat di tingkat banding dengan masuk PT Sumut. Ketua PT melintas di Jalan jamin Ginting hendak pulang ke rumahnya setelah perumahan tersebut, Rabu (6/1) dinihari. Humas PT Sumut Jatinar sebagai presiden mahasiswa mempertimbangkan beberapa Sumut belum mendisposisikan menyelesaikan urusan di Medan. Persis di tikungan Amnoy Dari tersangka IG yang menjalani perawatan akibat luka Nababan, kemarin, mengata- Universitas Sisingamangaraja faktor seperti mereka masih hakim yang memegang perkara Bandarbaru, sepeda motor korban tabrakan dengan mobil pick tembak di RS Bhayangkara Poldasu Jalan KH Wahid Hasyim, kan dari 57 berkas yang masuk, XII yang juga pengerah masa muda dan sebagian besar me- banding tersebut. Berkasnya up jenis Eltor Nopol BL 8469 ZW yang dikendarai Iswandi Rusli. disita barang bukti barang hasil kejahatannya. Sedangkan 27 berkas di antaranya lebih dari hukuman 5 tahun penjara rupakan mahasiswa. “Sehingga sudah masuk tetapi ketua PT Akibat tabrakan keras tersebut, tubuh Abel Tarigan terhempas ke empat rekannya yakni K Silitonga, J Sinaga, I Simarmata ringan dari putusan Pengadilan menjadi 3,5 tahun oleh hakim masih punya masa depan yang Sumut belum menunjuk siapa ke ruas jalan. Kondisinya cukup parah akibat luka-luka yang dan R Hutauruk, masih buron dan mereka masuk daftar Negeri Medan. tinggi PT Sumut. Kemudian, cerah untuk memperbaiki ke- hakimnya. Nanti, kalau sudah dideritanya. Sejumlah warga membawa korban ke rumah sakit pencarian orang (DPO). Data yang diperoleh Was- lima mahasiswa atas nama Su- hidupannya,” kilahnya. keluar hasilnya akan diberitahu. terdekat, namun di perjalanan meninggal dunia. Kapolsekta Medan Sunggal, AKP Faisal F Napitupulu, pada dari PT Sumut, pengura- priandi Hutapea dan kawan-ka- Selain itu, sebagian besar Akan Tentukan Sikap Sebab-sebab terjadinya kecelakaan itu sudah ditangani SH.SIK kepada Waspada mengatakan, ditangkapnya tersangka ngan jumlah masa tahanan itu wan, yang diawali persidangan terpidana juga sudah berada Sementara, Kepala Seksi Pe- pada usia lanjut, di mana putu- nerangan Hukum (Kasipen- Satlantas Poltabes Medan Pos Pancurbatu pimpinan Ipda Aben berkat informasi dari warga melalui SMS yang memberita- jauh lebih ringan dari putusan di PN dihukum lima tahun san tinggi yang dijatuhkan oleh kum) Kejaksaan Tinggi Sumut Ginting. Dua kenderaan berlainan jenis yang mengalami lakalantas hukan keberadaan salah seorang dari komplotan pencuri yang dijatuhkan majelis hakim berkurang menjadi 2,5 tahun di tingkat PN. Dari 27 berkas itu, penjara. majelis hakim PN sangat mem- Edi Irsan Kurniawan Tarigan tersebut sudah diamankan polisi. Iswandi Rusli, 31, warga itu berada di kawasan Jalan Ringroad dekat kompleks Tasbi. Lhokseumawe Aceh, pengemudi eltor menyerahkan diri ke Pos Polisi yang mendapat informasi langsung turun ke lokasi 32 terpidana sudah diputus Bahkan, dari pengurangan beratkan. Bahkan, ada pula menerangkan, pihaknya baru majelis hakim PT. ini ada beberapa terpidana yang yang sudah sakit-sakitan. menerima pemberitahuan pu- Lantas Pancurbatu setelah kejadian. (cat) dipimpin Kanit Reskrim Iptu Anthoni Simamora meringkus tersangka IG. Namun, saat dibawa dalam pengembangan Salah satunya terpidana sudah bisa menghirup udara “Menderita penyakit jan- tusan banding dari PT Sumut. kasus untuk menangkap ke empat rekannya, tersangka IG mencoba melarikan diri dan terpaksa ditembak kakinya. yang mendapatkan pengurang- an sangat signifikan adalah bebas, seperti Djumongkas Hu- tagaol dari dua tahun menjadi tung, sudah di by pass, jadi perlu perawatan. Jadi, kita memper- Pihaknya masih akan mem- pelajari putusan tersebut. Kuliah Perdana Magister UPMI Dalam kondisi luka tembak, tersangka dievakuasi ke RS koordinator aksi demo anarki, delapan bulan penjara. Selain timbangkan semua aspek “Dalam waktu dekat akan MEDAN (Waspada): Koordinator Kopertis Wilayah I Zainuddin Bhayangkara Poldasu dan hasil kejahatannya dibawa ke Gelmok Samosir. Dari enam itu, terpidana yang sebelumnya dalam menentukan putusan menentukan sikap. Apakah akan memberikan orasi ilmiah sekaligus membuka kuliah perdana Polsekta Medan Sunggal, sebagai barang bukti. tahun penjara yang diputus menjabat Ketua DPP Partai ini, “ jelasnya. akan mengajukan kasasi atau bagi 95 mahasiswa Universitas Pembinaan Masyarakat Indonesdia oleh PN menjadi 1,5 tahun Peduli Rakyat Nasional Pustaha Dia mengatakan, hukuman tidak. Sebab, waktunya itu 14 (UPMI) Program Pascasarjana Magister Ilmu Administrasi di Hotel Sedangkan, korban terakhir yang rumahnya dijarah para Madani Jalan SM Raja Medan, Sabtu (16/1). kawanan pencuri tersebut adalah Padriadi Wiharjo Kusumo diputus banding PT Sumut. Nurdin Manurung, dari 1,5 yang lebih ringan juga telah hari setelah putusan banding Terpidana Anju Mangasi tahun putusan yang ditetapkan memberi efek jera kepada para kami ter ima,” demikian Pembantu Rektor I UPMI Medan Ali Mukti Tanjung didampingi SS, SH, warga Tasbi II Blok III Medan, yang sudah membuat staf Abdul Karim dan Saimun mengatakan kepada Waspada di pengaduan ke Polsekta Medan Sunggal sesuai No: LP/33/ Naibaho, dalam aksi tercatat PN menjadi 10 bulan 15 hari terpidana. Katanya, tidak perlu Tarigan. (h05) Kampus 1 UPMI Jalan Teladan Medan, Selasa (5/1). 1/2010, kata Faisal. (m31) Menurut Mukti, ke-95 mahasiswa tersebut telah resmi Briptu DTS Positif Anggota Dewan Jalan Kaki mendaftar pada Program Magister Ilmu Administrasi di UPMI yang telah memperoleh izin penyelenggaraan berdasarkan SK Departemen Pendidikan nasional Direktorat Jenderal Pendidikan Konsumsi Narkoba Jemput Pergub Pupuk Tinggi (Dirjendikti) No.1705/D/T/2009. Pendirian Program Studi Magister Ilmu Administrasi adalah suatu program Magister yang mampu memberikan bekal MEDAN (Waspada): Terbukti mengkonsumsi Narkoba jenis daun ganja kering, Briptu DTS , anggota Polsekta Medan MEDAN (Waspada): Karena pimpinan PT. Pusri, Rinaldi, menuding Gubsu tidak serius, Taufan Agung Ginting, Wa- kemampuan dan keterampilan untuk memiliki kompetensi di Pergub (Peraturan gubernur) mengatakan penyaluran pupuk padahal itu kerjanya biro. Kalau shington Pane, Richard Lingga bidang aplikasi dan keahlian administrasi pelayanan publik. Kota, terancam dipecat dari insititusi kepolisian. Sesuai hasil “Sistem pendidikan meliputi kuliah diselenggarakan secara tes urine, Briptu DTS positif telah mengkonsumsi ganja. pengadaan dan penyaluran bersubsidi ke kabupaten/kota rapat ini dilanjutkan, dengan mengusulkan, Komisi B lang- pupuk Urea bersubsidi tidak untuk tahun 2010 terkendala tidak mengurangi rasa hormat, sung menemui Gubsu, karena intensif dengan sistem Kredit Semester dengan metode belajar “Sesuai hasil pemeriksaan di laboratorium forensik, air mengajar partisipatif serta memanfaatkan berbagai teknik,” ujarnya. seni oknum polisi itu dinyatakan positif, sedangkan lembaran kunjung diterbitkan, anggota karena belum juga diterbitkan- hargai pendapat saya untuk me- keputusan ada di tangan orang Kepada 95 mahasiswa yang telah terdaftar dapat hadir hasil tes masih dijemput di Labfor,” jelas Kapolsekta Medan Komisi B DPRD Sumut lang- nya Pergub. ninggalkan rapat ini,” ujarnya. nomor satu di Sumut itu. “Kita mengikuti pembukaan kuliah perdana ini. (m25) Area, AKP Juliani Prihatini, SIK kepada Waspada, Rabu (6/ sung mendatangi Gubsu Syam- Mendengar paparan itu, Sempat terjadi perdebatan tidak perlu datangi Biro Per- 1) siang, di Mapolsekta Medan Area. sul Arifin menjemput Pergub anggota Komisi B DPRD Sumut, antar Bustami dengan pimpi- ekonomian seperti diusulkan Dijelaskan Juliani, berkas pemeriksaan terhadap Briptu tersebut. Mereka berjalan kaki Bustami, langsung meminta nan rapat, M.Nasir, yang meno- Bustami, tapi kita langsung ke Jadwal Penerbangan Di Bandara Polonia DTS akan rampung dan segera diserahkan kepada pimpinan dari gedung dewan Jalan Imam rapat tidak usah dilanjutkan dan lak rapat dihentikan karena su- Gubsu bersama PT Pusri. Kalau Bonjol Medan ke kantor Gubsu mendatangi langsung Biro Per- dah berjalan. Dia tetap melan- perlu kita jalan kaki ke kantor No. Penerbangan Ke Flight Pukul Tiba Dari Fliht Pukul berikut barang buktinya selinting daun ganja kering hasil sisa pemakaian dari tersangka. Jalan P. Diponegoro Medan. ekonomian Pemprovsu untuk jutkan rapat sembari Sekretaris Gubsu,” ujar Washington dari GARUDA INDONESIA Briptu DTS ditangkap langsung oleh Kapolsekta Medan Tindakan mendatangi mempertanyakan soal belum Komisi B, Aduhot Simamora, PPRN itu. 1 Jakarta GA-181 06.25 Jakarta GA-180 06.10 Area, AKP Juliani, saat sedang duduk-duduk di lantai II Blok langsung Kantor Gubsu itu diterbitkannya Pergub penga- menghubungi Kabiro Pereko- Akhirnya dengan dipimpin 2 Jakarta GA-183 09.05 Jakarta GA-182 08.00 disepakati dalam rapat dengar daan dan penyaluran pupuk nomian, Bangun Oloan agar M. Nasir, Komisi B DPRD Sumut 3 Jakarta GA-185 10.55 Jakarta GA-184 09:30 A-7 Rumah Susun Sukaramai, Sabtu (2/1) sekira pk 11:00. 4 Jakarta GA-187 12.25 Jakarta GA-186 10.50 Lokasi rumah susun tersebut hanya beberapa puluh meter pendapat Komisi B DPRD bersubsidi. menghadiri rapat dan menje- beserta PT. Pusri sepakat berja- 5 Jakarta GA-189 13.45 Jakarta GA-148 11.50 dari Pos Polisi Polsekta Medan Area di komplek perumahan Sumut dengan PT Pusri wilayah “Kita yakin, pergub itu ma- laskan soal pergub pengadaan lan kaki ke Kantor Gubsu. Da- 6 Jakarta GA-191 15.45 Jakarta GA-188 12.50 Asia Mega Mas. Sumut di gedung dewan, yang sih tertahan di Biro Perekono- pupuk. Namun Kabiro Pereko- lam pertemuan itu, Gubsu ber- 7 Jakarta GA-193 17.10 Jakarta GA-190 14.10 Awalnya, kata Juliani, pihaknya mendapat informasi ada dipimpin Wakil Ketua Komisi mian. Diyakini surat itu belum nomian ternyata sedang berada janji akan menandatangani Per- 8 Jakarta GA-147 18.10 Jakarta GA-192 16.15 B DPRD Sumut, M. Nasir, Rabu ada ditangan Gubsu atau Wa- di Jakarta . gub pengadaan dan penyaluran 9 Jakarta GA-195 19.10 Jakarta GA-196 19.35 lokasi permainan judi di rumah susun tersebut. Saat AKP 10 Jakarta GA-146 14.45 Jakarta GA-147 16.30 (6/1). Dalam pertemuan itu gubsu, tapi masyarakat akan Anggota Komisi B lainnya: pupuk bersubsidi.(h11) Juliani dan beberapa personelnya naik ke lantai II menemukan tiga orang pria yang belakangan diketahui bernama Briptu AIR ASIA DTS dan dua teman sipilnya bernama Fer, 22, warga Jalan 1 Kuala Lumpur AK- 937 08.50 Kuala Lumpur AK-936 08.25 2 Kuala Lumpur QZ- 8054 09.40 Kuala Lumpur QZ-8055 11.55 AR Hakim dan Ind, 21, warga Jalan Selam I, Kel. Tegal Sari Mandala. Setelah dipergoki mengisap rokok bercampur ganja, Briptu Ratih Mengeluhkan 3 Kuala Lumpur 4 Kuala Lumpur 5 Penang AK- 457 AK-939 QZ-8074 18.00 20.10 16.05 Kuala Lumpur Kuala Lumpur Penang AK-456 AK-938 QZ-8075 17.40 19.40 18.05 DTS buru-buru menggenggam lintingan rokoknya. Berkat kejelian Kapolsekta, akhirnya DTS yang telah sebulan disersi digelandang ke sel Polsekta Medan Area berikut satu linting Kinerja Dokter RS Adam Malik 6 Jakarta 7 Jakarta 8 Jakarta QZ-7497 QZ-7503 QZ-7505 12.20 13.30 18.40 Jakarta Jakarta Jakarta QZ-7496 QZ-7502 QZ-7504 19.15 13.05 15.40 rokok becampur ganja. Akibat perbuatannya itu, ketiga PASIEN penderita pe- Dia berharap kepada para RSUP HAM, drg. Atma Wijaya saat ini dokter masih mela- MANDALA AIRLINES tersangka dijerat pasal 119 sub 120 sub 121 nomor 35 UU nyakit kelainan tulang atau tim dokter agar serius mena- mengatakan, pasien ini adalah kukan pemeriksaan ulang 1 Padang RI 089 17.20 Padang RI-088 15.45 tahun 2009 tentang penggunaan dan kepemilikan narkotika atrofi, Ratih Syafitri, 22, nganinya, jangan sepele. “Ja- termasuk yang paling diperha- atas pemeriksaan sebelum- dengan ancaman hukuman 12 tahun penjara. (cat) warga Pematang Sian-tar ngan karena saya pasien tikan,karena ini penyakit langka. nya pada Ratih. LION AIR 1 Jakarta JT- 381 06.30 Jakarta JT-380 08.20 mulai mengeluhkan kinerja jamkesda, mereka kurang Makanya, kata Atma, pi-hak “Masih ada pemeriksa- 2 Jakarta JT- 397 09.00 Jakarta JT-398 09.20 Uji Coba Sidang Pidana dokter RSUP H. Adam Malik Medan. Pasalnya, sudah satu perhatian,” ucapnya. Paling Diperhatikan RS. Adam Malik mema- sukkannya dalam rapat pem- an lanjutan lagi yang harus dijalani pasien. Baru setelah 3 Jakarta 4 Jakarta JT- 301 JT- 395 10.00 11.00 Jakarta Jakarta JT-394 JT-302 10.20 11.20 5 Jakarta JT- 303 12.00 Jakarta JT-398 10.45 Dua Kali Seminggu bulan lebih berada di rumah sakit pemerintah tersebut, Kabag Hukum dan Humas bahasan. Hanya saja, sampai itu kemungkinan dokter sudah dapat diagnosa pasti 6 Jakarta 7 Jakarta JT- 399 JT- 383 13.45 15.35 Jakarta Jakarta JT-382 JT-384 13.05 14.55 MEDAN (Waspada): Awal tahun 2010, Pengadilan Negeri kondisinya sama saja ketika atas penyakit pasien. Diag- 8 Jakarta JT- 385 17.05 Jakarta JT-396 16.25 Medan memberlakukan sidang pidana yang biasanya digelar pertamamasukkeRStersebut. nosa sementara dari dr Dar- 9 Jakarta JT- 387 18.35 Jakarta JT-306 19.35 lima hari dalam seminggu, kini menjadi dua hari. “Sudah satu bulan saya ma Lindarto SpPD (K)EMD 10 Jakarta JT- 305 21.15 Jakarta JT-386 21.35 di sini sama sekali belum adalah Osteogenesis Inper- 11 Jakarta JT-309 22.25 Jakarta JT-308 23.20 “Ya, program ini sedang diuji coba. Tujuannya untuk 12 Batam/S.baya JT-972 12.55 Batam/S.baya JT-971 12.20 ada perubahan. Pinomat- fecta atau pengkroposan tu- memfokuskan persidangannya,” kata Humas PN Medan kan saya sudah bisa duduk, lang. Tapi diagnosa itu masih 13 Banda Aceh JT-396 19.35 Banda Aceh JT-397 08.20 Laurensius Sibarani, Senin (4/1). 14 Penang JT-8288 09.10 Penang JT- 8289 11.35 tapi sampai sekarang juga muda, jadi kami harus ber- 15 Penang JT-8286 12.30 Penang JT-8287 15.00 Saat ini PN Medan memiliki 15 ruang sidang. Sedangkan belum. Sudah tiga kalipun hati-hati menangani pasien jumlah hakim sebanyak 33 orang. Jika diberlakukan secara saya pindah kamar di sini. ini, tidak terburu-buru. Ini MALAYSIA bersamaan seluruh persidangan setiap harinya, maka Dokter hanya memeriksa, penyakit langka. Jadi tidak- 1 Kuala Lumpur MH-861 09.05 Kuala Lumpur MH-860 08.25 merepotkan majelis hakim dalam mengatur waktu untuk tapi belum ada resep atau lah hanya waktu satu bulan 2 Kuala Lumpur MH-865 15.25 Kuala Lumpur MH-864 14.45 memimpin persidangan. Sementara, jumlah kasus dan perkara kepastian tentang penyakit menyembuhkan pasien ini, SILK AIR yang akan disidangkan mencapai ratusan setiap harinya. saya ini,” kata Ratih, di butuh waktu panjang. La- 1 Singapura MI-233 08.40 Singapura MI-232 07.50 “Untuk itu, ini dicoba dulu sejauh mana efektivitasnya,” Ruang Rindu A RSUP HAM, gian di sini gizinya kita jaga,” 2 Singapura MI-237 20.35 Singapura MI-238 19.50 katanya. Rabu (6/1). sebut Atma. Laurensius mengungkapkan, khusus untuk perkara pidana Dengan kondisi yang Berita Waspada sebe- VALUAIR 1 Singapura (4,7) VF-582 08.30 Singapura (4.7) VF-581 07.50 umum dijadwalkan akan bersidang di hari Selasa dan Kamis. hanya bisa berbaring di atas lumnya, Ratih adalah war- 2 Singapura (1,3,6) VF-584 20.45 Singapura (1,3,6) VF-583 20.00 Sedangkan, Senin, Rabu, dan Jumat akan diisi dengan sidang tempat tidur saja, Ratih me- ga Serdang Kel. Martoban perdata, persidangan hubungan industrial, serta persidangan ngaku malu kepada tetang- Kec. Siantar Utara Pema- BATAVIA AIR lainnya. ganya di P .Siantar. “Kalau tang Siantar. Penyakitnya itu 1 Jakarta 7P-592 10.10 Jakarta 7P-591 09.35 terus seperti ini, saya malu menjadikan tubuhnya se- 2 Jakarta 7P-598 12.50 Jakarta 7P-597 12.15 “Kalau ada juga nanti di tengah perjalanan ternyata 3 Jakarta 7P-594 15.50 Jakarta 7P-593 15.15 terbentur masa penahanan, tidak bisa dua kali seminggu, pulang. Ngapain jauh-jauh makin mengecil. Yang se- 4 Jakarta 7P-596 19.10 Jakarta 7P-595 18.25 maka bisa dilakukan setiap hari. Makanya, dilihat dulu sejauh di bawa ke sini kalau begini mula tingginya 160 cm, kini 5 Batam 7P-568 13.00 Batam 7P-567 11.05 terus. Bagusan saya di menjadi 110 cm. Karena ke- mana efektivitasnya ini,” terangnya. Diharapkan kebijakan rumah,” ucapnya. tiadaan biaya, oleh orang- SRIWIJAYA AIR baru ini bisa memfokuskan persidangan perkara yang ada Jika dalam dua atau tiga tuanya dia hanya dibawa 1 Jakarta SJ-015 10.20 Jakarta SJ-010 11.50 di PN Medan. minggu ini belum ada peru- berobat alternatif. Penyakit- 2 Jakarta SJ-011 15.30 Jakarta SJ-016 18.35 Sementara kebijakan baru ini disikapi berbeda oleh para 3 Jakarta SJ-017 19.10 Jakarta SJ-014 20.15 bahan, Ratih ingin minta Waspada/Mursal AI nya ini juga memaksa dia 4 Batam SJ-035 15.05 Jakarta SJ-034 14.30 jaksa dan pengacara yang mendampingi terdakwa di pulang balik ke kampung BERBARING: Sampai saat ini kondisi kesehatan Ratih belum harus berhenti sekolah sejak 5 Pekanbaru SJ-041 15.20 Pekanbaru SJ-140 15.25 persidangan. Satu sisi, para jaksa menyambut baik kebijakan halamannya. “Saya siap ada perubahan. Dia hanya bisa berbaring. Agar menghilangkan 2008 lalu. Karena penyakit- 6 Banda Aceh SJ-010 11.30 Banda Aceh SJ-140 14.20 ini, di sisi lain, sistem ini akan membuat repot mendampingi apapun keputusan dokter,” rasa suntuk dan penat, hari-harinya di RS. Adam Malik selalu nya ini dia harus berbaring 7 Penang SJ-102 07.20 Penang SJ-103 09.35 para terdakwa. (h05) ujarnya. dilalui dengan mengisi TTS. Foto diambil Rabu (6/1). di atas kasur.(cmai) 8 Padang SJ-021 16.00 Padang SJ-020 14.45 (m32)
  • 10. 12 WASPADA Opini Kamis 7 Januari 2010 Lanjutkan Pembangunan Serdang Bedagai paten Serdang Bedagai sebagai salah Kesehatan lalui penyuluhan, bantuan modal, al- satu kabupaten terbaik di Indonesia Di bidang pembangunan kesehat- sintan, bibit/benih, bantuan pestisida dengan masyarakatnya yang Pancasi- an dilakukan melalui peningkatan dan obat-obatan, bantuan ternak sapi lais, religius, modern dan kompetitif. kualitas dan jangkauan pelayanan ke- dan kambing serta pembangunan ja- Kami menyadari untuk mewujudkan sehatan dengan pembangunan sarana ringan irigasi tingkat usaha tani, ja- visi itu, tidak dibutuhkan ”Superman” fisik dan fasilitas kesehatan.. ringan irigasi desa, jalan usaha tani, akan tetapi yang diperlukan ada- Sejak tahun 2005 hingga 2009, 30 optimalisasi lahan, pembangunan lum- lah”Super Tim”. Artinya yang diutama- unit Puskesmas telah direhabilitasi bung pangan, lantai jemur dan ban- kan adalah kebersamaan dan kerja ke- termasuk 65 unit Puskesmas pemban- tuan penguatan modal bagi delapan ras dari semua pihak, baik aparatur tu. Selain itu telah dibangun Rumah (8), lembaga usaha ekonomi pedesaan maupun masyarakat. Oleh karena itu Sakit Umum Daerah Sultan Sulaiman, (UEP) sebesar Rp1,9 miliar. di awal masa pemerintahan, kami be- 4 unit Puskesmas, 7 unit Pustu dan 63 Untuk pemberdayaan dan pe- kerjasama dengan pihak ketiga mela- Pos Kesehatan Desa, penambahan te- nguatan lembaga kelompok tani Kabu- kukan fit and proper test dan pening- naga medis dan peningkatan penye- paten Serdang Bedagai, pemerintah TAJUK RENCANA katan capacity building bagi para peja- bat dan calon pejabat untuk memper- diaan obat-obatan. Dengan adanya RSU Sultan Sulai- memberikan bantuan program pe- ngembangan usaha agribisnis perde- Oleh HT Erry Nuradi oleh sumberdaya aparatur yang benar- man, masyarakat Serdang Bedagai saan (PUAP sebesar Rp5,6 miliar di 56 benar mempunyai kemampuan untuk sudah dapat melakukan pemeriksaaan desa dengan bantuan sebesar Rp100 menjalanakan amanah rakyat sesuai kesehatan tanpa harus ke luar kota. juta per desa. Jangan Sampai Kemana-mana T idak terasa usia Kabupaten Ser- dang Bedagai kini mencapai 6 tahun. Bila dibanding kabupa- ten/kota lainnya, maka Kabupaten tugas pokok dan fungsinya. Dengan keterbatasan yang ada, kita telah berupaya sekuat tenaga un- tuk membangun Kabupaten Serdang Di sektor infrastruktur sampai ta- hun 2009 telah dilakukan pembangun- an jalan alternatif untuk mengurangi kemacetan di Kota Perbaungan dan Di sektor perikanan telah dilaksa- nakan pembangunan Balai Benih In- duk (BBI), ikan tawar di Desa Melati II, Kecamatan Perbaungan, pemba- P emerintah Provinsi Sumatera Utara tahun 2010 menerima Serdang Bedagai adalah kabupaten Bedagai. Sejak tahun 2005 – 2009, di peningkatan jalan sepanjang 167,925 ngunan Tambat Labuh di Kecamatan yang relatif muda, tentunya Serdang sector pendidikan kita telah melaku- km, pemeliharaan jalan sepanjang Tanjung Beringin, kegiatan PLBM di Daftar Isian Pelaksanaan Anggaran (DIPA) dari pemerintah Bedagai memiliki ketebatasan-keter- kan perbaikan sarana dan prasarana 73,092 km, pembangunan jalan sepan- Desa Kota Pari, Kecamatan Pantai Cer- sebesar Rp24,098 triliun. Alokasi dana APBN 2010 untuk batasan, baik sumberdayanya, infras- sekolah seperti rehab SD negeri/swas- jang 36,886 km, pembangunan jem- min, bantuan bibit ikan, alat tangkap, Sumut itu meningkat tiga persen dibanding 2009 sebesar truktur maupun dana. ta sebanyak 434 sekolah (2.569 ruang), batan sepanjang 378 meter, peningkat- rumpon dan transplantasi trumbu ka- Namun demikian sudah menjadi rehab SMP negeri/swasta 45 sekolah an jembatan sepanjang 682 M. dan rang di Pulau Berhala, untuk mening- Rp23,379 triliun. tekad kita bersama untuk dapat me- (138 ruang) dan rehab SMA dan SMK pemeliharaan jembatan sepanjang katkan pengawasan beroperasinya pu- Penyerahan DIPA 2010 ke Sumut itu dilakukan langsung Presiden wujudkan cita-cita luhur pemekaran negeri/swasta 22 sekolah (52 ruang) 179 M. Pembangunan jaringan irigasi kat harimau di perairan Kabupaten yaitu meningkatkan kesejahteraan dan serta membangun 29 unit sekolah ba- sepanjang 34,027 km, peningkatan iri- Serdang Bedagai, telah diadakan kapal Susilo Bambang Yudhoyono kepada Gubsu Syamsul Arifin di Istana pelayanan kepada masyarakat melalui ru di antaranya 10 unit SMA negeri se- gasi sepanjang 36,250 km dan peme- pengawas dan motor boat. Negara Jakarta, Selasa (5/1). Selain kepada Sumut, DIPA 2010 juga pembangunan di segala bidang jak Indonesia merdeka sampai tahun liharaan irigasi sepanjang 151,786 km, Di sektor kehutanan dan perke- diserahkan kepala negara kepada gubernur dari 32 provinsi lainnya. Kabupaten Serdang Bedagai meru- 2005 jumlah SMA negeri yang ada ha- pembangunan infrastruktur TPA 3 bunan telah dilakukan gerakan pena- pakan kabupaten agraris. Dari luar wi- nya 7 sekolah. Saat ini kita memiliki unit, pembangunan pasar desa/kios naman one man dan one tree yang be- Syamsul melalui Kepala Dinas Kominfo Sumut Eddy Syofian dari Jakarta layah ±190.000 hektar, hamper 100.000 17 SMA negeri dan diharapkan pada sebanyak 10 unit , pembangunan pa- kerjasama dengan kelompok-kelom- menjelaskan, DIPA Sumut 2010 sebesar Rp 24,098 triliun itu terdiri dari hektar adalah areal perkebunan, baik tahun 2010 semua kecamatan sudah gar dan taman kota sebanyak 26 unit. pok masyarakat, perusahaan, peme- alokasi dana untuk Kementerian Negara/Lembaga (termasuk dana BUMN, swasta asing, swasta nasional memiliki SMA negeri. Permukiman berupa bantuan rehab rintah provinsi dan pusat dan pusat. maupun kebun rakyat. Dan ± 41.000 Sesuai dengan Perda Nomor 31 ta- rumah tidak layak huni sebanyak 42 Untuk bidang perkebunan telah dila- Dekonsentrasi dan Tugas Pembantuan) sebesar Rp 11,04 triliun. Dana hektar merupakan lahan sawah dan hun 2007, Pemerintah Kabupaten Ser- unit, penyediaan air bersih dan pem- kukan optimalisasi lahan kebun rakyat Alokasi Umum (DAU) dan Dana Alokasi Khusus (DAK) Rp13,058 triliun. ± 42.000 hektar lahan kering berupa dang Bedagai pada tahun 2008 telah bangunan kantor camat 10 unit, pem- dengan komoditi kelapa sawit dan ka- “Dari DIPA Sumut 2010 Rp24,098 triliun itu, Dana Bagi Hasil (DBH) tegalan/kebun dan ladang huma, ser- melaksanakan program wajib belajar bangunan rumah dinas camat 7 unit, ret dan pembuatan jalan produksi, pe- ta± 60 persen Penduduknya bermata 12 tahun, dengan harapan ke depan kantor kepala desa dan stadion mini. ngembangan bibit unggul melalui pe- Pajak dan Sumber Daya Alam (SDA) belum termasuk di dalamnya. pencaharian dari sektor pertanian. masyarakat Serdang Bedagai minimal Melalui program TNI Manunggal nangkar-penangkar dan kebun entres Karena dua dari empat komponen dana daerah itu, hanya diberikan Kabupaten Serdang Bedagai meru- dapat menyelesaikan pendidikan sam- Membangun Desa ( TMMD) telah di lahan masyarakat. sebesar Rp13,058 triliun,” jelas Eddy. pakan salah satu daerah penghasil pai SLTA. dibuka jalan baru sepanjang 3.705 me- Di sektor pariwisata upaya yang beras di Sumatera Utara dan membe- Untuk meningkatkan SDM masya- ter dan lebar 8 meter, pembuatan dan telah dilakukan antara lain penataan DIPA Sumut 2010 ini lebih besar tiga persen dibandingkan 2009 rikan sumbangan surplus beras bagi rakat Serdang Bedagai sampai ke jen- rehabilitasi jembatan, pembuatan go- sarana dan prasarana objek wisata de- sebesar Rp23,379 triliun, terdiri dari alokasi dana untuk Kementerian Provinsi Sumatera Utara rata-rata se- jang perguruan tinggi, telah ditandata- rong-gorong, pemasangan pipa salur- ngan memanfaatkan panjang garis Negara/ Lembaga (termasuk dana Dekonsentrasi dan Tugas Pem- tiap tahunnya mencapai 125.000 – ngani kerjasama dengan USU, UNI- an air bersih sepanjang 1.850 meter, pantai 95 km dan pulau terluar (Pulau 130.000 ton. MED dan IAIN. Tindaklanjutnya setiap pembuatan bak penampungan air Berhala) sebagai kawasan wisata baha- bantuan) Rp11,076 triliun, serta DAU dan DAK minus DBH Pajak dan tahun sebanyak 48 orang lulusan SLTA bersih, sehingga Desa Meriah Nagur ri berwawasan lingkungan, pengem- SDA Rp12,303 triliun. Kabupaten Terbaik Serdang Bedagai diterima di USU tan- dan Desa Rimbun yang selama ini ter- bangan wisata alam seperti wisata Batu Untuk mewujudikan cita-cita pe- pa tes, 35 di UNIMED dan 25 di IAIN.. tinggal dan terisolir diharapkan ke de- Nongol dan Ancol, wisata religi antara Bahkan jumlah DIPA Sumut 2010 itu jauh lebih besar dibanding mekaran sesuai dengan potensi yang Kerjasama juga dilakukan dengan pan menjadi desa yang lebih maju ka- lain Masjid Sulaimaniyah Perbaungan, DIPA 2008 sebesar Rp22,384 triliun, terdiri dari alokasi dana untuk dimiliki cita-cita pemekaran sesuai de- Dirjen Pendidikan Agama Islam dalam rena akses transportasi telah dibuka. Masjid Jamik Ismailiyah di Kecamatan Kementerian Negara/ Lembaga (ter- ngan potensi yang dimiliki itu, sejak rencana pembangunan madrasah ber- Di sektor pertanian telah dilakukan Tanjungberingin, Pura Hindu Bali di Ke- pencalonan kami sebagai Bupati dan taraf internasional di Kecamatan Pega- revitalisasi pertanian untuk dapat me- camatan Pegajahan serta wisata kuliner masuk dana Dekonsentrasi dan Tugas Wakil Bupati bersama H Soekirman jahan dengan dana dari Departemen ningkatkan dan mempertahakan swa- di Pasar Bengkel dan Sergai Walk. Intisari Pembantuan) Rp8,805 triliun serta tahun 2005, telah disusun visi yang Agama. sembada pagan, meningkatkan pen- DAU dan DAK minus DBH pajak dan ingin dicapai yaitu menjadikan Kabu- dapatan dan kesejahteraan petani me- (Berlanjut ke hal 13) Anggaran dana dari SDA Rp13,579 triliun. Tentu saja penerimaan DIPA ini pemerintah pusat kalau kita sambut baik dan harus disyukuri. tidak dikorupsi tentu- Bagaimanapun juga daerah masih Peran Waspada Dalam Pembangunan Kesehatan nya akan memberi ke- bergantung kepada pusat dalam hal pendanaan. Dan yang seharusnya mengambil langkah terdepan sebagai biasaanpadaanakdidiksekolahagarselalu Oleh Dr.Candra Syafei, Sp.OG penggerak masyarakat di bidang pemba- menjaga anggota badannya senantiasa untungan bagi rakyat. dilakukan pemerintah daerah adalah ngunan kesehatan. bersih khususnya tangan. Gerakan ini mendorong kemandirian masyarakat Kenapa demikian ? karena selama ini menggunakannya sesuai dengan P elaksanaan upaya kesehatan di swasta dalam bidang kesehatan. yang menjadi permasalahan kesehatan untuk berperilaku hidup bersih dan sehat alokasinya. Harus diingat banyak Sumatera Utara diarahkan untuk Sebagai penjabaran dari visi Dinas masyarakat ! sebagaimana pendapat HL (PHBS). mencapai tujuan pembangunan Kesehatan Provinsi Sumatera Utara, maka Blum, salah satu faktor yang paling besar Penyebaran informasi melalui rubrik persoalan korupsi di daerah terjadi hanya karena salah mengelola kesehatan yaitu mewujudkan derajad tujuan yang akan dicapai adalah terseleng- adalah perilaku. Dan untuk mengubah kesehatan Waspadamempunyainilaistra- anggaran. Ini yang harus selalu diingat, artinya, jangan sampai dana kesehatan masyarakat yang setinggi- garanya pembangunan kesehatan yang perilaku , bukan hal yang mudah, sebagai- tegis dan dimensi yang sangat luas, ma- yang sudah sedemikian besar, dipergunakan bukan semestinya. tingginya melalui peningkatan keterjang- tujuannya yang akan dicapai adalah ter- mana semudah membalikan tangan. Pe- syarakat dari berbagai lapisan dapat meng- kauan (accessibility), kemampuan (af- selengggaranya pembangunan kesehatan rilaku masyarakat adalah bagian karakter aksessesuaidengankebutuhannya.Rubrik Harus diingat jangan sampai sudah tidak menjabat lagi, seseorang itu fordability), kualitas (quality) pelayananan yang berkesinambungan, berhasil guna yang mempunyai dimensi latar belakang Kesehatan yang hadir cepat dan teratur harus mempertanggungjawabkan apa yang sudah terjadi saat dirinya kesehatan, sehingga mampu mengan- dan berdayaguna serta serasi dan seim- yang multifaktor. Maka peran Waspada mengikuti trend dan pola perkembangan menjabat. Hal ini tentunya bakal menjadi preseden buruk karena tisipasi perubahan, perkembangan, ma- bang dalam rangka mencapai derajad dalam merubah perilaku adalah berawal tingkat kesehatan masyarakat pada skala salah, dan tantangan dalam pembangun- kesehatan masyarakat yang setinggi- dari aspek titik singgung masyarakat yang waktu tertentu, dapat memberi seberkas bagaimanapun tidaklah sangat enak karena harus menyelesaikan persoalan an kesehatan. tingginya. paling sensitif dengan intervensi pada sinar pencerahan dalam format peman- hukum saat dirinya menjadi orang bebas. Tidak akan ada lagi kebebasan Dengan mempertimbangkan per- Pembangunan kesehatan diarahkan perubahan pola pikir ( mind set ). tauansituasidankondisikesehatanmasya- karena yang terjadi hanyalah memikirkan bagaimana bisa melepaskan kembangan masalah lokal serta berbagai untuk mencapai sasaran sebagaimana Perubahan pola pikir di bidang kese- rakat secara cepat pada setiap saat. Sebagai kecenderunganpembangunankesehatan tercantumdalamRencanaPembangunan hatan masyarakat memerlukan design landasan berpijak dari rubrik kesehatan diri dari persoalan hukum. Sungguh merupakan hal yang sangat ke depan serta dalam mencapai sasaran Jangka Menengah (RPJMN) tahun 2004- khusus, hal ini dikarenakan adanya faktor adalah hasil surveillance, data base, com- menyakitkan jika harus menghadapi persoalan-persoalan sedemikian. pembangunan kesehatan yang tertuang 2009sertaRPJMTransisiProvinsiSumatera keinginandankebutuhanmasyarakatyang mon sense, bentuk dukungan kebijakan Di sinilah dibutuhkan sebuah kemauan untuk membangun bukan dalam Rencana Pembangunan Jangka Utara tahun 2006-2009, yaitu : 1).Mening- bervariasidanberjenjang. Meskipun infor- pemerintah dan stake holder. Menengah Daerah (RPJMD) Provinsi Su- katkan umur harapan hidup menjadi 69,2 masi kesehatan masyarakat merupakan Kini Waspada telah genap dalam usia hanya untuk mengambil keuntungan. Aparatur pemerintahan adalah matera Utara tahun 2006 -2009, maka tahun. 2).Menurunkan angka kematian info penting, dalam kenyataannya, ketika 63 tahun tepatnya nanti hari Senin, tanggal orang-orang yang mau melayani dan memberikan pelayanan yang ditetapkanVisi Dinas Kesehatan Provinsi bayi menjadi 26 per 1000 kelahiran hi- akan disampaikan kepada masyarakat 11 Januari 2010, umur yang cukup signifik- tulus, ikhlas kepada masyarakat bukan hanya sekedar mengambil Sumatera Utara yaitu“Menjadi Penggerak dup.3).Menurunkan angka kematian ibu harusdikemassedemikianrupa,agardapat an menempatkan tonggak sejarah sebagai pembangunan Kesehatan menuju Suma- melahirkan menjadi 275 per 100.000 kela- lebih menarik, segar, dan hidup. Karena penyuluh , penyeru dan pelopor dalam keuntungan semata dari anggaran yang diberikan pemerintah kepada tera Utara Sehat melalui pemberdayaan hiran hidup. 4). Menurunkan prevalensi dalam proses transfer knowledge yang bidang pembangunan kesehatan. Kami daerah. Banyak pembangunan dapat dilaksanakan dengan anggaran masyarakat dan kemitrausahaan swasta”. gizi kurang pada anak balita menjadi tidak mengindahkan selera pasti dapat dari segenap jajaran kesehatan Sumatera yang sudah dianggarkan. Bagaimanapun juga dengan aggaran yang Sumatera Sehat adalah suatu kondisi dibawah 20,0 % diramalkan bakal mengalami kegagalan Utara mengucapkan selamat ulang tahun di mana masyarakat Sumatera Utara yang setara. buat jjaran redaksiWaspada, untuk terus sudah sedemikian adanya dari pusat, tentunya banyak program Hidup Sehat secara fisik mengenali, men- Peran Koran Waspada Selama iniWaspada telah cukup kon- teguh dan senantiasa menambah speed pembangunan dapat dilaksanakan. cegah dan mengatasi permasalahan Dalam penciptaan opini masyarakat sisten dalam gerakan pemberdayaan ma- dalam melaksanakan misi-misi kemanu- kesehatan yang dihadapi, sehingga dapat peran koran Waspada semakin penting, syarakat di bidang kesehatan masyarakat siaan, kesehatan, kemitraan dan keman- Sudah saatnya semua pihak meninggalkan perilaku-perilaku yang dirian masyarakat demi terwujudnya ma- bebasdariganggguankesehatan,baikyang koran selalu dibutuhkan dan diperlukan di Sumatera Utara. Waspada dalam ge- bisa merugikan masyarakat. Masyarakat tentunya sangat berharap disebabkan karena penyakit termasuk seiring dengan perkembangan zaman. rakannyayangprorakyatkhususnyapeduli syarakat sehat atau rakyat tidak sakit di dengan anggaran yang ada maka pembangunan itu akan terlaksana gangguan kesehatan akibat bencana Koran Waspada mempunyai sisi energi rakyat miskin telah melakukan berbagai Sumatera Utara. Semoga ! dengan baik saat anggarannya tidak kemana-mana alias dikorupsi.**** maupun lingkungan dan perilaku yang pemberdayaanmasyarakatyangluarbiasa, kegiatan terobosan-terobosan sebagai tidak mendukung untuk hidup sehat, di sehingga konon lebih dikenal denganThe berikut ; yakni Posyandu, Pengobatan gra- Penulis adalah Kepala Dinas Kesehatan posisi ini Dinas Kesehatan Propinsi Su- News Power . tis, Gerakan cuci tangan pakai sabun. Provinsi Sumatetra Utara matera Utara berperan sebagai agent Banyak hal yang dapat diangkat oleh Gotong royong massal, penghijauan dan Hubungi kami penggerakperananmasyarakatdanswasta Waspadamulaidaripenyebaraninformasi, penyebaran informasi kesehatan melalui dalam pembangunan kesehatan melalui pencitraan opini dan sanksi sosial yang kolom rubrik. KANTOR PUSAT Penerbit: PT Penerbitan Harian Waspada penerapan prinsip pemberdayaan dan dapat menjadi rangkaian proses yang PosyanduWaspada yang bekerjasama Jalan Letjen Suprapto/Brigjen Katamso No. 1 Komisaris Utama: Tribuana Said kemitrausahaan . dikemas dalam pesan yang dapat menjadi denganmasyarakatmelakukanpelayanan dan pemberdayaan masyarakat secara SUDUT BATUAH Untuk mewujudkan visi “menjadi landasan berpijak dari suatu hal yang Medan 20151 Direktur Utama: dr. Hj. Rayati Syafrin, MBA, MM penggerak pembangunan kesehatan terkait. langsung dalam rangka mengatasi per- Tel: (061) 4150858, Faks Redaksi: (061) 4510025, SIUPP: 065/SK/MENPEN/SIUPP/A.7/198 menuju Sumatera Utara Sehat alias Me- Khususnya di bidang kesehatan ma- masalahan kesehatan di lokasi setempat, Faks Tata Usaha: (061) 4531010. tanggal 25 Februari 1988 * KPK minta KDH kembalikan E-mail Redaksi: redaksiwaspada@gmail.com nuju Rakyat Tidak Sakit melalui pember- syarakat , peran Waspada menjadi kian kegiatan ini dilanjutkan dengan upaya Anggota SPS No. 13/1947/02/A/2002 dayaan masyarakat dan kemitrausahaan strategis.Waspadadapatmelakukanproses pembinaan dasa wisma secara bergilir dan fee meski sudah lengser KANTOR PERWAKILAN swasta“ maka Dinas Kesehatan Provinsi auto pedampingan kepada masyarakat bergulir. - Alamak terpaksalah jual tanah Percetakan: PT Prakarsa Abadi Press Sumatera Utara mempunyai misi : a) danmenjadiinstrumentperjuanganpem- Kegiatan pengobatan gratisWaspada pusaka Bumi Warta Jaya Jalan Letjen Suprapto/Brigjen Katamso No. 1 Menggerakan pembangunan nasional bangunan kesehatan. Waspada selalu ha- dilakukan secara simultan pada event- Jalan Kebon Sirih Timur Dalam No. 3 Medan 20151 event tertentu untuk membantu masyara- * Pemko lanjutkan tugas tertunda Jakarta 10340 berwawasan kesehatan. b)Meningkatkan dir untuk memberi dan mengisi informasi Tel: (061) 6612681 tahun 2009 Tel: (021) 31922216, Faks: (021) 3140817. kualitas aparatur kesehatan individu, tentang pengetahuan kesehatan masya- kat yang tak mampu berobat dan jauh dari Isi di luar tanggung jawab percetakan keluargadanmasyarakatbesertalingkung- rakat.Waspadadenganteratur,secaraterus jangkauanpelayananpuskesmasmaupun - Siapa yang melanjutkan? Jalan Ratu Syafiatuddin No. 21 C Banda Aceh 23122 Harga iklan per mm kolom: annya. c) Memelihara dan meningkatkan menerus mengadvokasi siapa saja untuk puskesmas pembantu (Pustu) sehingga BW Rp. 11.000,- pelayanan kesehatan individu, keluarga dapat ikut berpikir bersama mengatasi menambah akses pemerataan pelayanan * Harga bahan pokok terus Tel & Faks: (0651) 22385 FC Rp. 30.000,- dan masyarakat beserta lingkungannya. segala permasalahan yang dapat mele- kesehatan. merangkak naik Jalan Iskandar Muda No. 65 Lhokseumawe Halaman depan BW Rp. 33.000,- d) Memelihara dan meningkatkan pela- mahkan derajat kesehatan masyarakat. GerakancucitanganpakaisabunWas- - Inilah bikin awak naik pitam, Tel: (0645) 42109 yanan kesehatan yang bermutu, merata Sebagaimana Visi Dinas Kesehatan pada yang sasarannya adalah masyarakat he...he...he oel Halaman depan FC Rp. 90.000,- D Wak Jalan Sutami No. 30 Kisaran. Tel: (0623) 41412 Ukuran kolom: 40,5 mm dan terjangkau.e) Mendorong keman- yang menyatakan sebagai penggerak anak sekolah adalah upaya terpola untuk dirian masyarakat dan kemitrausahaan pembangunan, maka Waspada yang telah memberi pembelajaran perilaku dan ke- Dewan Redaksi: H. Prabudi Said, H. Teruna Jasa Said, H. Azwir Thahir, H. Sofyan Harahap, H. Akmal Ali Zaini, H. Muhammad Joni, Edward Thahir, M. Zeini Zen, Hendra DS. Redaktur Berita: H. Akmal Ali Zaini. Redaktur Kota: Edward Thahir. Redaktur Sumatera Utara: M. Zeini Zen. Redaktur Aceh: Rizaldi Anwar. Redaktur Luar WASPADA Negeri: H. Muhammad Joni. Redaktur Nusantara & Features: Gito Agus Pramono. Redaktur Opini: H. Sofyan Harahap. Redaktur Ekonomi: Armin Rahmansyah Nasution. Redaktur Olahraga: Johnny Ramadhan Silalahi. Redaktur Minggu/Humas: Hendra DS, Redaktur Agama: H. Syarifuddin Elhayat. Asisten Redaktur: Rudi Faliskan (Berita) Zulkifli Harahap, Muhammad Thariq (Kota Medan), Feirizal Purba (Sumatera Utara), T. Donny Paridi (Aceh), Syafriwani Harahap (Luar Negeri), Setia Budi Siregar (Olahraga), Hj. Hoyriah Siregar (Ekonomi), T. Junaidi (Hiburan), Hj. Erma Sujianti Tarigan (Agama), Hj. Neneng Khairiah Zein (Remaja), Austin Antariksa (Kreasi), Armansyah Thahir (Otomotif), Anum Purba (Wanita), Hj. Ayu Kesumaningtyas (Kesehatan), Denny Adil (Pelangi). Sekretaris Redaksi: Hj. Hartati Zein. Iklan: Hj. Hilda Mulina, Rumondang Siagian (Medan), Lulu (Jakarta). Pemasaran: Andi L. Said (Medan), H. Subagio PN (Sumut), S. Manik (NAD). Wartawan Kota Medan (Umum): H. Erwan Effendi, Muhammad Thariq, Zulkifli Harahap, David Swayana, Amir Syarifuddin, Ismanto Ismail, Rudi Arman, Feirizal Purba, Zulkifli Darwis, H. Abdullah Dadeh, H. Suyono, Ayu Kesumaningtyas, M. Ferdinan Sembiring, M. Edison Ginting, Surya Effendi, Anum Purba, Sahrizal, Sulaiman Hamzah, Sugiarto, Hasanul Hidayat, Aidi Yursal, Rustam Effendi. Wartawan Kota Medan (bidang khusus): H. Syahputra MS, Setia Budi Siregar, Austin Antariksa, Dedi Riono (Olahraga), Muhammad Faisal, Hang Tuah Jasa Said (Foto), Armansyah Thahir (Otomotif), Dedi Sahputra (Penugasan Khusus). Dedek Juliadi, Zulfan Efendi, Tetty Rosiana, Handaya Wirayuga (Koran Masuk Sekolah/KMS). Wartawan Jakarta: Hermanto, H. Ramadhan Usman, Hasriwal AS, Nurhilal, Edi Supardi Emon, Agus Sumariyadi, Dian W, Aji K. Wartawan Sumatera Utara: H. Riswan Rika, Nazelian Tanjung (Binjai), H.M. Husni Siregar, Hotma Darwis Pasaribu (Deli Serdang), Eddi Gultom (Serdang Bedagai), H. Ibnu Kasir, Abdul Hakim (Stabat), Chairil Rusli, Asri Rais (Pangkalan Brandan), Dickson Pelawi (Berastagi), Muhammad Idris, Abdul Khalik (Tebing Tinggi), Mulia Siregar, Edoard Sinaga (Pematang Siantar), Ali Bey, Hasuna Damanik, Balas Sirait (Simalungun), Helmy Hasibuan, Agus Diansyah Hasibuan, Sahril, Iwan Hasibuan (Batubara), H. Abu Bakar Nasution, Nurkarim Nehe, Bustami Chie Pit (Asahan), Rahmad Fansur Siregar (Tanjung Balai), Indra Muheri Simatupang (Aek Kanopan), H. Nazran Nazier, Armansyah Abdi, Neirul Nizam, Budi Surya Hasibuan (Rantau Prapat), Hasanuddin (Kota Pinang) Edison Samosir (Pangururan), Jimmy Sitinjak (Balige), Natar Manalu (Sidikalang), Arlius Tumanggor (Pakpak Bharat)Parlindungan Hutasoit, Marolop Panggabean (Tarutung), Zulfan Nasution, Alam Satriwal Tanjung (Sibolga/Tapanuli Tengah), H. Syarifuddin Nasution, Mohot Lubis, Sukri Falah Harahap, Balyan Kadir Nasution (Padang Sidimpuan), Idaham Butarbutar (Gunung Tua), Iskandar Hasibuan, Munir Lubis (Panyabungan), Bothaniman Jaya Telaumbanua (Gunung Sitoli). Wartawan Aceh: H. Adnan NS, Aldin Nainggolan, Muhammad Zairin, Munawardi Ismail, Zafrullah, T. Mansursyah, T. Ardiansyah (Banda Aceh), Iskandarsyah (Aceh Besar), Maimun (Lhoksukon) Bustami Saleh, M. Jakfar Ahmad, Jamali Sulaiman, Arafat Nur, M. Nasir Age, Fakhrurazi Araly, Zainal Abidin (Lhokseumawe), Muhammad Hanafiah (Kuala Simpang), H. Syahrul Karim, H. Ibnu Sa’dan, Agusni AH, H. Samsuar (Langsa), Amiruddin (Idi), HAR Djuli, Zainuddin Abdullah (Bireuen), Bahtiar Gayo (Takengon), Muhammad Riza, H. Rusli Ismail (Sigli), T. Zakaria Al-Bahri (Sabang), Khairul Boang Manalu (Subulussalam), Rusli Idham (Meulaboh), Jaka Rasyid (Blang Pidie), Zamzamy Surya (Tapak Tuan), Ali Amran, Mahadi Pinem (Kutacane), Bustanuddin , Wintoni (Blangkejeren), Khairul Akhyar (Bener Meriah), Tarmizi Ripan, Mansurdin (Singkil), Rahmad (Sinabang). Semua wartawan Waspada dilengkapi dengan kartu pers. Jangan layani dan segera laporkan ke pihak berwajib atau ke Sekretaris Redaksi bila ada oknum yang mengaku wartawan Waspada tetapi tidak bisa menunjukkan kartu pers yang sah, ditandatangani Pemimpin Redaksi
  • 11. WASPADA Kamis 7 Januari 2010 Opini 13 Waspada, Mewujudkan Indonesia Sehat 2010 (Refleksi Ulang Tahun Ke 63 Harian Waspada) Di samping itu, masyarakat juga dapat diberitakan dengan gaya yang khas Ha- suk di kota Medan dan Kabupaten/Kota rahan Aur Medan. siaan dan menyelamatkan nyawa manu- memberi kritikan dan masukan yang po- rian Waspada sehingga membuat masa- lainnya di Sumatera Utara. Kondisi ini Ini merupakan wujud peran aktif sia yang membutuhkan. Kegiatan seperti sitif kepada instansi bersangkutan. lah HIV/AIDS di Sumatera Utara khusus- multi kompleks, tidak hanya masalah langsung Surat Kabar Harian ini dalam ini, adalah yang pertama di Sumatera Publikasi melalui media cetak mau- nya Kota Medan menjadi perhatian ma- kesehatan, tapi erat kaitannya dengan melakukan upaya promotif dan preventif Utara dan diharapkan menjaring donor pun elektronik terhadap kegiatan yang te- syarakat. masalah pendapatan dan penghasilan kesehatan. pemula yang cukup banyak untuk men- lah, sedangdan akan dilakukan Pemerin- Bahkan saat ini, RSUP H. Adam Malik keluarga, pengetahuan, kepedulian serta jawab tantangan PMI dalam pengadaan tah Kota dan Provinsi di bidang kesehatan dengan Pusat Pelayanan Khusus (Pu- sosial budaya. Kampanye Cuci Tangan darah khususnya di Kota Medan. merupakan upaya promosi kesehatan yang syansus) yang dibentuk pada tahun 2003, Pada ulang tahun ke-61 tahun 2008, Di ulang tahun ke-62 tahun 2009, menjadi andalan utama program pemba- sudah dikenal secara nasional karena Harian Waspada bekerja sama dengan Harian Waspada menggelar kampanye Penanggulangan Penyakit Menular ngunan kesehatan di suatu daerah. Salah menjadi icon penanggulangan HIV/AIDS Dinas Kesehatan Kota Medan dan RSU cuci tangan pakai sabun di Kecamatan Berbagai penyakit infeksi menular Oleh DR. Dr. Umar Zein satu mitra pemerintah dalam mewujudkan serta menjadi pusat rujukan dan konse- Permata Bunda serta pihak swasta lain- Medan Labuhan. Kegiatan ini bekerja sampai saat ini masih menjadi problema Indonesia Sehat 2010 adalah Harian Was- ling di Sumatera Utara. Hal ini tidak akan nya, menggelar suatu kegiatan kampanye sama dengan Pemko Medan dan Pem- utama di Indonesia, mulai dari penyakit V isi Indonesia Sehat 2010 telah pada. Aspek kesehatan merupakan salah terjadi tanpa peranan Harian Waspada makan telur di Kelurahan Aur, Kecamat- prov Sumatera Utara serta dirangkai de- lama yang muncul kembali (Reemerging digaungkan sejak lima tahun satu bidang berita yang menjadi perhatian yang piawai dalam mengemas berita. an Medan Maimun. Sejumlah 25.000 bu- ngan pemberian contoh sarana cuci ta- Infectious Diseases) seperti polio, an- yang lalu oleh Pemerintah Re- Harian Waspada, bahkan penulis sudah Wartawan Waspada juga secara aktif tir telur dibagikan kepada masyarakat ngan pakai sabun yang mudah dan mu- thrax, filariasis, penyakit infeksi yang publik ini melalui Departemen memanfaatkannya sebagai sarana menulis menampilkan tulisan yang berisi peliput- yang mempunyai anak bayi dan balita dari rah untuk sekolah-sekolah terutama Se- masih belum teratasi seperti tuberkulosis, Kesehatan. Filosofi dari sebuah visi ada- sejak masih duduk di bangku perguruan an berbagai kelompok risiko penularan keluarga kurang mampu, serta sebagian telur kolah Dasar se Kecamatan Medan La- malaria, demam berdarah dengue, chi- lah angan-angan yang ingin dicapai, tinggi pada era tahun 70-an. HIV/AIDS, seperti Pekerja Seks Komersil diolah dan langsung diberikan kepada balita buhan. kungunya, leptospirosis dan penyakit mimpi yang ingin digapai dan harapan (PSK), Waria dan pengguna narkotik sun- yang hadir pada acara tersebut. Kampanye ini menggaungkan akan infeksi menular yang baru (Emerging In- yang ingin diwujudkan. Visi harus diurai- Pemberitaan HIV/AIDS tik serta opini tentang penanggulangan Kampanye ini bertujuan agar para pentingnnya perilaku hidup bersih dan fectious Diseases), seperti HIV/AIDS, flu kan pula dalam Misi dan dituangkan da- Pemberitaan tentang HIV/AIDS seca- HIV/AIDS. orang tua memberikan sumber protein sehat yang dimulai sejak dini dan diterus- burung dan flu babi. lam langkah-langkah objektif yang mam- ra proporsional di Sumatera Utara, khu- hewani berupa telur ayam yang sangat kan hingga dewasa. Sasaran anak SD sa- Dalam penanggulangan penyakit pu dilaksanakan di lapangan. susnya Kota Medan dipelopori oleh ha- Rubrik Kesehatan mudah diperoleh dimana saja dengan ngatlah tepat, karena di usia tersebut infeksi menular ini, peranan Harian Was- Indonesia Sehat akan tercapai bila rian Waspada sejak tahun 2002. Awalnya, Salah satu peran langsung Harian harga terjangkau oleh semua golongan. anak-anak sangat aktif dan sangat rentan pada cukup signifikan dalam melaporkan Provinsi Sehat. Provinsi Sehat akan ter- pemberitaan di Harian Waspada menim- Waspada di bidang kesehatan adalah de- Keistimewaan telur bagi balita dan anak- terhadap penularan penyakit melalui ta- jumlah kasus dengan data yang akurat, wujud bila Kabupaten/Kota Sehat. Ka- bulkan pro dan kontra di kalangan petu- ngan membuka rubrik kesehatan yang anak pada umumnya adalah disamping ngan yang tidak bersih. perkembangan kasus, pemantauan ka- bupaten/Kota Sehat tercipta bila Keca- gas kesehatan dan berbagai Lembaga secara rutin setiap hari Minggu dan per- bisa tahan lama disimpan, juga bisa di- Dengan kegiatan yang sederhana ini, sus, serta mensosialisasikan program- matan Sehat. Kecamatan Sehat tatkala Swadaya Masyarakat (LSM) yang con- nah membuka rubrik Konsultasi Kese- olah dengan berbagai cara serta dapat angka kejadian diare dan ISPA akan dapat program pemerintah dalam upaya pe- seluruh Kelurahan/Desa di wilayahnya cern terhadap HIV/AIDS. hatan. Rubrik ini menampung berbagai dicampur dengan bahan makanan atau diturunkan dengan tajam. Bukan saja nanggulangan penyakit tersebut di ma- sehat. Kelurahan/Desa terdiri dari Ling- Pemberitaan tentang ODHA (Orang jenis artikel yang ditulis para pakar dan minuman lain dan dapat diolah menjadi kepada anak sekolah, tetapi kampanye syarakat. kungan/RT/RW. Kemudian, Lingkung- Dengan HIV/AIDS) yang disajikan secara praktisi kesehatan di Sumatera Utara. berbagai jenis makanan siap saji. Harian ini ditujukan kepada setiap individu agar Tentu saja peran ini harus terus di- an/RT/RW terdiri dari rumah tangga- proporsional dan akurat serta menjauhi Berbagai kegiatan Puskesmas dipubli- Waspada merupakan pionir kampanye membiasakan diri cuci tangan pakai sa- tingkatkan dari masa ke masa dan dise- rumah tangga berisi individu-individu sensasi, secara perlahan membantu me- kasikan melalui rubrik ini, bahkan rubrik makan telur ini, yang kemudian diikuti bun terutama sebelum makan. suaikan dengan perubahan-perubahan yang harus berperilaku hidup sehat dan ngurangi stigmatisasi dan diskrimininasi ini menjadi peluang bagi para dokter di berbagai pihak di Kota Medan. kebijakan dalam Sistim Kesehatan Nasio- mempunyai lingkungan hidup yang se- terhadap mereka. Rasa malu dan takut Medan, sekaligus sebagai tantangan bagi Donor Darah Pemula nal dan Daerah serta dengan perkem- hat. kehilangan pasien yang semula meng- insan kesehatan di Sumatera Utara untuk Posyandu Waspada Pada tahun yang sama, Harian Was- bangan bidang teknologi komunikasi Salah satu upaya yang sangat penting hantui pihak rumah sakit akibat merawat ikut berperan aktif. Salah satu upaya revitalissi posyandu pada bersama Perhimpunan Donor Da- yang sangat pesat berkembang. Visi In- untuk mewujudkan Visi Indonesia Sehat pasien AIDS, secara perlahan diyakinkan, Upaya promosi kesehatan pada haki- adalah membuat Posyandu menjadi mi- rah Indonesia (PDDI) Sumatera Utara, donesia Sehat 2010 belum tercapai, kare- 2010 adalah Promosi Kesehatan. Dalam bahwa justru dengan pemberitaan yang katnya adalah upaya yang harus dilaku- lik masyarakat serta mengajak pihak PMI Cabang Medan dan Dinas Kese- na masih banyak yang belum digapai. promosi, peranan media paling utama benar dan memberi pelayanan yang be- kan setiap insan kesehatan secara terus swasta ikut berperan menjadi Bapak hatan Kota Medan menggerakkan pen- Mimpi itu belum jadi kenyataan, ka- untuk mensosialisasikan semua program nar akan menumbuhkan kepercayaan ma- menerus agar terjadi perubahan dalam Asuh Posyandu. Harian Waspada telah jaringan donor darah pemula di seluruh rena masih banyak yang harus dilibatkan. pemerintah kepada masyarakat luas. Ha- syarakat terhadap rumah sakit tersebut. perilaku yang membutuhkan waktu rela- mewujudkannya dengan mendirikan Po- kecamatan di Kota Medan. Kegiatan ini Harapan penulis, kiranya di tahun 2010 rian Waspada sebagai salah satu harian Adalah Rumah Sakit Umum Pusat tif lama sangat membutuhkan media se- syandu Waspada di Gedung Bumi Warta dilaksanakan di 21 Puskesmas yang ter- Harian Waspada akan meningkatkan terkemuka di Sumatera Utara dan Aceh (RSUP) H. Adam Malik sebagai pionir pe- perti Harian Waspada. Waspada pada tanggal 11 setiap bulan- sebar di 21 Kecamatan. peran sertanya di segala bidang, terutama yang memasuki usia ke 63 pada 11 Ja- rawatan pasien AIDS di Sumatera Utara nya. Ini merupakan satu-satunya Po- Diharapkan seluruh warga Medan bidang kesehatan. Insya Allah! nuari 2010, telah ikut berperan aktif da- yang dengan gencar hampir setiap hari Penyuluhan Gizi syandu yang digerakkan langsung oleh yang merasa dirinya sehat dan sudah de- lam promosi kesehatan untuk mewujud- diberitakan Harian Waspada tentang per- Kasus gizi buruk dan gizi kurang di swasta dengan segala fasilitasnya dan wasa akan mendonorkan sebagian kecil kan Medan Sehat 2010 dan Sumatera kembangan perawatan pasien, serta pro- Indonesia masih saja ditemukan, terma- dibantu kader-kader kesehatan di Kelu- darahnya untuk kepentingan kemanu- Penulis adalah Kolumnis Waspada Utara Sehat 2010, sekaligus Indonesia gram-program yang akan dilakukan oleh Sehat 2010. rumah sakit, Dinas Kesehatan serta Ko- Harian Waspada tidak hanya sebatas misi Penanggulangan AIDS Daerah melakukan publikasi setiap kegiatan yang (KPAD) serta pendampingan ODHA yang Lanjutkan Pembangunan... pembangunan di Kabupaten Serdang menjadi 6,12 pada tahun 2008. Kese- tai politik sebagai calon bupati dan wakil dilakukan Pemko Medan dan Pemprov dilakukan berbagai LSM di Kota Medan. Bedagai, peran pihak swasta (dunia usa- jahteraan rakyat juga mengalami pening- bupati Serdang Bedagai periode 2010 – (Lanjutan dari hal 12) ha) dan masyarakat sangatlah penting. katan dengan membaiknya derajat kese- 2015. Kami yakin kebersamaan dan kerja Sumatera Utara melalui Dinas Kesehatan Data yang akurat selalu ditampilkan serta unit-unit pelayanannya seperti Pus- sehingga masyarakat mengetahui sudah Sedangkan upaya promosi untuk Oleh karena itu telah dicanangan Gerak- hatan, tingkat pendidikan dan ekonomi keras sangat menentukan keberhasilan meningkatkan arus kunjungan wisata an Pembangunan Swadaya Rakyat atau masyarakat, yang digambarkan dengan 5 (lima) tahun mendatang. kesmas dan Rumah sakit, tapi juga terli- sampai dimana perkembangan penular- khususnya wisatawan mancanegara, Gerbang Swara. Dengan Gerbang Swara peningkatan IPM dari 71,2 pada 2005 bat langsung dalam kegiatan promosi an penyakit ini serta apa saja upaya yang menjadi 72,59 pada 2008. Jumlah pen- Jangan Memfitnah telah dilakukan kerjasama antara Pem- ini, pemerintah daerah mengajak sege- kesehatan agar masyarakat dapat menge- dilakukan pemerintah dan masyarakat kab Sergai dengan Asosiasi Indonesia nap elemen masyarakat berpartisipasi duduk miskin juga mengalami penurun- Tahun 2010 adalah tahun politik di- tahui secara langsung bagaimana pro- untuk penanggulangannya. Kritikan dan Travel Agency (ASITA) Sumut dan Aso- dalam mempercepat pembangunan an dari 12,34 persen 2006 menjadi 10,61 mana akan dilaksanakan pesta demo- gram itu dijalankan dan apa tujuannya. pandangan sinis dari berbagai pihak juga siasi Profesional Pariwisata Indonesia Sergai. persen pada 2008. krasi yakni Pilkada. Sebagai negara de- (ASPPI) Sumut. Sejak tahun 2006 hingga 2009, jumlah Kemajuan lainnya adalah pengesah- mokrasi, perbedaan adalah hal yang Dalam pemberdayaan koperasi dan nilai partisipasi yang diberikan masya- an APBD sejak 2007, 2008, 2009 dan 2010 biasa. Perbedaan jangan menjadikan Dedi usaha mikro kecil dan menengah, telah r a k a t d a l a m p e m b a n g u n a n R p. tepat waktu. Evaluasi laporan keuangan perpecahan dan permusuhan bagi kita, Foliopini Sahputra dedisahputra@yahoo.com dilakukan pelaksanaan klasifikasi kope- rasi dan pelatihan perkoperasian serta menumbuhkan usahawan baru, sampai 2009 telah terbentuk 174 unit koperasi 43.181.418.000. Untuk memberikan pelayanan prima kepada masyarakat dan mendorong in- vestor menanamkan investasinya di Ser- sejak tahun 2006, 2007 dab 2008 dengan opini wajar dengan pengecualian. Di samping itu Kabupaten Serdang Bedagai telah ditetapkan sebagai kabupaten ko- tetapi jadikanlah perbedaan itu ibarat sebagai suatu lukisan indah yang penuh warna-warni. Hindarilah, saling meng- hujat dan memfitnah. Allah SWT telah aktif dan 1 unit bank padi sebagai salah dang Bedagai, sejak tahun 2006 telah di- perasi dan kabupaten layak anak. Keber- memperingatkan dalam Al Quran surat satu unit usaha yang bergerak di bidang bentuk Unit Pelayanan Terpadu Satu Pin- hasilan lain yang tidak kalah pentingnya Al Hujarat ayat 11 yang artinya antara Humor Itu … pengeringan dan pengolahan padi men- jadi beras serta bantuan penyediaaan dana bergulir bagi kegiatan produktif tu. Pada tahun 2007, status Unit Pelayan- an Terpadu Satu Pintu ditingkatkan men- jadi Kantor Pelayanan Terpadu Dengan adalah dalam kurun waktu 5 tahun legis- latif dan eksekutif telah menerbitkan 162 peraturan daerah. Di antara Perda itu me- lain, ‘’ Hai orang yang beriman, janganlah suatu kaum mengolok-olokkan kaum yang lain, karena boleh jadi mereka (yang Kebesaran trah K.H. Hasyim Asyari, tertawa? Dengan semua ketakutan dan skala usaha mikro, sehingga diharapkan Menangani 23 izin.. Pada Oktober 2008, lahirkan Perda hari jadi, mars Serdang mengolok-olokkan). Dan surat Al Hujarat pendiri Nahdhlatul Ulama (NU), tampak- tekanan yang selama ini melandaku. saat panen raya petani dapat menyimpan pemerintah memberikan penghargaan Bedagai, pemekaran beberapa keca-mat- ayat 12 yang artinya antara lain:’’Hai nya benar-benar mengalir ke Gus Dur. Semestinya aku sudah mati kalau aku gabahnya di bank padi dan menjualnya Piala Citra Pelayanan Prima kepada Pem- an hingga menjadi 17 kecamatan. orang-orang yang beriman jauhilah dari Bahkan setelah wafatnya, almarhum te- tidak tertawa, dan kalian membutuhkan saat harga gabah sudah menguntungkan. kab Sergai yang diserahkan Presiden Su- Di samping adanya kemajuan, Sergai prasangka, sesungguhnya sebagian pra- rus menjadi bahan pembicaraan; dari obat ini jauh lebih banyak dariku,’’ ka- Untuk mengurangi pengangguran silo Bambang Yudhoyono di Istana Ne- juga memperoleh banyak penghargaan sangka itu dosa dan janganlah kamu mulai program dialog di TV sampai ke tanya. Karena pada saat itu Lincoln ter- dan membuka lapangan kerja, telah di- gara. Di samping itu, Pemkab Sergai sejak baik dari tingkat provinsi maupun tingkat mencari-cari kesalahan orang lain dan lakukan pemberian kemudian pengu- 2007 telah menerapkan Sistem Informasi nasional. Sejak 2006 – 2009, Sergai telah janganlah sebagian kamu menggunjing ruang-ruang seminar maupun di pinggir nyata sedang memberikan obat panjang rusan izin usahan dan khusus izin SIUP Administrasi Kependudukan (SIAK). Un- memperoleh 123 penghargaan yang ter- sebagian yang lain. jalan atau di warung kopi. umur bagi para menterinya. diri dari 76 penghargaan dari tingkat Pro- Pilihan boleh berbeda, tetapi persa- dan TDP tanpa dipungut biaya, promosi tuk memberikan kemudahan bagi ma- Kalau bicarakan Gus Dur, berjilid-jilid Mahatma Gandhi (1869-1948) juga syarakat dalam pengurusan administrasi vinsi Sumatera Utara dan 47 pengharga- tuan dan kesatuan harus tetap dijaga. dan kerjasama investasi, pelatihan ke- buku tidak akan tuntas mengupas ten- begitu. Dia ternyata punya resep jitu ke- terampilan bagi pencari kerja dan penye- penerbitan dokumen kependudukan an dari tingkat nasional/internasional. Oleh karena itu mari kita jalin kebersa- tang sang mantan presiden itu. Namun tika berhasil dalam perlawanannya me- baran informasi tentang peluang kerja. (Kartu Keluarga, KTP dan Akta Catatan Penghargaan-penghargaan ini bukanlah maan dan kerukunan untuk mencipta- yang menonjol, selain sikapnya yang selalu nentang penjajahan kerajaan Inggris. Dia Di samping itu Sergai telah memiliki Per- Sipil), telah dikakukan penyuluhan dan merupakan tujuan utama dan untuk kan suasana yang kondusif menyong- kontroversial, hal lain adalah sense of humor berkata begini,’’Kalau saya tidak punya da Nomor 19 tahun 2007 tentang peman- pelayanan melalui mobil unit yang lang- membanggakan diri, tetapi menjadi mo- song pesta demokrasi.Semoga momen- yang dimilikinya. Tidak jarang pula Gus rasa humor, sudah lama saya bunuh diri.’’ faatan lahan kosong (sementarara tidak sung ke kecamatan dan desa dan sampai tivasi untuk dapat bekerja lebih giat lagi. tum hari jadi ke-6 Kabupaten Serdang Dur mengaplikasikan gaya humornya ini Bahkan Rasulullah SAW sendiri ber- diusahakan) bagi tanaman semusim, ha- 2009, mobil unit telah melayani pener- Keberhasilan ini tidak terlepas dari Bedagai tahun 2010 dapat kita jadikan dalam menyelesaikan masalah. canda. Dalam sebuah riwayat dikisahkan nya saja sosialisasi perda itu perlu diting- bitan KTP sebanyak 12.500 KTP dan 6.021 , dukungan seluruh pihak melalui, saran sebagai pendorong dan motivasi mem- Ketika terjadi kerusuhan di Ambon seorang nenek tua datang kepada Rasul katkan kepada seluruh lapisan masya- kartu keluarga. dan kritikan yang membangun yang di- bangun kebersamaan untuk melanjut- beberapa tahun lalu misalnya, dengan minta didoakan agar masuk surga. rakat. Sebagai kabupaten baru, alham- sampaikan. Kami menyadari dalam ku- kan pembangunan dan meraih prestasi. lantang Gus Dur mengatakan bahwa Maka Nabi SAW berkata kepadanya, Bagi masyarakat miskin juga telah dulillah dengan kerja keras dan semangat run waktu 5 tahun ini masih banyak pro- Semoga Allah SWT senantiasa me- Mayjen “K” yang menjadi dalangnya. ‘’Wahai Ummu Fulan! Sesungguhnya diberikan bantuan keserasian sosial se- kebersamaan, telah diperoleh banyak gram pembangunan yang belum dapat ridhoi dan memberkati segala usaha yang Opini publik serta merta mengarah ke- surga itu tidak dimasuki orang yang su- besar Rp1,5 miliar untuk 22 desa, ban- kemajuan. Hal ini digambarkan antara selesai. Didasari hal itu dan ditambah kita lakukan untuk mewujudkan cita-cita pada Mayjen Kivlan Zen hingga yang dah tua.’’ Maka wanita tua itu pun me- tuan Kelompok Usaha Bersama (KUBE) lain dengan peningkatan PDRB atas dengan desakan dan dukungan dari to- pemekaran yaitu meningkatkan pelayan- bersangkutan menjadi gerah. Setelah nangis, karena ia memahami kalimat itu Rp1,5 miliar untuk 50 KUBE, BLT dan dasar harga berlaku tahun 2005 sebesar koh masyarakat agar saya dan Pak Seo- an dan kesejahteraan masyarakat Kabu- sekian lama masalah ini jadi ’bola liar’ apa adanya. Raskin untuk 46.562 rumah tangga mis- Rp5.059.770.000.000 dan mengalami kirman melanjutkan pembangunan Ka- paten Serdang Bedagai. . kemudian dengan enteng Gus Dur hanya Kemudian Rasulullah SAW mema- kin dan bantuan Lansia terlantar seba- peningkatan menjadi Rp7.472.750.000. bupaten Serdang Bedagai guna mewu- nyak 60 orang. 000 pada 2008. Pertumbuhan ekonomi judkan cita-cita pemekaran, maka kami menjawab begini,’’Yang saya mak-sud hamkannya, bahwa ketika dia masuk sur- Dalam mempercepat peningkatan pada tahun 2005, 5,91 dan meningkat telah mendaftarkan diri di beberapa par- Penulis adalah Bupati Serdang Bedagai adalah Mayjen Kunyuk (monyet).’’ ga,tidakakanmasuksurgasebagaiorangyang Sama seperti ketika terjadi pemban- sudah tua, tetapi menjadi muda belia dan taian orang-orang NU di Banyuwangi, cantik. Lalu Nabi SAW membaca firman Allah mengindahkan peraturan yang di berikan hanya sepihak. Jawa Timur. Gus Dur kemudian menu- SWT: “Sesungguhnya Kami menciptakan 4. Anehnya petugas-petugas di lapangan terlebih security tetap menadahkan duh orang yang berinisial ES yang terli- mereka (wanita-wanita surga) itu dengan tangan kepada kami (pekerja) setiap masuk keluar instalasi dengan alasan: uang bat. Lalu muncul Eggy Sudjana yang di- langsung, dan Kami jadikan mereka gadis- makan, uang kopi, rokok dan sebagainya. Singkatnya tetap kami para supir/kernet sebut-sebut kepanjangan dari akronim gadis perawan, penuh cinta lagi sebaya yang memikul beban mereka. ES. Tapi kemudian, lagi-lagi kiai dari umurnya.” (Q.S. 56: 35-37) 5. Kanas Girsang (selaku komandan security) pada Instalasi Medan Group yang Jombang ini hanya tertawa. ”Yang saya maksud itu Eyang S,” ujar Gus Dur. *** Ralat Dari DPD GM Gakari Sumut merupakan ujung tombak dari K.L. aktip mengatur lapangan dan mengatur semua petugas termasuk aparat negara yang bertugas mungkin demi karir dan prestasi Bagi sebagian orang, Gus Dur terlalu Gaya bicara yang humoris juga meru- Sehubungan dengan pemberitaan di harian Waspada tanggal 4 Januari jabatan, sungguh ambisi yang tidak positif. ’melangit’ dan gak pernah cecah di bumi pakan bagian dari komunikasi yang efek- 2010 dengan judul GM Gakari Konsolidasi Struktural di halaman 10 yang 6. Begitu banyak stap para instalasi medan group PT. Pertamina di Lab Deli, hingga tak pantas jadi pemimpin. Gus tif. Kalau seorang pembicara di depan satupun tak ada yang potensial. “Memecahkan masalah harus kembali ke akar menyebutkan nama Ketua Umum Viktor Aritonang, yang sebenarnya adalah Dur juga dinilai nyeleneh dan semau gue seminar yang panjang terus berbicara masalah”. pengurus DPP GM Gakari. Sedangkan Ketua Umum adalah R.Akbar 1. Nampaknya K.I. ingin menegakkan disiplin pada Instalasi Medan Group, tapi gak peduli orang sakit hati. Tapi sebagian serius dari A sampai Z maka mudah dite- Lubis,SH. tidak dimulai pada diri sendiri dan staf-stafnya, bahkan terbalik di mulainya dari lain Gus Dur adalah seorang wali yang bak, orang akan cepat jenuh. Demikian kami sampaikan ralat ini,. Atas perhatian dan kerjasamanya komposisi paling bawah, yaitu kami para supir dan kernet mobil tangki. jadi panutan bahkan siap berdarah-da- Domapin, menurut penelitian Dr kami atas nama pengurus DPD GM Gakari Sumut mengucapkan II. Kami katakan K.I. (OH) tidak disiplin, beliau tidak pernah melakukan SIDAK rah untuk bela sang kiai. Tapi saya kira Beth Ann Ditkoff, adalah bahan kimia terimakasih (Inspeksi Mendadak), karena staf beliau membuat sistem ABS (Asal Bapak Senang) semua pihak setuju kalau disebut Gus dalam otak yang bertanggungawab me- Hormat kami jadi K.I. hanya menerima laporan yang baik-baik saja. Dur itu punya rasa humor yang tinggi. micu otak untuk memulai tahapan men- DPD GM Gakari Sumatera Utara III. Setiap hari kerja kami masuk panggilan 1 jam: 06.30 saat mobil tangki sudah cerna suatu humor. Dopamin ini me- Ketua: Apri Budi berada di bawah Blody pengisian, para karyawan yang bertugas belum ada yang *** mungkinkan kita merasa nyaman saat hadir kami semua gelisah mondar mandir di lapangan, anehnya petugas lapangan Sudah sejak lama humor itu dekat kita tertawa hingga kondisi pasien yang menegor kami, tanpa memperdulikan petugas pengisian yang setiap hari terlambat. dengan para pemimpin dunia. Suatu ketika pada masa perang sipil, Presiden kronis sekalipun hingga jadi lebih baik saat distimulasi dengan hal-hal lucu. PT. Pertamina Tidak Profesional Lima belas menit kemudian baru minyak mulai mengalir ketangki mobil, namun sayang sejak awal Januari 2008 setiap pengisi pertama minyak tidak pernah AS, Abraham Lincoln (1809-1865) meng- Dengan yakin bahkan Chuck Ghal- Dengan tidak mengurangi rasa hormat kami para sopir selaku transportir BBM menyentuh jarum indeks, kurang sekitar 80-100 liter. Petugas hanya bisa menyuruh interupsi sebuah rapat yang sedang ‘ke- lozzi seorang penulis Kanada dengan kepada tuan-tuan selaku penguasa di PT Pertamina seluruh Indonesia pada kami tambah kegudang belakang dengan mengangkat menggunakan ember, cukup tat’ untuk sebuah cerita jenaka yang yakin mengatakan When you lose your umumnya dan kepada kepala instalasi Medan Group PT Pertamina pada khususnya beresiko, terutama saat hujan, tangki licin andai terjadi kecelakaan siapa yang dibacakan stafnya. sense of humor, you lose your footing di Labuhan Deli, dengan ini menyampaikan keluhan sebagai berikut: bertanggungjawab? Cerita lucu itupun dibacakan. Tapi (ketika Anda kehilangan rasa humor, An- 1. Kepala Instalasi (OH) Medan Group hanya mengintai intai kelemahan para 7. Nah disinilah sebab musabab masalah semerautnya BBM keluar dari instalasi apa yang terjadi? Tidak ada yang terse- da kehilangan tempat berpijak). supir mobil tangki yang masuk, misalnya tidak berpakaian seragam tidak memakai Medan Grup PT.Pertamina Lab.Deli, yang pasti K.I beserta seluruh staf karyawan nyum mendengarnya. Entah karena hu- Karena humor itu adalah aura kehi- Badge (tanda pengenal masuk instalasi) atau tidak memakai safty helm. tidak pernah intropeksi diri. Mau menyelesaikan masalah tapi tidak mau kembali mor yang memang tidak lucu atau karena dupan,sebuahgairahyangtakpernahselesai. 2. K.I (OH). Menggunakan alat negara seperti Polisi dan Marinir untuk menjaga kepada akar permasalahan. keamanan tersebut. Jika visi dan misi beliau tidak berjalan sebagaimana yang di suasana hati peserta rapat yang sedang TidakakanadamasalahsepanjangAndatidak harapkan. Muchdir Yen ’bengis’ pada saat itu. melakukannya secara berlebihan. 3. Tapi sayang Instalasi Medan Group tetap semeraut karena para supir tidak Medan ’’Tuan-tuan mengapa Anda tidak Aaaah..., saya jadi ingat Gus Dur lagi.
  • 12. 14 WASPADA Kamis, 7 Januari 2010 FAX.4561347 1 CM Rp. 12.000 3 CM Rp. 36.000 5 CM Rp. 65.000 7 CM Rp. 91.000 9 CM Rp. 126.000 11 CM Rp. 165.000 IKLAN KHUSUS HARGA BELUM TERMASUK Khusus Medan Deli, Marelan, Labuhan, Belawan 2 CM Rp. 24.000 4 CM Rp. 48.000 6 CM Rp. 78.000 8 CM Rp. 104.000 10 CM Rp. 140.000 12 CM Rp. 180.000 6x1,5 kolom Rp. 120.000 PPN 10% Hub. 0812 6390 660 Iklan Anda Dijemput Bursa TIMOR DOHC THN. ‘97 MAJU TEKNIK TERCECER Bursa DIBUTUHKAN RUMAH Dijual di Bumi Asri, LT. 180m, Bangunan 100m, 3 KT, Lingkungan tenang dan nyaman Blok F No. 13, Bursa AUTOMOTIVE Warna biru tua, Pajak Full 1 thn. VR 16. AC 7030118 LOWONGAN KERJA 3 Orang Tk. Pangkas/ Pengalaman BUSANA / ASESORIS Informasi Pembaca Hub. 061-7679 3535 - 0813 9621 6511 76750084 TERCECER Fas. Komplek, Kolam renang, Lap. Tenis, Rmh ibadah, KULKAS, M. CUCI Surat Tanah A/n. Mustafa Kamal. DICARI TK. PANGKAS (Pangkas Full AC/ Jaminan) Kabel underground, Harga 475 Jt/nego Bursa Automotive BURUAN STOCK TERBATAS THN DP ANGS Luas 5106,25. Terletak di Desa Paya ALBAROKAH ECERAN PARFUM AC : Air Condition PS : Power Stearing - Kijang LGX Htm, Diesel, BK Mut, Ban Maxxis ‘01 35 Jt 3,6 Jt DISPENSER (BERGARANSI) Muslim, Berpengalaman, Sopan, Jjr, Hub. 0882.6150.0067 Hub. 0811.300.003 - 0812.656.7676 BR : Ban Radial PW : Power Window - Kijang LSX EFI, Biru ‘01 25 Jt 3,2 Jt Geli Dusun II Kec. Sunggal. Rapi, Hub. Citra Pangkas Jl. Karya Jaya GROSIR DAN CL : Central Lock RT : Radio Tape MENJUAL SEGALA JENIS PARFUM ND : Nippon Denso VR : Velg Racing - Daihatsu Ceria KL + Silver Met ‘02 13,5Jt 1,19 Jt Bursa No. 126A Telp. (061) 7792.9952 DIBUTUHKAN TUKANG PANGKAS DIJUAL CEPAT DB : Double Blower EW : Electric Window - Zebra Espas 1.6 Maroon Met, VS, BR ‘96 14 Jt 1 Jt - Zebra Master Pick Up, Bak 3 Way Hitam ‘04 55 Jt Nego - Isuzu Panther Touring, Hitam, Mulus ‘01 125 Jt Nego ELEKTRONIK HILANG TUKANG LAS BERPENGALAMAN 2 orang yang berpengalaman, 1 unit Rumah Jl. Menteng Raya Komplek NON ALKOHOL & BOTOL-BOTOL JL. SM. RAJA NO. 174 MEDAN (DEPAN UISU) HUB. 0813 7521 8964 - (061) 9134 4210 PROMO DAIHATSU NATAL MERIAH - Isuzu Panther Pick Up 2.4 ‘04 75 Jt Nego Jaminan (50.000) Hub. Pangkas Xenia DP 10Jt-an/angs. 2 Jt-an Terios DP 20Jt-an/angs. 3 Jt-an - Land Cruiser VX Turbo Diesel, 4x4, Mulus ‘96 60 Jt 8 Jt - Mercy E230, New eyes, Hitam ‘96 47 Jt 3,4 JUAL & BELI Surat Tanah No. Supir yg jujur, Rajin Hub Jl. Brigjen. Hamid Km. 6,8 No. 27 Tt. Kuning Jaya Jl. W. Iskandar No. 93 dekat Menteng Indah Blok C No. 20 Medan, PECI MURNI TV, PS1, 2, 3, Handycam, Camera, LCD Projector, Laptop, Luxio 4 Gran Max MB DP 9Jt-an Hub. SM. Raja 368 Simp. Limun 0812.6336.6155 / 0813.7588.7306 sebelah Rumah Makan Aroma Simpang Perjuangan Medan Bunga 2,5 %, Diskon + Hadiah. Hub. Gery 0813 7694 1988 / 77722561 Keyboard, Kulkas, M. Cuci, Tape compo, Sound, dll. Hub. MARKET ELEKTRONIK. Telp. 8210097 - 66900693 01523. atas Harga 300 Jt Hub HP. 0811.630.864 ISUZU Panther LDX ‘91. W. biru Jl. Setia Budi No. 424 B Dkt. Simp. Psr. III T. Sari. DIBUTUHKAN DICARI KOKI DAIHATSU BARU met, AC, TP, VR, BR, Mulus, Komplit. BARU “HARGA” SPECIAL nama: Kudri Rais. Tenaga kerja/ karyawan bergerak, DISEWAKAN RUMAH AC Xenia.............DP 13 Jt-an Mesin terawat. Harga 37 Jt/Nego. dibidang perbengkelan bersedia UTK CAFE 1 ORG TEMPAHAN ISTIMEWA Terios..............DP 17 Jt-an Hub. 061-77395727 / 0813 7575 4321 ditempatkan, di Pondok Kelapa, Pasar Komp. Tasbih Blok EE, KT 3, Gran Max......DP 10 Jt-an - - - PANASONIC MITSUBISHI SAMSUNG - LG - AUX - DAST Jl. Rahmadsyah Merah, Setia Budi, posisi sebagai: 1. Kasir (wanita) SMP/ SMA sederajat WAITRES/ PELAYANAN 1 ORG TERUTAMA PRIA KM 2, Kitchen set, Garasi H. ADAM AKIL HSB Jl. Setia Budi No. 49 A 8223975 Serius !!! Hub. 0852 7003 9888 / 7630 4788 (Agustina) Bursa SEWA - - - GENERAL CHANGHONG - FUJI - DAIKIN SHARP PLASMA CLUSTER No. 305 Kota 2. Doorsmeer (cuci mobil) 3. Mekanik (yg berpengalaman) HUB. 0812.6500.454 Hub. 0878.6904.2716 BUTUH UANG FLOOR 4. Tukang bubut HONDA CIVIC FERIO VTEC ‘96 Wrn. Merah/Orance, VR, CL, CD, Ada STANDING HUB: TOKO SUPER ELECTRONIC Matsum I Medan. Lamaran diantar ke: LOWONGAN KERJA DIKONTRAKAN Sound. No. Pol. Pilihan (BK 4 CR). Tdk kecewa. Khusus pemakai. Harga 74Jt Nego. Hub. 0813 97700119 ANDA BUTUH DANA TUNAI? Jaminan BPKB Spd. Motor, mobil Bunga ringan, data dijmpt. BPKB Aman. Hub. 3 Pk & 5 Pk Jln. Sutomo No. 139 C Simp. Gandhi Luas Lebar 5 M. BENGKEL STAR SERVIS Jl. Setia Budi Psr. V No. 88-S/ 435 Telp. 0813.6125.3678 1. Tukang Bubut khusus bengkel umum berpengalaman 1 unit Rumah minimalis Type 70 (Full keramik), 2 Km Tidur, 1 R. Tamu, 1 Km Malam, PAM, PLN Jl. Karya KONVEKSI KAOS Tel.061-7347810 - 7360741 (Bpk. Ronald Simanjuntak) Menerima Tempahan: 061-6647 7734 / 0813 9779 1077 (TP) Tel. 77982281 MEDAN 2. M e k a n i k s e p e d a m o t o r , Ujung Sei Agul Gg. Wonogiri dekat P. Brayan (khusus MITSUBISHI BARU L300. Angs. 3Jt-an. Pajero Sport (Ready Stock). DANA CASH INSTALASI & PEMASANGAN SERVICE, REPERASI AC - KULKAS Pj. 18,80 M. !!! PELUANG KERJA !!! berpengalaman Muslim) 13,2 Jt/ 2 tahun Hub. 0898.482.5215 T120 SS, Cold Diesel 110 PS, 125 PS, Triton. Serius SANGAT DIBUTUHKAN - KAOS KAMPANYE PILKADA Jaminan BPKB Mobil, Proses TELAH TERCECER Hub. Bpk. Fendy Telp. (061) 7366.885 Hub. (061) 76728071 / 0812 653 3319 BPKB atas nama ABD Rahman, SH. Perusahaan bertaraf Int’l menerima P/ RUMAH DIJUAL PLUS FOTO FULL COLOUR DIJUAL SALAH SATU Cepat & Bunga Ringan. BK 2254 HK. Alamat Jl. B. Katamso W 17 s/d 38 thn untuk ditempatkan DI KANTOR, Syarat: LOWONGAN KERJA Jl. Suluh No. 7 9 Sidorejo Hilir, Gg. Perwira No. 24. Bagi yang Terbuka - KAOS OLAH RAGA, DLL. MITSUBISHI Kuda Diamond Diesel NB: BPKB Dijamin aman & menemukan Hub. 0812 6588 306 - Min. SMA, SMK/ sederajat Bagi mahasiswa Dibutuhkan bbrp Karyawati penjaga LT. 13x50m, LB. 13x20m, Hub (TP) Thn. 2002. H. CRV Thn. 2003 A/T. - Pas photo dan KTP stand makanan: CEPAT DAN EKONOMIS bantu perlunasan BPKB. HILANG - Guntingan iklan untuk interview - Jujur, rajin, rapi, penampilan menarik Hub. 7797 8389 / 0852 7095 4389 Hub. 0812 64077 347 BPKB Mobil Kijang 1984/Pick Up BK Penghasilan: 1,5 s/d 2,5 Jt/ bln 0813.6159.8401 - 0813.6115.7756 - Pendidikan/ pengalaman tdk MITSUBISHI Galant V6 ‘93 Merah Ma- 9947 BH. a/n. Terkelin Manik. Alamat: Info: IBU ALMAIRAH, SE diutamakan Jl. Amal Luhur Gg. Kuini No. 129J Jl. B. Sedap Malam XIV No. 48-A RUMAH DIJUAL roon, Velg Racing, TV Slaiding/Sound sys- tem. Siap pakai & Tidak kecewa. Rp. 52Jt DANA CEPAT Medan. No. BPKB 66954 29-B 0812.6563.9323 Alamat kantor: Jl. Wahid Hasyim No. 118A Barat - Utk ditempatkan di Thamrin Plaza Bawa lamaran dan lgs interview Letda Sujono/ Titi Sewa Benteng Hilir/ (061) 847.5648/ 0811.659.235 Mdn Hub. 0899.4959.020 sebelumnya Nego. Hub. 0812 600 63847 Jaminan BPKB Semua Tahun. TERCECER Telah tercecer Asli Surat Keterangan Sebagai Pedagang NB. Lebih cepat lebih bagus Jl. Bejo depan Nazri Water Uk. 7,5x13m Proses Cepat, Syarat Ringan. Keramik, SHM, Harga 135 jt/nego MITSUBISHI ‘91 Warna Hijau. Velg Pasar Desa Lalang Medan No. 130 Lapangan terbuka a/n. Bahagia Sembiring. Dan No. 139 L. Terbuka LOWONGAN KERJA Hub. (061) 6991.8188, TP Bursa Racing 16” Kaleng-kaleng. Orisinil, tidak kecewa, Jl. Starban No. 52 Polonia. Hub. 0813 96000 793 Hub. (061) 77052032 - 0815 3476 7327 a/n. Sriana Br. Pinem disekitar Jalan Gatot Subroto TERCECER DIBUTUHKAN SEGERA RESMI KE MALAYSIA Dibutuhkan Tenaga Kerja Wanita untuk dipekerjakan RUMAH DIJUAL PERABOT 1 BPKB No. 8603 898-B BK 3961 FI, AKPER 3 ORANG pada perusahaan Electronic terkemuka di Siap huni, Full keramik, 3 KT/ 1 KM + JUAL PERABOT ELITE BEKAS NISSAN READY STOCK SPESIAL BUTUH DANA TUNAI BUNGA RENDAH Pemilik Adelfina, Jl. Rakyat Gg. Malaysia, Kilang COMPANY, bukan KONTREK 1 K. Cuci, Listrik, PAM, AC, Perum. Bukit Dan tmpt tidur engkol 100% baru All New Xtrail Autec, Frontier Double, Pelajar Ujung Medan. (OUT SOURCING), sebagai berikut: Mas Blok E Jl. Binjai Km. 16,5 (dpn SPBU) cabin, Gren Livina, Xgear. Mau lebih 1 - 2 %, 1 Jam Cair. Jaminan, SHM, SK Syarat: WESTERN DIGITAL M SDN. BHD Diski, Hrg 115 Jt/maaf TP Serius hub. (061) 7625.4629 lanjut. Hub. 0812 655 9429 TERCECER Hub. (061) 6962.4460 Camat, BPKB Mobil, Truk, Kreta dan Juga 1 BPKB No. 7445183-B. BK 1129-LY. 1. Umur 23 - 35 thn Syarat-syarat pendaftaran dan seleksi: TEMPAHAN MURAH SUZUKI Forsa GL 87 W. Biru, BK mobil yang masih kredit. Over Leasing Pemilik Suparman. Persilungga I 1. Wanita umur 18 s/d 30 tahun DIJUAL CEPAT - Lemari pakaian 3 pintu Sungkai asli Rp. 1.500.000 tempahan Medan, pajak Bln 10/2010, mulus, dan Bantu Pelunasan BPKB. Hub. (061) No. 19 Bilah Hulu. Lab. Batu. 2. Pakai sepeda motor 2. Pendidikan minimal SMP sederajat 3. Membawa Foto copy Ijazah, KTP, Kartu 1 Unit Rumah Kondisi 90% Selesai. - 1 Set Sofa Kain/ Kulit Rp. 1 Jt-an Hub Telp. (061) 6616802 - 77015252 - 77919797 original, siap pakai. Segera Hub. 0811 656 313 (Hrg. Nego) 8445716, 0813 7044 6633 (Heny) TERCECER 3. Bersedia kerja 12 jam/ hari Keluarga (Asli dibawa sewaktu interview) Jl. Eka Suka Depan Gang Eka Suka Asli Surat Izin Pemakaian Tempat Berjualan Pasar 4. Membawa phasphoto warna 3x4: 3 lbr Sunggal Medan. Stand No. 033 Loosd II A/n. Kacar 9 Gedung Johor. Ukuran tanah 15 SPRING BED DIJUAL MURAH SUZUKI Carry 86 Alexander Dijual. Bursa Br. Tarigan dan Stand No. 036 Loosd II a/n. Mhd. Tolen Ginting. Disekitar Jalan M.T. Simatupang Medan. - Gaji 1,2 Jt/ bulan A. RINCIAN GAJI WESTERN DIGITAL (M) SDN. BHD x 24 M2. Ukuran rumah 12 x 16 M2. Spring Bed 6 kaki 2 lapis Rp. 1.100.000 BK Mdn. Warna Hijau metalik. Harga RENTAL MOBIL Kamar 4 buah, Garasi 1 buah, SHM, 18Jt/Nego. Hub. 061-7786 7583 TERCECER - Biaya operasional/ setiap - Gaji Pokok : RM 550/ bln - Elaun Clean Room : RM 78 IMB. Hub.0878.6829.4842 Spring Bed 5 kaki 2 lapis Spring Bed 4 kaki 2 lapis Rp. 1.075.000 Rp. 1.000.000 IKHLAS RENT CAR 1 BPKB No. 7165744-G BK 1847 LJ. - Tunjangan Shift : RM 107/bln SUZUKI Baleno Th. 97 pemakaian I N N O VA 3 0 0 r b , Av a n z a 2 7 5 r b . Pemilik Pantas Sihombing. Jl. Jend. minggu - Overtime tetap : RM318 (clean room) Spring Bed 3 kaki 2 lapis Rp. 900.000 Thn. 98 Dijual. Warna silver. Harga 63Jt Termasuk Supir, diluar BBM, dlm kota. G. Subroto No. 299/467 Medan. Hub. 0812.6349.8884 @60 jam RM 284 RUMAH DIJUAL SIAP HUNI Spring Bed 3 kaki Dorong Rp. 1.000.000 061-9131 2308. 0852 6118 2406 (non clean room) Garansi Per 10 tahun Hub. 061- 6616802 - 77015252 - 77919797 (Bisa Kredit) (BK Medan masih - Bonus : Bonus Prestasi dan Type Villa panjang) DP Hanya 33 Juta (Nego). TELAH TERCECER tahunan 1. Somerset Regency Blok C-32 Sudah bayar 18 bulan. Hub. 0813 Bursa STNK dan Buku Speksi BK 8711 LK. Bagi yang LOWONGAN KERJA B. FASILITAS: 9768 5402 - 0813 9768 5405 FOTO COPY menemukan harap hub. 0813 9628 2768 Akan diberi hadiah sepantasnya. - Levy subsidy 100% 2. Piazza Residence Blok G-20 Bursa SUZUKI Katana, 91. Biru, AC, Tape, KAMI PERUSAHAAN KONSULTAN TEKNIK - Asrama tiket pulang, kemudahan Type Romans MAKANAN TERCECER kesehatan, Asuransi, berangkat naik Hub. (061) 7717.0099 / 0812.601.0099 VR, BR, sangat mulus, BK Mutasi, Sp. MEMBUTUHKAN TENAGA KERJA ARSITEKTUR pesawat terbang Motor, Supra X 125D, Putih merah. BPKB Nomor 9743285-B, Sepeda Motor Vespa, No. Pol: BK 64443 PG, a/n. SUMIATI, Alamat Jl. - Bagi yang tidak mampu tidak dipungut KAMI PRODUSEN BUMBU PECAL 2006. Satu tangan dari baru. Bougenville No. 2 Lk. II Kel. Pahlawan Kec. Binjai & JURU GAMBAR UNTUK DITEMPATKAN DI biaya proses pemberangkatan. Biaya DISEWAKAN/ DI KONTRAKKAN Dari Surabaya mencari Agen2 Hub. Jl. Selambo 5 No. 3 Medan - Utara Kota Binjai. Bila menemukannya harap KANTOR DAN DILAPANGAN: dipotong di Malaysia setelah TKI bekerja Untuk Sumut dan Aceh Amplas. HP. 0813 7632 6860 TP. dikembalikan kepada nama tersebut diatas 1 (satu) Unit Rumah 3 KT, 2 KM, Hub. UD. Asia 0811.631.699 C. JADWAL PENDAFTARAN/ SELEKSI: SETIAP HARI dan akan diberikan hadiah sepantasnya. 1. SARJANA TEKNIK ARSITEKTUR KERJA Full keramik, PLN 1300 Watt, PAM TOYOTA BARU AVANZA, RUSH, INNOVA, FORTUNER, YARIS, VIOS, HILANG 3 Buah BPKB Sepeda Motor atas nama 2. STM/ SMK JURUSAN GAMBAR GEDUNG D. PT. MUTIARA KARYA MITRA ADALAH PJTKI TERBANYAK MENGIRIM TKI KE WESTERN DIGITAL M SDN. BHD & Telp, di Jl. Bukti Barisan No. 26 TERSEDIA STAND Medan (dekat Kampus UMSU) ALTIS, CAMRY, HILUX. DP + Bunga Ringan. Hub. 0813 7512 7297 - (061) 7795 1428 - Hinsa Tamba BK 2619 CM - Lamsyah Damanik BK 5313 VQ Persyaratan: Segera daftarkan diri anda sekarang juga ke: Hub. 0812.607.4410 FOOD COURT - Purnomo Putro BK 4796 DR PT. MUTIARA KARYA MITRA Mohon dikembalikan kepada Bp. Hinsa 1. DIUTAMAKAN BERPENGALAMAN UNTUK Untuk menjual makanan halal diutamakan TOYOTA Kijang Kapsul 1.8 Dijual. Tamba. Yang beralamat Jl. Kawat II No. 89 BANGUNAN GEDUNG JL. KAPTEN MUSLIM NO. 89C MEDAN DIJUAL Thn. 97. Suzuki Katana Thn. 94. A Gg. Keladi Lk. 15 Kel. Tanjung Mulia Medan. TELP. (061) 845.2956 (DEKAT RSU SARI MUTIARA) Rumah permanen 3 unit Jalan Manunggal/ penjual Martabak Telur, Mie Goreng In- Mobilt erawat/AC Dingin. Hub. 2. MAMPU MENGOPERASIKAN PROGRAM Contact Person: Mega 0813.6220.2213 0857 6155 5800 / 7798 3400 AC, KULKAS, M. CUCI, P. CLEANER, GENSET HILANG Ecy: 0813.7515.5055 - 0812.640.80074 Jermal XII, Panglima Denai, Lokasi depan donesia & Seafood, Lontong & Nasi Sayur AUTOCAD, MICROSOFT OFFICE DAN Ibu Veronika: 0878.6827.7444 Perumahan Jasari Manunggal TOYOTA KJG LSX Up Solar Model LGX New AC, 1 Pk, 1,5 Pk, 2 Pk=1,5Jt s/d =1,9Jt, AC Air Cooler=975rb. Kulkas, 1 Pt=450rb s/d =900rb, 1 (Satu) Lembar Berkas Surat 3 DIMENSI 1. Luas Tanah 5x20m² Luas Bangunan 5x18m² Antar langsung: Thn. 2002. Silver met, sgt orisinil Spt. Baru, BPKB 1 nama, VR, BR, PS, PW, CL, E. Miror, 2 Pt=650rb s/d=1,3Jt, K. Mini=500rb, K, 2 Pt. Keterangan Tanah (SK Camat 3. BERSEDIA DITEMPATKAN DI LUAR KOTA 2. Luas Tanah 9x20m² SPBU Singapore Station AC, DVD, MP3, USB, Hrg. 130Jt. Sudah BBN Jumbo=2 Jt, M. Cuci, 2 Tb=600rb, 1 Tb=900rb s/d =1,4Jt. P. Cleaner=1,2Jt, Genset, 9000W. Percut Sei Tuan) a/n. Adi Bursa Luas Bangunan 8x16m² 3. Luas Tanah 9x34m² “S24 MINIMART & PHARMACY” Nama Pembeli. Hub. 061-9135 6484 Mahmud Pariono. Tanah Surat Lamaran Diantar ke Kantor: 7500W, 1200W=950rb s/d = 6000jt. HARIAN WASPADA dengan kode GH ‘10 PROPERTY Luas Bangunan 7,5x20m² Lokasi pinggir jalan 4 meter Jl. Brigjen Katamso No. 226 Medan TOYOTA Kijang Capsul LGX Th. 2000. W. Coklat. TV, PS, DVD, HANDICAM, CAMERA, PROYEJTOR, LAPTOP, KEYBOARD terletak di Jalan Pendidikan Surat SHM & Harga nego Met Tangan pertama komplit. AC DB, Tape, TV 43” LCD LG=6Jt. 53”Sony= 8,5Jt 34” Sony= Gang Sugeng Dusun X Desa Informasi Pembaca Hub Pemilik langsung: Selambat-lambatnya 1 (satu) Minggu VR, BR, PW, CL, PS, Remot. Mulus, Original body kaleng Hub. 0812 6085 8594 Mdn. 2,5Jt - 32” M. Bishi =2Jt, 29” Baru/Bekas=900rb s/d =2,3Jt, 14/21”=300rb s/d 975rb. DVD=260rb, Sei Rotan Kecamatan Percut LOWONGAN KERJA Bursa Property BPK. AKBAR HP. 0812.6309.5276 TV DVD Vortable=1,2Jt, PS 1=400rb, PS2=1 Jt, Sei Tuan Seluas 11 x 17 Meter. ELEKTRONIK DI MALAYSIA GR : Garasi LB : Luas Bangunan Bursa TOYOTA Kijang Grand Extra ‘96. AC, PSP=1,8Jt. Laptop Celeron: 3,5Jt. Handicam/ TANAH Tape, VR, Wr. Hijau mulus, Commando Bursa Camera, Mini DV, DVD, HI8 =500rb s/d 2,3Jt. P.Yejtor Epson 3,5jt, KN-7000=27jt, Ampli, spk, TELAH HILANG Peluang kerja LANGSCUNG (COMPANY) KM : Kamar Mandi LT : Luas Tanah KP : Kamar Pembantu RM : Ruang Makan MATERI BANGUNAN Long. BK Mdn asli. Hub. 0811 650 674 ALAT MUSIK power,Power, Mixer, BMB, Yamaha, Peavey, dll. di Perusahaan Elektronik terkemuka di KT : Kamar Tidur RT : Ruang Tamu TANAH DARAT JUAL PERKAPLING DIJUAL KEYBOARD KN-7000 Hub. Senang Hati: 4517509 - 7707 3637. Jl. Sekip 67 A SK Bupati No. 22872 / Selangor, Malaysia HIROSE ELECTRIC (M) SHM: Sertifikat Hak Milik Siap bangun & strategis ±4 Km ke Kualanamu/ Pgr jln alternatif berhadapan dgn kav. angkasa pura, TOYOTA COROLLA DX TH. 80/81 Kondisi 90% Baru Lkp. Kotak. Sangat A / III / 4 Luas 930 M2. 10x24 net Rp. 20 Jt SK Camat, Cepat mendapat hub. istimewa. Hub. 8210097 - 66900693. SDN. BHD dengan persyaratan sebagai RUMAH 3 PINTU DIJUAL W. Merah, BK Mdn Asli, AC, Tape, VR, BR, (061) 7641.5320/ 0812.6078.8884 Cat mulus. H. Nego. Hub. 0812 6599 2655 MARKET ELECTRONIC. Jl. Setia Budi Bursa Atas nama: Karin. berikut: Hanya Rp. 55 Jt/ unitnya lokasi Jl. Jermal VI No. 424 B. Dkt. Simp. Pasar III T. Sari. PERCETAKAN Hilang sekitar Jl. AH. Gg. Bidan VI Hub. 7778.4688 - 7635.0413 KEBUN SAWIT DIJUAL - Wanita, umur: 19 s/d 33 tahun Luas 3 Ha Lokasi di Simp. Empat TOYOTA KIJANG COMMANDO DASHBOARD SEDAN. Thn. 95. Abu-abu metalic, AC, Tape, CL, Remot, VR, BR. Bursa Nasution. Bagi yang - Tamat SMU/ sederajat RUKO Dijual di Jl. Karya Ujung No. 227 (RM. Cikampak, Lab. Batu Selatan, Mobil cantik sekali luar dalam. Hrg. 63,5Jt. Damai. Hub. RUMAH MAKAN SURYA BARU Jl. Karya No. 90 Sei KOMUNIKASI menemukan Hub. - Mendapat izin Orang Tua/ keluarga Ganti Salero), Cocok untuk usaha apa saja Pinggir jalan, SHM, TP Agul 20 Mtr. Dari Simpang (4) Lampu Merah. 0812 600 22211. - Lulus test awal dan test kesehatan tempat strategis/ ramai Rp. 575 Jt/damai Hub. 0812.6532.0225, TP OASIS REFILL - Bersedia kontrak kerja minimal 2 tahun Hub. 0812.635.6660 - 0819.202.9139 TOYOTA KIJANG SUPER THN. 90 MURAH. TRANSAKSI CEPAT. DEPOSIT AMAN Tidak akan dituntut TANAH DIJUAL T-SEL I-SAT dan diberi hadiah - Terbuka untuk para mantan RUMAH Dijual Jl. Gaperta Gg. Encong Lengkap, AC, Tape, VR, Grill Baru. 40Jt. 5 = 5.075 10 = 9.750 5 = 5.250 10 = 10.250 No. 97, Uk. 7x16mtr, Keramik 3 KT, SHM, 3 4 x 3 6 m Te m b u n g / S e i Hub. 0816 310 4197 / 7790 5359 20 = 19.350 20 = 20.025 sepantasnya. FASILITAS: Rp. 160 Jt/damai Rotan Hub. 415.6506 HP . 25 = 24.700 25 = 24.725 - Gaji Pokok RM 515/ bulan Hub. 0812.6464.053 / 0856.6838.0743 TOYOTA SOLUNA GLI THN. 2000 50 = 48.100 50 = 49.000 Wrn. Merah met. No. pol. Pilih, Tanpa Seri. BK Asli Medan. BPKB 1 nama, Asli cat mulus TRANSAKSI 24 JAM. CS OPERATOR 24 JAM Bursa - Tunjangan kehadiran RM 40/ bulan DIJUAL SEGERA LOKASI SANGAT STRATEGIS 0813.6234.9799 Pak Yan 100%. Siap pakai. Khusus pemakai. Hrg. DEPOSIT MIN 50RB. BIAYA ADMINISTRASI GRATIIISSSS....!!!! ALAT MUSIK - Tunjangan shift pagi RM 1.50/ hari 1 Unit RMH PERMANEN (SHM) Type 70 Lokasi strategis Komp. 76Jt Nego. Hub. 0812 6000 709 HUB. 0852 8868 9977.cs1_stok_refil. VILLA SETIA BUDI PERMAI, SETIA BUDI/ Jl. Kenanga Sari No. TANAH DIJUAL Pendaftar an via SMS ketik: - Tunjangan shift sore RM 4.00/hari 5 Psr. 2 Tj. Sari Medan (200m dari Jl. Besar Setia Budi) Khusus Luas ± 9.646m² (SHM), Lokasi Jl. Ceremai, Muslim Hub. 0856.5811.8887 (Tanpa perantara) TOYOTA Starlet 1.3 SEG Th. 95. DAFTAR#NAMA#NO HP#ALAMAT Kirim ke 0852 - 8868 - 9977 - Tunjangan shift malam RM 6.50/ hari ±300m di belakang Ktr. Walikota T. Balai Asahan, Cocok buat perumahan atau W. Abu-abu Met. BK Medan, lengkap. Daftar harga dan info lengkap di http: //oasisrefill.blogspot.com - TUnjangan makan RM 2.00/ hari RUMAH & TANAH DIJUAL kantor yang berminat h u b . Te l p. 0813.7034.7690 - 0812.6524.6331 Harga damai. Hub. 77644156 Alamat Pendaftaran dan Deposit langsung: - Berangkat dengan pesawat terbang Di Jl. Balam Sei Sikambing B Medan, dan (061) 7734.9075 (TP) Jl. Besar Tembung PSR IX (dari Medan Luas ± 530m Peminat hubungi Amri TOYOTA BARU Ready Stock Innova B/D, Fortuner B/D Rush, Hilux sesudah pajak gambir sebelum lapangan sebelah kanan) Pasang * Testing dilaksanakan pada hari: Senin Tgl. 11 Januari 2010 HP 0811.647.434 - (061) 7782.2222 . TANAH DIJUAL, TP (PU) (DC). Avanza, Yarris, Vios. DP + Bunga Ringan. ATAP & DINDING EURODEK Hub. 0813 70 333 221 - 061.77011221 Service Iklan Mini Pendaftaran dilakukan setiap hari kerja RUMAH DIJUAL Hak Milik, Luas 1.218m² (60x21) ALUMINIUM ZINC - AZ - 150 ELEKTRONIK dengan membawa: Uk. LT. 15x16,5m, LB. 13,5x9, letak di Jl. Pasar I Desa Tanjung Sari TOYOTA LSX - Up ‘01. W. Silver Copy KTP, Pasphoto 3x4: 2 lembar, Copy 3 KT, RT, RK, Rp. 250 Jt Jl. Amal/ Kec. Medan Selayang met. EFI 1.8 Bensin. Kond. SERVIS SERVIS CUCI AC, ISI FREON, BONGKAR PASANG. “WASPADA” REPARASI, KULKAS, MESIN CUCI Ijazah, Copy KTP orang tua/ yang Jl. Sehat II No. 1 Kec. Sunggal Hub. 0811.877.252 - 0813.9696.7016 Terawat/Mulus. BK Mdn, Pjk Full 1 Thn. Hub. 061-7794 3668 AC Hub. DIFA SERVIS 0813 9735 7061 061-69644786 memberi izin, Copy Kartu Rumah Tangga (Tidak dipungut biaya pendaftaran) HP. 0813.7693.9327 - 0852.7864.0456 DIJUAL CEPAT PAGAR EURO R AC REPARASI, BKR PSG, SPARE PARTS AC - KULKAS - MESIN CUCI Untuk pendaftaran datang langsung ke: RUMAH DIJUAL/ B.U Tanah Kavling Uk. 14x25m, di DIJUAL CEPAT Hub: MADINA SERVICE GALVANIS TOYOTA Yaris Thn. 2008. BK 0812 6566 7521 061-77972065 PT. AL WIHDAH JAYA SENTOSA Simp. Pos Padang Bulan masuk Gg. Jl. Gaperta/ sblh Komp. Toshiro Siap Ditempat & Bergaransi Jl. Setia Budi No. 74-C Bersama, Cocok untuk anak2 kos, Jaya, Lokasi bagus/ SHM, Harga Medan, kondisi mulus 95%. S. Matik. Warna Hitam Hanya Rp. 165 Juta Nego. TP. Hub. 0813 6223 9989 AC REPARASI AC, KULKAS, MESIN CUCI Kompor Gas, Dispenser H & C TV, M. Pompa Air Sanyo Hub. SURYA TEKNIK SERVICE Telp. 66482216 - 0813 7589 8757 Siap Ketempat Telp: 061 - 4576602 4151359 (Sebelah Showroom Yamaha, dekat simpang Jl. Sei Serayu) Medan 20122 Telp. (061) 821.5444 (Hunting) dekat dgn 4 Kampus, LT. 200m, LB. 110, KT 3, KM 2, Harga 100 Jt/nego Yg cepat beruntung HP. 0831.9831.2253 - 0882.6154.4895 bisa nego Hub. 0812.6418.650 - 0812.6077.536 TANAH KAVLINGAN MURAH EUROMESH R BAJA U-50 KOLOM PRAKTIS Uk. 7x18m Jl. Binjai Km. 15 Diski EURO R Gg. Tepas, SK Camat, Cuma 3 BAJA U-50 - Kavling, Siapa cepat dia dapat SIAP PAKAI - LEBIH PRAKTIS & HEMAT - Hub. Segera (061) 9153.1980 DARI BESI BETON PRODUKSI: TANAH DIJUAL PT. REZEKI PRIMA JAYA ABADI Jl. Sutomo No. 436 Medan 20231 Jl. Beringin Kompleks (samping Bank Maspion) Telp. (061) 452.2588 - 415.7504 - 455.7204 - 455.71494 Wartawan Sidorukun, Medan, Fax. (061) 415.7504 SUMUT - INDONESIA Uk. 14x29m, SK Camat Hub. 0819.3420.0567 Tanpa perantara Bursa PERKEBUNAN DIJUAL BIBIT TANAMAN PERKEBUNAN Kehutanan, Buah-buahan, Ternak dan pengering Hub. (061) 6644.087 HP. 0813.7505.1360 (Rizal N) Bursa Service PELUANG BISNIS KONSTRUKSI WC TUMPAT, Sal. AIR, K. Mandi TUMPA Tel. 081361718158, 77008458 NARO SERVICE Jl. Sisingamangaraja WC TUMPAT/ SEDOT PELUANG USAHA 77442112 PEMASANGAN DEPOT AIR MINUM Jl. Gatot Subroto Medan ISI ULANG PALING MURAH Ada Garansi SESUAI KEMAMPUAN ANDA TUMPAT Jl. P. BRAYAN 1. DEPOT RO 40 S/D 400 GALON/ HARI WASPADA WCADI 081.2642.71725 844.2246 GARANSI 2. DEPOT AIR MINERAL/ PEGUNUNGAN - TERIMA SIAP UTK JUALAN - LENGKAP SERTIFIKAT DEPKES Harian Ingin Promosikan UD. RIZKY ABADI JAYA WC TUMPAT 8442271 0813 7035 7291 Jl. Setia Budi JL. VETERAN PSR. X (DPN MESJID AL HIDAYAH) HELVETIA TELP (061) 7640.1678 . 0813.7580.8866 Produk Anda Harian WASPADA MINI & EFEKTIF MINI & EFEKTIF Media yang Tepat IKLANKAN PRODUK ANDA IKLANKAN PRODUK ANDA untuk Iklan Anda
  • 13. Ekonomi & Bisnis 15 WASPADA Kamis 7 Januari 2010 Beras, Gula Ancaman Inflasi Tahun Ini tiran terhadap kenaikan harga Wakil Menteri oleh Presiden beras dan gula,” jelas Rusman. Yudhoyono. Rusman menambahkan Dia menjelaskan pada masalah ancaman inflasi di 2010 harus diantisipasi, salah awal tahun hingga pertenga- satunya pergerakan harga ko- han tahun 2010 lebih masih moditas jadi harga minyak dipengaruhi faktor internal. yang sekarang sudah 80 dolar Rencana batalnya kenaikan ta- AS per barel, jauh dari harga rif daya listrik (TDL) tahun ini asumsi APBN. cukup membantu mengura- “Artinya, kita akan melihat ngi tekanan inflasi di 2010. Ia dampaknya dari sisi peneri- juga memperkirakan angka maan negara kenaikan harga inflasi 2010 bisa mencapai 5 itu, tapi di sisi lain adalah sub- persen. sidi,” papar Sri Mulyani. Waspadai kenaikan subsidi Dijelaskannya, meski kon- Sementara itu Menteri Ke- sumsi subsidi dikontrol tapi JAKARTA ( Waspada): ditemui di Istana Negara, Ja- uangan Sri Mulyani Indrawati karena pertumbuhan ekono- Kenaikan harga gula dan karta, Rabu (6/1). mengatakan pihaknya me- mi diharapkan lebih tinggi, beras memasuki awal tahun Rusman menjelaskan kha- waspadai peluang kenaikan maka konsumsi BBM yang 2010 ini diperkirakan men- watiran tersebut cukup bera- belanja subsidi sebagai kon- subsidi itu seperti premium jadi ancaman kuat bagi in- lasan karena komoditas seper- sekuensi atas penambahan dan diesel atau solar kemung- flasi 2010 khususnya hingga ti gula akan mengalami masa konsumsi BBM bersubsidi ka- kinan akan meningkat. semester I. Gejala-gejala an- paceklik cukup panjang yaitu rena peningkatan pertumbu- “Jadi, kita akan melihat Waspada/Armin Nasution caman kedua komoditi ter- hingga April-Mei. Meskipun han ekonomi. dari variabel ini, tahun lalu, CHIEF ECONOMIST: Jhon Tafbu Ritonga (kiri) usai penetapan sebagai chief economist BNI 01 bersalaman dengan pemimpin sebut telah terasa diminggu ia mengatakan beberapa ke- “Untuk sementara, saya kita dapat subsidi BBM di ba- BNI M. Adil (kanan) di gedung bank milik pemerintah itu, Rabu (6/1). pertama Januari 2010. butuhan pokok telah menga- bisa katakan mungkin dam- wah yang dianggarkan, tahun “Pada minggu pertama lami penurunan sepert daging paknya belum terlalu signifi- ini, kita akan lihat sebagai sa- ini sudah ada gejala yang ayam, telur ayam, cabai dan kan antara penerimaan dan lah satu netto-nya, yaitu pene- BNI 01 Yakin Dana Pihak Ketiga Terus Tumbuh perlu diantisipasi sebenar- nya. Seperti harga beras, da- lain-lain. “Kalau Januari itu memang belanja subsidi, relatif agak bi- sa berimbang. Tapi, untuk rimaan yang naik karena har- ganya yang tinggi dikurangi MEDAN (Waspada): BNI ini akan terus membaik di bagai penambahan layanan lam minggu ini saja sudah sering bikin kejutan. Tapi mu- jangka panjang, mungkin kita subsidi untuk premium dan yah, maka manajemen bank wilayah 01 optimis jika dana 2010. Sehingga kita optimis serta rencana bisnis yang ada naik 4 persen dibandingkan dah-mudahan karena masih harus mewaspadai kalau jum- solar karena minyak tanah su- milik pemerintah ini memi- pihak ketiga (DPK) yang di- jika target DPK tumbuh antara optimis mencapai target,” je- rata-rata Desember. Ini da- ada harga komoditas yang tu- lah subsidinya meningkat,” dah relatif dipindahkan ke el- lih Jhon Tafbu Ritonga seba- himpun pada tahun 2010 akan 30 persen-35 persen,” jelasnya. lasnya. lam 1 pekan. Kemudian gula run, daging ayam, cabai, dan kata Menkeu di Istana Negara piji itu akan jadi faktor pengu- gai chief economist BNI wi- tumbuh antara 30 persen-35 Adil mengatakan diban- Sementara Jhon Tafbu naik 13 persen,” kata Kepala yang pokok-pokok. Jadi masih Jakarta, Rabu (6/1), usai meng- rangnya,” katanya. layah 01. “Kita berharap ke- persen. Hal itu sejalan dengan dingkan 2008, maka DPK BNI Ritonga mengatakan dilihat BPS Rusman Heriawan saat bisa mengimbangi kekhawa- hadiri pelantikan Seskab dan (dtc/ant) hadiran John Tafbu Ritonga prediksi kondisi perekonomi- wilayah 01 tumbuh hingga dari kemampuan Indonesia semakin memajukan pere- an yang lebih baik dari tahun 20,28 persen. Selain itu, penya- melewati berbagai tantangan, konomian di wilayah ini. Se- lalu, kata pejabatnya. Pemimpin BNI kantor wilayah 01 M Adil mengatakan luran kredit kepada sektor UKM (dengan pagu dibawah Rp10 miliar) tumbuh 37,99 seperti krisis di 1998 hingga sekarang, goncangan politik maupun dampak krisis global, kaligus juga meningkatkan peran BNI dalam mendu- kung perekonomian di Su- Pertamina Asuransikan hal itu kepada wartawan di- sela-sela penetapan dekan fa- kultas ekonomi USU Jhon Taf- bu Ritonga sebagai chief eco- persen dan kredit sektor me- nengah tumbuh 18,81 persen. Selain karena pengaruh ekonomi, pencapaian target tak akan membuat ekonomi lebih buruk. “Hal ini juga harus didu- kung dengan konsistensi para mut-NAD,” harapnya. Jhon Tafbu Ritonga me- ngatakan kehadirannya di BNI diharapkan dapat Korban Kecelakaan Elpiji nomist BNI untuk wilayah 01 DPK ini juga akan dilakukan pemegang otoritas untuk membantu masyarakat, ter- TEBINGTINGGI (Was- pai di tangan warga sudah se- ngan pemberian tabung gas persoalan, walikota berharap di Medan, Rabu (6/1). dengan memperbanyak outlet menjalankan tanggung jawab- utama untuk lebih menge- pada): Pertamina memberi- suai dengan standar industri elpiji, dilakukan edukasi kepa- agar warga yang menerima Dia mengatakan secara BNI di wilayah 01 yang ditar- nya masing-masing serta depankan fungsi dari lem- kan jaminan asuransi kepa- Indonesia. Itu artinya produk da masyarakat. Untuk kota tabung gas elpiji, mempelaja- umum perekonomian, baik getkan bertambah 15 unit. menjalankan prinsip-prinsip baga perbankan. da warga yang mengalami sudah aman digunakan. Na- Tebingtinggi, kata penyalur rinya secara baik melalui pe- nasional maupun di wilayah “Kita juga sudah memiliki ekonomi pasar. Seperti beru- “Ma s y a ra k a t m a s i h kecelakaan dalam program mun, jika ternyata produk itu dari PT Info Cahaya Hero Di- nyuluh. kerja BNI meliputi Sumut- layanan weekend banking dan saha untuk bekerja lebih baik. perlu mendapat edukasi konversi dari minyak tanah salah dan menimbulkan kece- dik, disiapkan tujuh tenaga Usai pelaksanaan edukasi NAD, akan bertumbuh lebih juga mengoperasikan mobil Saya yakin ekonomi kita tum- dan pemahaman tentang ke elpiji. Namun jaminan lakaan bagi pengguna, Perta- edukasi, disamping relawan yang dilakukan pelaksana, se- baik dari tahun sebelum-nya. BNI keliling yang menyedia- buh pesat,” tegasnya. masalah-masalah ekonomi, asuransi itu hanya diberi- mina menjaminnya dengan yang intinya dari kepala ling- jumlah warga yang dikonfir- “Hal ini terlihat dari kon- kan berbagai layanan bagi na- Adil menambahkan seja- keuangan dan perbankan. kan kepada warga yang me- asuransi. Tapi, jika kesalahan kungan. “Merekalah yang masi mengaku telah memaha- disi perekonomian yang sam- sabah. BNI pun berupaya lan kebijakan BNI untuk lebih Hal ini yang menjadi salah ngalami kecelakaan akibat itu karena ulah pemakai tidak akan bekerja memberikan mi cara penggunaan gas elpiji pai saat ini berjalan sesuai menggaet kembali nasabah menggali potensi perekono- satu hal yang akan saya la- kesalahan produk, sedang- ada asuransi, tegas dia. edukasi kepada masyakat itu. “Saya sudah tahu menggu- jalurnya. Kita melihat, kondisi lama. Sehingga, dengan ber- mian di masing-masing wila- kukan,” jelasnya.(m13) kan karena kesalahan dila- Selain itu, program penga- pengguna,” kata dia. Upaya nakannya, Tadi sudah dikasi kukan pemakai tidak men- manan atas kemungkinan ter- pengamanan juga dilakukan tahu caranya,” ujar Baharud- Bursa HYPNOTIS Ingin spt Romi Rafael/ Uya Kuya? Telah dibuka Kelas Pendidikan HYPNOTIS Pertama di Medan, manfaat dapat jaminan, kata peja- jadinya kecelakaan pemakai- dengan sosialisasi yang telah din Batubara, warga penerima PENGOBATAN mengubah sifat negatif menjadi Positif. Pengobatan batnya. an telah dilakukan melalui ber- dilakukan jauh sebelum pe- tabung gas dari Kel. Pabatu. Medis/ Kejiwaan, Fobia, trama, ketergantungan obat²an, dll. H u b . E S P Tr a i n i n g C e n t e r Hal itu disampaikan SR bagai prosedur, sehingga da- nyerahan, kata Supriadi dari HP. 0813.6165.7799 Jl. Gn. Singgamata KUSUK & LULUR No. 26 Krakatau (dekat UMSU) NB. 10 Pendaftar pertama Disc. 50%. Pelatihan 1x I Pertamina NAD/Sumut lam pemanfaatan tabung gas pelaksana lapangan di Kota Harga internasional HUB. MBAK DINA seminggu, Sabtu 16.00-18.0 Wib, 8x Pertemuan, Roby Chairon Djasmy, Rabu elpiji diharapkan tidak terjadi. Tebingtinggi. Terkait hal itu, Kabag Pere- mulai belajar 16 Januari, izin terdaftar, Bersertifikat 0812.6499.1979 (6/1), saat berbincang ter- Salah satu upaya itu, kata Chai- Walikota Tebingtinggi Ab- konomian Ahmad Kaloko Bersedia dipanggil di tempat kait pemberian seperangkat ron, adalah pelaksanaan edu- dul Hafiz Hasibuan mengata- disela-sela acara mengatakan HIDUP SEHAT tabung gas elpiji, kepada kasi sebelum penyerahan ta- kan program konversi itu me- pasca pelaksanaan konversi, DENGAN NUTRISI 30.118 warga Kota Tebing- bung gas kepada warga. Pem- rupakan kebijakan pemerin- minyak tanah subsidi untuk UST. SEMBARA NAIK TURUN BERAT BADAN tinggi. Acara itu, dihadiri berian tabung gas harus be- tah untuk mengurangi subsidi Kota Tebingtinggi, masih akan DENGAN DZIKIR & DO’A 5 - 7 KG/ BLN Walikota Tebingtinggi Abdul nar-benar sampai kepada bahan bakar yang selama ini tetap disalurkan hingga akhir MASALAH, GANGGUAN TPT (PROTEIN DAN NUTRISI BUAH-BUAHAN) Hafiz Hasibuan, Camat, Lu- yang berhak dan si penerima dilakukan. Atas dasar itu, ma- Januari 2010. Program subsidi ANGKER, KERAMAT, PUAKA, rah dan warga penerima di sudah harus diyakinkan betul syarakat diharapkan meman- minyak tanah akan berakhir Jangan Lewatkan Interaktif langsung HANTU ILMU HITAM, SANTET, dengan PASAK BUMI di DELI TV Setiap halaman Kantor Camat Kec. memahami bagaimana me- faatkan pemberian bantuan total pada April 2010. Selama KESURUPAN, BUANG SIAL, JL. KLAMBIR V NO. 152 Sabtu Malam Pkl. 22.30 Wib (Live) Padang Hulu. manfaatkan pemberian itu, itu dengan baik. Untuk me- periode itu, secara perlahan SELESAI DGN MUDAH KP. LALANG MEDAN Call Center: 0818 090 73481 Dia katakan produk el- kata dia. ngurangi berbagai kesalahan akan ada pengurangan jatah HUB. 0858.3178.1080 piji ukuran 3 kg, ketika sam- Selain itu, bersamaan de- yang nantinya menimbulkan subsidi, kata dia. (a08) Pengobatan Alat Vital H. Suhendar Besar dan panjang di tempat Klinik H. Suhendar di bawah SEBELUM SESUDAH Telkomsel Patuhi Regulasi Pemerintah MEDAN (Waspada): Tel- nal perusahaan, Telkomsel perhatikan segala aspek yang 2010, serta pelanggan Kartu As SOLUSI TEPAT komsel mematuhi regulasi juga selalu menghormati se- mendorong terciptanya iklim di daerah Nanggroe Aceh Da- Tidak ada hasil, Mahar kembali kontrol dan pengawasan langsung - UNTUK MENGECIL PERUT BUNCIT - GEMUK SETELAH MELAHIRKAN pemerintah melalui BRTI tiap keputusan diambil peme- kompetisi industri telekomu- russalam, Sumatera Utara, Ditangani secara profesional H. SUHENDAR Alami bukan suntik, menggunakan - TERLALU KURUS (Badan Regulasi Telekomu- rintah Indonesia. nikasi yang sehat. Itu sebabnya Lampung, Jabodetabek, Ban- metode terapi dan ramuan tradisional, Diberitahukan kepada masyarakat HUB. SEGERA UNTUK MENDAPATKAN nikasi Indonesia) melarang Begitu pula dengan kebija- untuk mendukung kebijakan ten, Sukabumi, Bali, Nusa TEST LEMAK, SAMPEL PRODUC Paling aman tidak ada efek samping untuk berhati-hati terhadap pengobatan SOPY : 0813.6113.3880 para penyelenggara tele- kan BRTI ditujukan ke seluruh tersebut, mulai 6 Januari 2010 Tenggara Barat, dan Nusa sejenis yang mengaku-ngaku kerabat WIDA : 0852.6520.8998 komunikasi mengadakan operator selular tertuang da- Telkomsel menghentikan pro- Tenggara Timur yang meng- H. Suhendar sudah di kenal sebagai pakar GARANSI 30 HR UANG KEMBALI kejantanan yang sudah berpengalaman, atau saudara, soal cara boleh sama program SMS gratis antar lam Surat Plt Dirjen Postel sela- gram SMS gratis antar opera- aktifkan kartu perdananya sanggup mengatasi keluhan alat vital khusus tapi keahlian yang membedakan operator. ku Ketua BRTI No. 306/BRTI/ tor,” tegas Sarwoto. mulai 16 Desember 2009. pria, memperbesar, memperpanjang “H. MOHD. RAWAL” Direktur Utama Telkom- XII/2009 tertanggal 30 Desem- Sebagai bentuk kepatuhan Telkomsel juga menggelar (garansi), meningkatkan Untuk keluhan dan pengaduan silahkan SPECIALIST AMBEYENT TANPA OPERASI sel Sarwoto Atmosutarno kekerasan, tambah Mahar hubungi langsung: ber 2009 tentang Program Pro- terhadap kebijakan pemerin- program SMS Mania, di mana kuat dan tahan lama Rp. 500 ribu PUTUS SAMPAI KE AKAR2NYA DIJAMIN mengatakan Selasa (5/1), mo Layanan Telekomunikasi, tah, Telkomsel mengadakan hanya dengan Rp 1.000 pe- H. SUHENDAR HP. 0812.131.6364 TDK SEMBUH UANG KEMBALI GARANSI dalam berhubungan Jl. Tempuling No. 43 B - Serdang sebagai perusahaan bero- di mana para penyelenggara program SMS gratis ke sesama langgan Kartu As dapat mengi- Ciri2 Ambeyen: Disekeliling Dubur Ada (masuk Gg. Sado) Medan Benjolan Seperti Daging Tumbuh/Jerawat, perasi di Indonesia, di mana telekomunikasi dilarang me- Telkomsel untuk mengganti rimkan 50 SMS ke seluruh no- Telp. (061) 663.4220 Gatal, B.A.B Keras, Keluar Darah Segar. mayoritas sahamnya dimi- nawarkan tarif nol dalam pro- program SMS gratis antar ope- mor Telkomsel berlaku mulai Susah Duduk Seperti Ada Yang Mengganjal. liki pemerintah melalui Ba- Saksikan !!! Duduk Serba Salah. Nyeri (Ngilu). Dubur mosi dan memberikan bonus rator. Melalui program ini, pukul 00:00 hingga pukul Interaktif bersama Bpk. H. SUHENDAR Seperti Luka, Solusinya Datang dan dan Usaha Milik Negara Tel- gratis untuk layanan SMS lin- pembeli paket perdana Kartu 18:00. Dengan harga sama, di TVRI Nasional Medan. Setiap Sabtu Berobatlah ke kom, Telkomsel selalu men- tas penyelenggara telekomu- As dapat menikmati 50 SMS pelanggan Kartu As juga akan Malam Minggu Pukul 20.00 WIB “H. MHD. RAWAL” jalankan usahanya sesuai nikasi. gratis ke seluruh pelanggan memperoleh 500 SMS yang PUSAT: Jl. Prof. H.M. Yamin S.H (Serdang) No. 251 A regulasi yang berlaku dalam “Pada prinsipnya Telkom- Telkomsel (kartuHALO, sim- dapat dikirimkan ke sesama EYANG NAGA INTEN WASIRI Simpang Pahlawan Tel.(061) 4563067 Cabang I Jl. Bunga Harum (Benteng) No. 26 Suka Jadi belakang Brimob Pekan Baru mendukung perkemba- ngan industri telekomuni- sel selalu comply terhadap re- gulasi pemerintah, di mana PATI, dan Kartu As). Program ini berlaku bagi pengguna Telkomsel mulai pukul 00:00 hingga pukul (Untuk Ambeien) Telp. (0761) 45368 HP. 0812.656.8700 kasi di Indonesia. dalam hal menetapkan suatu pelanggan Kartu As yang bera- 12:00. Untuk menikmati kedua RAMAL DENGAN MATA BATHIN DAN Cabang II: Jl. Jend. A. Yani No. 105 Telp. (0641) 22457 HP. 0852.262010594 Sejalan dengan kepatu- kebijakan tentunya regulator da di Jawa Barat dan Jawa Te- paket ini, pelanggan cukup te- KARTU TARROT PEMASANGAN SUSUK han terhadap regulasi da- sudah melalui pertimbangan ngah yang mengaktifkan kartu kan *100# dan pilih paket se- Wasiri berani menjamin kesembuhan tuntas Langsa: 0852 6201 0594 SPECIALIST MATA TANPA OPERASI lam menjalankan operasio- secara matang dengan mem- perdananya mulai 6 Januari suai dengan kebutuhan.(m09) JARAN GOYANG ambeien/wasir anda. Sangat berkhasiat dan cepat Dapat disembuhkan sampai tuntas Segala jenis mata seperti mata: - Katarak, Plus, Minus, Glaucoma SUSUK PENAKLUK menghilangkan ambeien. Wasir yang menonjol (UNTUK LAWAN JENIS/ SESAMA JENIS) maupun yang tumbuh di dalam. Redakan rasa - Mata Merah, Berair, Bengkak, dll Khusus yg mau masuk angkatan minus jarak pandang +/- 7 Meter B/W (buta warna), juga dapat di sembuhkan Pertanian Di Karo Bermasalah Harga Manggis Di Madina Anjlok sampai tuntas, Insya Allah KABANJAHE (Waspada) : Berbicara mengenai pertanian PANYABUNGAN (Waspada) : Harga komoditi buah mang- MENGOBATI MEDIS STROK, DIABETES sakit, perih dan menghentikan pendarahan waktu Hub. IBU FARIDA AKRAM Jl. Prof. H.M. Yamin S.H (Serdang) No. 251 A Tel.(061) - 4563067 Mdn Izin Depkes R.I Terdaftar di Karo dari tahun ke tahun hampir tidak ada putusnya gis di Kabupaten Mandailing Natal dalam musim kali ini KANKER, DARAH TINGGI buang air besar, mencegah infeksi dan panas mengalami masalah,mulai dari kwalitas bibit, pemupukan, anjlok dari Rp10.000 menjadi Rp3.000 per kg. Akibatnya, dalam serta melancarkan buang air besar. perawatan, penyakit (hama), iklim (musim), kwalitas, trans- para petani mengeluh. ALAMAT: JL. GARU 6 GG. BELIBIS portasi, infrastruktur,pemasaran,biaya, hingga menyangkut Keluhan ini disampaikan seorang petani manggis Sya- NO. 25 E AMPLAS Dpt Diperoleh di Sumatera - Aceh harga jual produksi. faruddin Siregar, 40, warga Kotanopan kepada Waspada baru- 0815.3332.0450 Hub: (061) 7365429 - 7362887 Padahal sektor pertanian merupakan denyut jantung baru ini. “Musim panen manggis kali ini harganya sangat perekonomian warga di daerah ini dan juga dari tahun ke jauh menurun. Biasanya kalau normal harganya mencapai tahun dijadikan sebagai skala prioritas pembangunan peme- Rp10.000, tapi sekarang hanya berkisar Rp3.000 ,” ujarnya. KLINIK TRADISIONAL BALAI PENGOBATAN TRADISIONAL rintah Kabupaten Karo. Turunnya harga manggis di pasaran sangat mempengaruhi ALAT VITAL ALAT VITAL DARI PELABUHAN RATU Permasalahan yang nyaris tak kunjung teratasi tersebut kondisi perekonomian warga. Walaupun sifatnya panen CISOLOK BANTEN DITANGANI OLEH AHLINYA: M. SUHERDI harus segera di tanggulangi secara bertahap dan secara musiman, tapi kalau harganya normal sangat membantu DITANGANI LANGSUNG DARI PELABUHAN RATU SUKABUMI JABAR biaya perekomian warga. “Musim kali rata-rata petani manggis A. AMARUDIN Terapi keperkasaan seksualitas Pria hasil permanen tanpa kontinu melalui kebijakan dan kerjasama semua pihak. efek samping, alami, bebas pantangan, untuk semua usia Hal itu dikemukakan Sumbul Depari saat bincang-bin- mengeluh,” tambahnya. TERAPI KEJANTANAN DENGAN MENGGUNAKAN TOTOK SYARAF DAN DIBERIKAN RAMUAN/ JAMU Hasil langsung reaksi ditempat, cukup satu kali berobat cang dengan wartawan, Rabu siang (5/01) di Kabanjahe, Thomas, 42, seorang toke manggis yang dihubungi di HASILNYA PERMANEN. TANPA EFEK SAMPING BEBAS USIA, BEBAS MENANGANI KELUHAN: MENAMBAH UKURAN sehubungan dengan rencana program kerja kepala daerah Pasar Kotanopan, membenarkan anjloknya harga manggis PANTANGAN DAN AGAMA REAKSI LANGSUNG DI TEMPAT MEMILIH UKURAN YG SUDAH DI SIAPKAN DARI NO (1) S/D (3) - - Panjang: 13, 14, 15, 16, 17, 18, 19, 20 cm Besar: 3,5. 4,5. 5. 5,5. 6 diameter Kabupaten Karo ke depan. tersebut. “ Pasaran manggis memang turun, dan ini terjadi MENGOBATI PRIA - Memperkeras, Tahan lama Menurut mantan Sekdakab Karo ini, salah satu solusi bukan di Madina saja tapi juga secara keseluruhan,” ung- - Ejakulasi dini, Mani encer + BESAR : 3, 4, 4, 4, 4, 5, 5, 5, 6 CM - Impotensi, Lemah syahwat kapnya. Menurutnya, penyebab anjloknya harga manggis + PANJANG : 13-14-15-16-17-18-19-20 CM mengatasi permasalahan pertanian di Karo dengan cara - Diabetes, kencing manis/ batu dikare-nakan secara bersamaan negara tetangga Thailand - IMPOTENSI Juga melayani problem asmara, mempercepat jodoh, menerapkan pengelolaan pertanian secara modern dan yang juga melakukan musim panen. Thailandkan termasuk - LEMAH SYAHWAT pengasihan, penglaris, buka aura, pasang susuk, dll terpadu serta ramah lingkungan dengan penerapan perta- - KURANG KERAS/ LOYO ALAMAT KELINIK TETAP: salah satu pemasok buah terbesar di dunia, jadi sangat - MANI ENCER/ EJAKULASI DINI naman organik. Untuk itu, katanya, perlu pemberdayaan - DIABETES/ KENCING MANIS Jl. SM. Raja Masuk ke Jl. Utama No. 18 Medan berpengaruh kepada harga pasaran buah, “ katanya. Hal Harga - TDK PNYA KETURUNAN Dari Toko Roti Majestik ±100meter Izin Kejaksaan: B/DSP.5/12/2008 masyarakat secara terpadu melalui pendidikan dan pelatihan manggis ini tergantung kepada kualitasnnya, kalau kualitas - MENANGANI PROBLEM ASMARA, DSB ALAMAT: JL. SM. RAJA DEPAN GARUDA PLAZA GG. KELUARGA SAMPING KLINIK BUNDA NO. 31A HP. 0812.6409.1777 Izin Dinkes: No. 448/0649/I/2008 HP 0812.6388.7999 . Buka setiap hari Harian WASPADA guna meningkatkan Sumber Daya Manusia (SDM) para petani.(c06) bagus (Super) harganya Rp3.000 sedangkan yang BS (bekas sortir ) harganya berkisar Rp1.500-Rp2.000 per kg.(cpin)
  • 14. 16 Ekonomi & Bisnis WASPADA Kamis 7 Januari 2010 Jonni Pasaribu, Kadiskop UKM Sumut Produk Lokal Jauh FTA ASEAN-China Bikin Lebih Bagus Dari China Cemas UKM Sumut bahan baku yang melalui antar daerah antar kabupaten dihapuskan. “Kalau me- mang bisa diringankan jangan kita bebani usaha kecil lagi.” Lalu, jelasnya, strategi ketiga gerakan aku cinta produk Indonesia supaya diku- mandangkan. “Mutu produk kita tidak kalah. Malah lifetime (masa pakai) pro- duk dalam negeri bisa lebih lama,” je- lasnya. Jonni bercerita beberapa waktu lalu pernah ke Korea. Seorang praktisi di sana menunjukkan baju yang dibelinya de- ngan won Korea dengan harga mahal pa- dahal di Indonesia paling sekira Rp20 ribuan, jelas Kadiskop. “Malah saya dengar produk garmen kita banyak yang dikirim ke luar negeri kemudian ditukar label saja. Masyarakat kita ini perlu disadarkan supaya banyak pembeli. Bayangkan total penduduk kita 230 juta lho,” ucapnya. Ketika disinggung apakah produk lokal kurang percaya diri? Jonni mem- Waspada/Armin Nasution benarkan. Sebab banyak faktor dan tan- LOKAL: Jonni Pasaribu menunjukkan tangan yang harus mereka fikirkan, ucap- sepatu buatan Medan yang selalu dipa- nya. “Untuk mencari peralatan saja me- kainya. reka susah dan izin yang tumpang tindih pasti mempengaruhi. Padahal kalau me- “LIHAT sepatu yang saya pakai. Ini beli reka kita beri keringanan pasti mutu tidak dari perajin lokal. Mereknya pun Palermo. kalah.” Saya beli cuma Rp200 ribu. Tapi tak kalah Lalu apakah FTA berpeluang ditunda? bagus kan dari sepatu impor,” kata Kepala Jonni mengatakan itu bukan jalan keluar. Dinas Koperasi dan UKM Sumut Jonni “Saya kira untuk membuat perjanjian Pasaribu. antar negara itu butuh waktu lima sampai Dia berbicara kepada Waspada di 10 tahun. Tidak mungkin semudah mem- Medan, Rabu (6/1). Jonni begitu yakin de- balik telapak tangan. Begitu pula untuk Waspada/Sahrizal ngan pilihannya dan tak gengsi memamer- membatalkannya tak bisa hari ini seenak SEPATU LOKAL: Perajin sepatu di Pusat Industri Kecil (PIK) kan sepatu yang dipakainya. “Saya punya kita membatalkannya.” dua sepatu hasil kerajinan lokal. Satu saya Apa pun itu, jelas Jonni, produk dalam MENGAWALI tahun ini lasi 1,7 miliar konsumen se- China, tarif rata-ratanya masih nasional. “Saya yakin kalau di Ban- beli di Jawa dan satu lagi beli di Medan.” negeri yang harus benar-benar disiapkan dengan kekhawatiran. Itulah kawasan dengan gross domes- tinggi yaitu sebesar 2,9 persen. Perjanjian ini memang ti- dung dan daerah Jawa itu per- Menurutnya, sepatu kulit berwarna menghadapi persaingan ke depan. “Inti- yang kini ada di benak para pe- tic product (GDP) sekitar 2 tri- Tarif average ke China seki- dak bisa dicegah. Hanya me- siapan sudah cukup baik. Ka- hitam yang dipakainya sudah melekat di nya kita kasi usaha kecil kemudahan. Yang laku usaha kecil di Medan dan liun dolar AS. Kemudian nilai tar 2,9 persen. Produk-produk merlukan beberapa negosiasi rena mereka juga UKM center kakinya sejak enam bulan lalu. “Tak ada kita takutkan ketika pasar global dibuka Sumatera Utara.Walau sebenar- perdagangan yang tercipta China akan lebih murah dari untuk membantu produk da- yang mengakomodasi semua bedanya dengan sepatu impor. Malah keli- malah ada barang-barang ilegal yang sulit nya bukan hanya Sumut, tapi sekira 1,23 triliun dolar AS se- produk Indonesia minimal 20 lam negeri. UKM (usaha kecil anggota. Di sini masih minim,” hatan kulitnya tetap licin walau sudah di- didteksi.” pebisnis di sini pasti lebih kha- kaligus menjadi populasi ter- persen apalagi adanya peng- menengah) di Sumut pun di- tegas pengusaha sepatu itu. pakai berbulan-bulan,” tuturnya. Secara nasional pun, menurut Jonni, watir dengan kesepakatan per- besar sedunia. hapusan bea masuk nol per- paksa mempersiapkan diri Kalaupun ada hanya aso- Layaknya mempromosikan produk hal itu sudah diantisipasi. Apalagi Men- dagangan ASEAN-China. Tetapi tentu saja produk sen mulai 1 Januari 2010. menghadapi globalisasi. Se- siasi perajin sepatu atau aso- lokal dia yakin sebenarnya perajin di da- negkop UKM Syarif Hasan yang akan Karena per 1 Januari 2010 China menjadi saingan berat. Saat ini pemerintah tengah bab cepat atau lambat sudah siasi sektoral. Komunikasi di- erah ini punya potensi besar untuk percaya datang ke Medan Minggu nanti sudah perjanjian perdagangan bebas Sebenarnya jika produk Indo- memperjuangkan sebanyak 8 tak bisa dihindarkan lagi. antara perajin dan pebisnis diri dengan hasil pekerjaannya. Jonni pun memiliki beberapa agenda aksi untuk atau free trade agreement an- nesia sudah lebih dulu bisa sektor industri untuk ditunda Berbagai tuntutan dari pe- masih minim, kata dia. Forum sebenarnya ikut memahami apa yang memajukan koperasi dan usaha kecil, tara ASEAN dan China resmi berkompetisi akan lebih ba- atau dimodifikasi dalam pe- laku UKM meminta agar per- untuk bertemu, berdiskusi ser- dikhawatirkan para pelaku bisnis kecil. jelasnya. berlaku. Berbagai hambatan nyak menguntungkan pebis- laksanaan FTA ASEAN-China janjian dibatalkan. Paling tidak ta ada dukungan pemerintah Itu sebabnya instansi yang dipimpin- Dia mengatakan secara nasional dagang dihapuskan. Bukan nis lokal. yaitu sektor industri besi dan 10 sektor nasional dipastikan daerah. nya mengkaji beberapa hal yang dianggap program kementerian termasuk pe- hanya pelaku UKM, tapi juga Sebab akan bisa meram- baja, petrokimia, makanan kalah bersaing dengan produk Apakah ketakutan terha- bisa mendorong pengembangan UKM ngembangan lingkungan berusaha fak- pengamat, pejabat, anggota bah negara ASEAN sampai Chi- dan minuman, TPT, furniture, impor. Di antara ke-10 industri dap FTA bukti UKM lokal man- sejak diberlakukannya FTA ASEAN-China. tor-faktor pendukung, kemudian me- dewan dan praktisi sangat kha- na. Nyatanya persiapan In-do- alas kaki, kimia organik dan tersebut adalah tekstil, maka- ja? Indikasi itu ada. Sebab saat Menurut Jonni, ada beberapa langkah ningkatkan daya saing dan mutu kelem- watir dengan kondisi ini. nesia menjadi yang paling lam- elektronika yang semuanya nan dan minuman, peralatan ini dominan pelaku usaha lo- yang perlu dilakukan. bangaan serta memberdayakan usaha Pasalnya Indonesia me- bat. Bahkan lalai karena terlalu mencapai 303 pos tarif. pertanian, alas kaki, elektronik, kal selalu minta fasilitas dan Pertama, jelasnya, pemerintah harus mikro. mang yang paling minim per- banyak persoalan non ekonomi Pemberlakukan perdaga- mesin dan industri mesin. insentif yang meringankan. memberikan suasana kondusif dalam me- Bahkan dari kementerian juga sudah siapan. Termasuk di Sumut. yang muncul di tengah jalan. ngan bebas Asean-China Kekhawatiran ini wajar Sehingga ketika diajak ber- laksanakan usaha. Baik dari segi peraturan ada gerakan masyarakat sadar koperasi, Malah para pelaku usaha kecil FTA yang mengganggu pe- (FTA-AC) akan menghapus mengemuka. Karena ibarat kompetisi secara internasional daerah maupun perizinan yang tidak ungkap Jonni. “Gerakan ini pasti sejalan di daerah ini seperti terkejut rindustrian itu adalah FTA In- bea komoditas impor ke Indo- mau perang tapi tidak punya membuat resah. Jangankan memberatkan, tuturnya. dengan menggaungkan kembali aku ketika tahu per 1 Januari se- donesia dengan China karena nesia, sehingga berbagai pro- senjata. Redy, pelaku usaha ke- menguasai pasar internasional, Jonni mengatakan harusnya pebisnis cinta produk Indonesia untuk menopang mua barang China bebas ma- ASEAN-Indonesia sudah ber- duk UMKM Indonesia teran- cil di Medan, Rabu (6/1), me- jadi tuan rumah di dalam negeri kecil malah mendapat insentif berupa usaha lokal,” tegasnya. suk Indonesia. laku dengan dengan tarif rata- cam pemasarannya, terutama ngungkapkan imbas yang pa- saja pun belum mampu. kemudahan mendapatkan izin. Kedua, Kesepakatan ASEAN-Chi- rata untuk Januari 2010 hanya oleh produk China yang sela- ling dirasakan dari FTA adalah kata dia, semua biaya retribusi pengadaan * Armin Nasution na sebenarnya mengakumu- 0,9 persen. Sedangkan, untuk ma ini telah menguasai pasar pebisnis seperti mereka. * Armin Nasution Dipersiapkan Kuasai Dalam Ketakutan Memuncak Hadapi Maraknya Negeri Sampai Mancanegara TIGA masalah krusial dihadapi UKM diantaranya membawa pelaku usaha Produk Asal Tirai Bambu untuk menghasilkan produk lokal yang kerajinan sepatu dan garmen ke Sidoarjo pasar di Sumatera dari Aceh tah menjadi setengah jadi ter- mampu menghadapi kekuatan branding dan Tasik Malaya untuk pelatihan. sampai Pekanbaru memperki- sebut, terpaksa perajin mem- produk asing dan pabrikan dalam negeri Salah satu UKM binaan Disperindag rakan tak lama lagi pasar me- beli dari pengusaha yang me- menjadi perhatian penting pemerintah Medan yakni Batam Craft telah mampu reka akan kedatangan kom- masok rotan dari Sumatera daerah menghadapi FTA 2010. melakukan ekspor ke Belanda dan Austra- petitor baru. Barat serta tali eceng gondok, Lemahnya pendidikan serta kekura- lia sebanyak tiga kontainer dalam sebulan “Industri kerajinan rotan tali batang pisang dan tali pan- ngan modal dan kendala informasi ten- memproduksi kursi, ayunan, tempat memang tidak memiliki kom- dan untuk aksesoris kerajinan tang pasar telah mengkerdilkan produk sampah dan lainnya dari bahan rotan. petitor atau pesaing dari luar rotan dari Pulau Jawa. lokal sehingga banyak yang tergusur dari Menurut Karya Dharma Disperindag negeri, namun turunnya per- Bahan baku utama ini di- pangsa pasarnya sendiri. Medan November lalu membawa sejum- mintaan ekspor akan memak- beli dengan harga mahal, se- Mutu yang tidak konsisten standarnya, lah pelaku usaha sepatu untuk dilatih dan sa pesaing dari pulau Jawa se- hingga produk yang dihasilkan lemahnya manajemen produksi sehingga melihat teknologi tepat guna yang ada perti Surabaya dan Cirebon terpaksa dijual lebih tinggi dari tidak mampu memenuhi kebutuhan pasar di tempat kerajinan sepatu ke di daerah masuk Medan,” katanya. produk dari Jawa. Disamping di saat yang tepat serta minimnya modal Sidoarjo. Produk rotan dari Jawa upah kerja lebih murah diban- mengakibatkan kekuatan inovasi memba- Pelatihan yang diikuti enam pelaku dengan harga lebih murah dan ding Medan mereka juga ca selera pasar tidak maksimal. usaha tersebut dilakukan selama 10 hari disain serta kualitas yang lebih mampu mengolah bahan ba- Menghadapi FTA 2010 saat ini, kondisi dengan langsung ke berbagai usaha lokal unggul dikhawatirkan menjadi ku utama. pelaku UKM yang seperti itu dikhawatir- di Sidoarjo yang didampingi para instruk- petarung yang solid dan akan Hal ini harus disikapi pe- kan akan kerepotan melanggengkan usa- tur Balai Diklat daerah tersebut, katanya. menyaingi produk kerajinan merintah khususnya Dispe- hanya. Di tengah naiknya harga bahan ba- Sedangkan pada Desember juga di- di Medan, sebutnya. rindag Medan yang telah me- ku dan lemahnya daya beli, para kompeti- laksanakan pelatihan bordir terhadap pa- Untuk itu Disperindag Me- lakukan pembinaan pelatihan tor akan berlomba murah menjual pro- ra pelaku usaha kecil di Medan ke Tasik dan harus memfasilitasi dan peningkatan mutu dan mana- duknya. Malaya selama 10 hari dari 11 Desember lebih melindungi usaha lokal jemen kepada perajin agar di- Tentunya mutu barang dan promosi sampai 21 Desember yang diikuti peserta diantaranya mengadakan stu- tingkatkan lagi sesuai kebutu- juga akan menjadi faktor yang sangat me- lima orang pelaku UKM dari Medan. di banding dengan weaktu han untuk kemajuan usaha nentukan, repotnya ketika produk asing Peserta pelatihan di samping menin- yang cukup oleh perajin rotan perajin, tuturnya. dan pabrikan dalam negeri melirik pasar jau tekhnologi yang digunakan juga meli- ke daerah sentra produksi ro- Sementara itu para perajin tradisional maka akan pergi kemana UKM hat bagaimana cara meningkatkan kuali- tan di Jawa, katanya. sepatu juga mengalami hal lokal membawa produknya. tas produk yang dilakukan oleh perajin Hal itu sangat penting gu- yang lebih parah lagi, pangsa Pemko Medan jauh hari menyadari garmen dan bordir di Tasik Malaya untuk na mengukur kemampuan pasar mereka dalam tiga tahun akan tibanya masa tersebut karena me- dikembangkan saat kembali ke daerah, kompetitor dari sisi kualitas, terakhir sudah berkurang me- mang telah lama didengungkan. Dinas sebutnya. disain dan pengolahan bahan lebihi 50 persen di Medan se- Perdagangan Medan (Disperindag) telah Di samping itu peserta pelatihan ter- baku sehingga perajin di Me- hingga mereka lebih banyak mempersiapkan pelaku usaha mikro kecil sebut juga didampingi instruktur dari ba- dan dapat menyaingi kualitas, memasarkan ke daerah-da- dan menengah agar mampu menguasai lai diklat tata busana berbasis pesantren Waspada/Surya Efendi desain dan memangkas biaya erah kabupaten. pasarnya sendiri. di Tasik Malaya. PERAJIN ROTAN: Seorang perajin rotan sedang menyiapkan pesanan. Walaupun perajin rotan produksi sehingga mampu Di tengah lemahnya daya Berbagai pelatihan manajemen ber- Sementara itu sebanyak 30 peserta tak memiliki saingan namun mereka khawatir kalau rotan dari Jawa akan mereduksi pangsa menjual lebih murah, ujart beli masyarakat di luar Medan basis gugus kendali mutu menyangkut perajin rotan mengikuti pelatihan yang pasar mereka. Sunarto. mereka harus bersaing dian- perbankan, keuangan, kualitas hingga pe- dilakukan Disperindag Medan bekerja Pihaknya juga mengajur- tara sesama perajin lokal, se- masaran serta manajemen produksi yang sama dengan Batam Craft salah satu ind- ERA 2009 yang diwarnai ngamankan pangsa pasar di (UKM) berbasis produksi mas- kan pemerintah segera mem- hingga berlomba menawar- mengatur efisiensi dan efektifitas menekan ustri rotan binaan Disperindag yang ber- imbas krisis global begitu kru- daerah sendiri. Lemahnya per- sal seperti rotan, sepatu, dan bangun Pusdiklat untuk UKM kan harga murah di tengah biaya produksi dibekali pada UKM. hasil mengembangkan usahanya hingga sial di pasaran internasional. mintaan ekspor di pasar inter- garmen terancam dimasuki perajin rotan yang mampu naiknya harga bahan baku se- Pelatihan tersebut tidak dibekali pada ekspor ke Eropa. Sepertinya akan mengancam nasional telah memancing kompetitor luar dan dalam ne- membuat produk berstandar patu yang 95 persen produksi satu jenis produk UKM saja namun diuta- Sebanyak 30 perajin tersebut merupa- pangsa pasar lokal di 2010, se- produk daerah lain merebut geri sendiri. ekspor. Saat ini biaya pembua- pabrikan. makan pada produk yang menjadi anda- kan warga Sei Sikambing yang mengikuti hingga berbicara ekspor bagi pasar Sumut. Sunarto, pelaku usaha in- tan kerajinan rotan cukup ting- Industri kerajinan sepatu, lan industri kerajinan di Medan seperti pelatihan selama 20 dengan intruktur produk lokal menjadi sangat Di tengah krisis ekonomi dustri rumah tangga perajin gi akibat lemahnya pengeta- kata Mardi Sikumbang di Jalan perajin sepatu, bordir, cor logam, hingga Sunarto salah satui perajin rotan yang pesimis. melanda hampir sebagian be- rotan juga merasakan kekha- huan pengolahan bahan baku Bromo Medan telah lama “ku- rotan dan konveksi. telah berhasil dan banyak menguasai ke- Diberlakukannya perda- sar pasar internasional dan na- watiran tersebut. Ketua Kopin- mentah. pak-kapik” karena kuatnya Menurut Kadisperindag Medan HT terampilan kualitasnya sudah di-akui. gangan bebas atau Free Trade sional, pangsa pasar Sumatera kra Rotan di Jalan Titipapan, Sementara itu rotan, eceng kompetitor yang dihadapi. Di- Basyrul Kamali, Selasa (5/1), didampingi Disamping itu Disperindag akan me- ASEAN-China (FTA) sangat Utara khususnya Medan men- Gang Pertama Medan ini me- gondok, batang pisang dan tali samping menghadapi kom- Kepala Seksi Industri Dasar, Kecil dan Me- nempatkan seorang petugas pengawas mendukung terjadinya anca- jadi salah satu yang dilirik kare- ngatakan 2010 akan ada per- pandan yang banyak diguna- petitor produk tradisional dari nengah (IDKM) Karya Dharma, salah satu yang telah bersertifikasi di Pusat Industri man tersebut melihat gencar- na daya beli masyarakat masih saingan ketat, ujarnya, Rabu kan sebagai bahan baku uta- pulau Jawa, kehadiran produk usaha lokal binaan Disperindag tersebut Kecil (PIK) Jalan Menteng Medan, agar nya produk impor dari China tinggi. (6/1). ma produk kerajinan rotan pabrikan dalam negeri dan telah mampu ekspor ke Belanda. pemberdayaan fasilitas tersebut dapat menggusur pasar produk lokal. Akibatnya berbagai pro- Walaupun perajin rotan di berkualitas ekspor banyak di- luar negeri seperti China mem- Menghadapi perdagangan bebas 2010, ditingkatkan lagi untik pembinaan UKM. Fokus pelaku usaha di Me- duk andalan Medan khusus- Medan menguasai hampir 100 jumpai di Sumatera Utara. buat mereka tidak berdaya. Disperindag Medan telah jauh hari mem- dan kini lebih banyak mema- nya yang dikerjakan pelaku persen pasar di Medan dan Akibat ketidakmampuan bina UKM dan masyarakat di Medan, * Sahrizal sang strategi bagaimana me- usaha kecil dan menengah menguasai 60 persen pangsa mengolah bahan baku men- * Sahrizal
  • 15. WASPADA Kamis 7 Januari 2010 Sumatera Utara 17 Kota Zhuhur ‘Ashar Magrib ‘Isya Imsak Shubuh Syuruq Kota Zhuhur ‘Ashar Magrib ‘Isya Imsak Shubuh Syuruq Kota Zhuhur ‘Ashar Magrib ‘Isya Imsak Shubuh Syuruq Kota Zhuhur ‘Ashar Magrib ‘Isya Imsak Shubuh Syuruq Medan 12:29 15:53 18:28 19:42 04:59 05:09 06:30 Langsa 12:32 15:55 18:29 19:43 05:03 05:13 06:34 Sabang 12:43 16:05 18:37 19:51 04:16 05:26 06:47 Tarutung 12:28 15:53 18:29 19:43 04:55 05:05 06:26 B. Aceh 12:43 16:03 18:38 20:52 05:16 05:26 06:46 L.Seumawe 12:35 15:58 18:31 19:45 05:08 05:18 06:39 Pandan 12:29 15:54 18:30 19:44 04:55 04:05 06:26 T.Tinggi 12:27 15:51 18:26 19:40 04:57 05:07 06:27 Binjai 12:30 15:54 18:28 19:42 05:00 05:10 06:31 L. Pakam 12:29 15:52 18:27 19:41 04:58 05:08 06:29 Sibolga 12:29 15:54 18:30 19:44 04:55 05:05 06:26 Panyabungan 12:26 15:51 18:29 19:43 04:50 05:00 06:21 Bireuen 12:37 16:00 18:33 19:47 05:10 05:20 06:40 Sei Rampah12:28 15:51 18:26 19:40 04:58 05:08 06:28 Sidikalang 12:30 15:55 18:30 19:44 04:59 05:09 06:29 Teluk Dalam12:33 15:58 18:36 19:50 04:57 05:07 06:28 B. Pidie 12:37 16:00 18:33 19:47 05:08 05:18 06:39 Meulaboh 12:39 16:03 18:37 19:51 05:10 05:20 06:41 Sigli 12:40 16:03 18:35 19:49 05:13 05:23 06:44 Salak 12:31 15:55 18:31 19:45 04:58 05:08 06:28 G. Sitoli 12:34 15:59 18:36 19:50 04:59 05:09 06:30 P.Sidimpuan12:27 15:52 18:29 19:43 04:53 05:03 06:24 Singkil 12:33 15:57 18:33 19:47 05:00 05:10 06:31 Limapuluh 12:26 15:50 18:25 19:39 04:55 05:08 06:29 K. Jahe 12:30 15:54 18:29 19:43 04:59 05:09 06:30 P. Siantar 12:28 15:52 18:27 19:41 04:56 05:06 06:27 Stabat 12:30 15:54 18:28 19:42 05:00 05:10 06:30 Parapat 12:28 15:33 18:28 19:42 04:56 05:06 06:27 Kisaran 12:26 15:50 18:25 19:39 04:54 05:04 06:25 Balige 12:28 15:52 18:28 19:42 04:55 05:05 06:26 Takengon 12:37 16:00 18:33 19:47 05:08 05:18 06:39 GunungTua 12:25 15:50 18:27 19:41 04:51 05:01 06:22 Kutacane 12:33 15:56 18:31 19:45 05:02 05:12 06:33 R. Prapat 12:25 15:49 18:25 19:39 04:52 05:02 06:22 T.Balai 12:25 15:49 18:24 19:38 04:54 04:04 06:24 Sibuhuan 12:25 15:50 18:28 19:42 04:50 05:00 06:21 Dihisab oleh: Tim Ahli Badan Hisab dan Rukyat (BHR) Sumut Tapaktuan 12:35 15:59 18:34 19:48 05:04 05:14 06:35 Lhoksukon 12:35 15:58 18:31 19:45 05:07 05:12 06:38 Depag Sergai Peringati Hari Amal Bhakti SEI RAMPAH (Waspada): Peringatan Hari Amal Bhakti (HAB) Bocah 3 Tahun Dikhitan Orang Bunian Departemen Agama (Depag) ke-64 di Kabupaten Serdang Bedagai T. TINGGI ( Waspada): 12 Pasar Tiga Desa Payalombang. di dapur. “Saya terkejut sewaktu Riko tuk hasil yang disunat orang Bu- anaknya tetap sehat, sebab (Sergai) di halaman Kantor Depag, Sei Rampah, Senin (4/1) dengan Warga Desa Paya Lombang, Bocah itu, Riko Pradinata, Sepulang bermain-main, merintihkesakitandisekitar ‘anu- nian. Bila diperhatikan dari jarak menurutnya, peristiwa ini inspektur upacara Bupati Sergai HT Erry Nuradi. Kec. Tebingtinggi, Kab. Sergai anak ketiga dari pasangan Sulisdi, sang anak mengadu kepada nya’danlebihterkejutlagisewaktu dekat, bentuk ‘sunatan’ orang tergolong aneh dan merupakan Menteri Agama H Suryadharma Ali dalam sambutan tertulis heboh. Pasalnya peristiwa aneh 40, dan Munadah, 36. Ketika ibunya, bahwaiamerasakansakit saya lihat bentuk kemaluannya bunian dengan sunat yang dilak- karuniadariAllahSWT.Menurut dibacakan Bupati Sergai mengatakan, Depag RI yang berdiri 3 dialami seorang bocah berusia dikonfirmasi wartawan, Selasa di sekitar kemaluannya. Khawatir seperti sudah disunat,” tutur sanakan manusia seperti tidak sejumlahwargadisana,kejadian Januari 1946 telah mengisi tempat yang amat penting dan strategis tiga tahun. Ia diisukan disunat (5/1) Mudanah, orang tua bocah terjadi sesuatu yang tidak diingin- Munadah. ada bedanya, hanya saja sunatan aneh seperti ini bukan yang dalamsusunandanfungsipemerintahannegara,khususnyamembina, (dikhitan) mahluk bunian itu menuturkan, peristiwa aneh kan,orangtuanyalangsungmem- Setelah kejadian itu, rumah orang bunian ini terlihat tanpa pertama terjadi di dusun terse- melayani dan mengembangkan kehidupan beragama dengan sebaik- (makhluk halus-red) ketika se- dialami anak ketiganya, Kamis buka celana sang anak, namun kediaman Riko sering dikunjungi ada benang. but,sedikitnyasudahadaempat baiknya sesuai dengan amanat Undang-undang Dasar 1945. dang bermain-main tidak jauh (31/12) sekira pukul 13:30 ketika aneh kemaluan Riko terlihat se- warga, mereka ingin mengetahui Kini orang tua Riko yang warga yang disunat ‘orang Peringatan Hari Amal Bhakti ke-64 juga dihadiri Kakan Depag daritempattinggalnyadiDusun itu ia sendiri sedang memasak perti sudah disunat. secara langsung seperti apa ben- sehari-harinya bertani berharap bunian’.(a09) Sergai Drs HM Hasbi, MH serta penyerahan Satyalencana Karya Satya 20 tahun dari Presiden RI kepada Drs H Hasful Huznain, Tembok Ruko Dibor SH, Hidayatullah, SPd, Romen Prayitno, SPd dan Satyalancana Maling Angkut Karya Satya 10 tahun kepada Darmono Purba, SAg, Drs H Jamaluddin, dan Drs. Suhermanto serta pernyerahan secara simbolis Surat Keputusan Pembantu Pegawai Pencatat Nikah (P3N) kepada Hotsah dari Kec. Sipispis, Darwis dari Kec. Teluk Mengkudu, Mhd. Thayib Ribuan Rokok dari Kec. Sei Rampah dan M. Upir dari Kec. Perbaungan. (a07) Gotong Royong Buka Jalan Baru Di Hamparan Perak STABAT (Waspada): Ruko menyebut jumlah rokok yang aksinya tercium oleh pemilik Gundaling di Jalan hilang tidak terkira, sangat rumah yang melihat bekas jejak MEDAN (Waspada): Masyarakat Hamparan Perak di bawah banyak. Polisi menyelidiki ka- kaki pelaku berjalan dari ru- koordinasi kepala desanya membuka jalan tembus sepanjang Perniagaan Stabat dibobol susnya untuk mengejar pelaku. mahnya. Awalnya tersangka dua km yang menghubungkan tiga dusun yaitu Dusun V Kebun maling, diperkirakan sekira Anehnya, saat Waspada tidak mengakui perbuatannya, Baru, DusunVI dan DusunVII Pulau Agas secara bergotong royong. pukul 04:00, Rabu (6/1). memantau ke lokasi toko, tidak namun setelah diselidiki, baru Jalan itu memang sudah ada sejak masa penjajahan belanda, terlihat sesuatu yang aneh di tersangka mengakui perbuata- Kejadian itu baru diketahui tetapi belum pernah terealisasi. Barulah sekarang jalan tersebut sana. Terkesan tidak terjadi nya dan mengembalikan uang dapat dilalui kendaraan bermotor. Dan dengan terbukanya jalan pagi harinya saat pemilik apapun di toko itu. hasil curiannya. Selanjutnya ka- baru ini maka hasil para petani dapat diangkat dengan tidak lagi membuka pintu. sus tersebut ditangani Mapolsek memikul. Nekad Mencuri Rambutan. Jalan baru ini tetap akan digotongroyongkan setiap minggu Sementara itu mengaku su- Dalam pemeriksaan petu- agar tidak lagi dilanda banjir seperti yang telah lalu.Tanpa kita Modus pencuri dengan cara dah tidak punya uang lagi untuk gas tersangka mengatakan, pe- Waspada/Eddi Gultom bersatu padu pembanggunan jalan ini tidak akan dapat terlaksana, membor tembok ruko bagian membeli keperluan rumah ristiwa tersebut terjadi, Minggu BERIKAN TALIKASIH: Menyambut Hari Jadi ke-6 Kab.Serdang Bedagai Bupati HT.Erry Nuradi samping hingga menguras tangga, seorang pria nekad (2/1) siang sekira pukul 11:30. kata Kepala Desa Khalil Munawar di hadapan seluruh masyarakat didampingi Kadis Sosial Herman Sitorus memberikan bantuan tali kasih dan sembako kepada dagangan yang dipenuhi rokok mencuri uang milik tetangganya Ketika itu rumah korban yang yang melakukan kerja gotong royong massal. 85 KK warga Panti Karya Bakti Desa Sei Buluh,Kec.Perbaungan. Sembako serta uang diterima di Jalan KL. Yos Sudarso, Kel. merupakan tetangganya di Jalan dan barang kebutuhan sehari- “Kita jangan mengharapkan bantuan dari pemerintah saja, pimpinan Panti Karya Bakti Desa Sei Buluh, Ridwan Manurung dan selanjutnya diserahkan Lalang Tebingtinggi dengan cara Yos Sudarso, Ling. II Kel. Tanjung hari itu. tetapi mari kita tunjukkan partisipasi kita dahulu kepada bangsa kepada penghuni panti. Manurung, penderita tuna netra yang mewakili rekan rekannya Korban Alung telah mem- masuk mendongkel pintu Marulak Tebingtinggi sedang dan negara ini.” mengatakan sangat berterimakasih kepada Bupati HT Erry Nuradi yang sangat peduli terhadap buat pengaduan ke Polsek rumah korbannya yang sedang kosong, karena korban dan ke- Kepala Desa bersama masyarakat Hamparan Perak juga mereka. Menurut Manurung, Bupati HT Erry Nuradi sudah ada tiga kali datang mengunjungi Stabat. Kapolsek AKP Karlos tidak berada di rumah. luarga sedang mengikuti kebak- tidak lupa mengucapkan ribuan terima kasih kepada Bupati mereka termasuk pada malam tahun baru 2008 yang lalu. Untuk itu, kata Manurung, mereka membenarkan kejadian. Dia Akan tetapi kemudian tian di gereja. (a38/a09) Deliserdang Drs H Amri Tambunan yang telah membantu pem- semua sepakat mendoakan HT Erry Nuradi agar sehat selalu dan dapat melanjutkan pembangunan di Kab.Sergai termasuk mendukung dan memenangkan pada Pilkada bulan Mei mendatang. bukaan jalan tembus itu. (m05) Terlihat pada gambar Bupati Sergai HT Erry Nuradi memberikan sembako secara simbolis kepada warga panti, Rabu(6/1) sore. Bob Andika Mamana Sitepu Ketua PDIP Binjai Korban Musibah Gedung BINJAI (Waspada): Rapat Barat sedangkan,PAC PDIP Binjai wartawan Selasa (5/1) di Binjai. Pengurus Anak Cabang Partai Selatan, Binjai Kota, Binjai Timur Ketua Terpilih Bob Andika Nasional Terima Tali Asih Ubah Pola Makan Agar Terhindar Dari Penyakit Demokrasi Indonesia Perjua- ngan (PDIP) Kota Binjai yang dan Binjai Utara memberikan suaranya untuk Bob Sitepu, se- mengatakan, terpilihnya dia sebagai ketua merupakan keme- T.PURA (Waspada): Para korban musibah Gedung Nasional, STABAT (Waspada): Masyarakat senantiasa meningkatkan risiko terkena penyakit didasari diikuti 5 PAC yang diadakan di dangkan Raiderta Sitepu tidak Langkat, di RSU Tanjungpura mendapat santunan Rp 300 ribu nangan semua kader, dan diha- menjaga pola hidup dan makan agar terhindar makanan siap saji mengandung zat pengawet Sekretariat PDIP Binjai di Jalan mendapat suara. rapkan tidak ada faksi-faksi lagi per orang dan langsung diserahkan Bupati Langkat melaluiWabup dari berbagai penyakit, terutama penyakit diabetes yang membahayakan organ tubuh. T.Amir Hamzah 28 Desember Terpilihnya Bob Andika Ma- Budiono. di tubuh partai, karena semua dan stroke. Sementara Kadis Kesehatan Langkat dalam 2009 lalu, memilih Bob Andika manaSitepukelahiran11Oktober Demikian sumberWaspada di RSU Tanjungpura menyebutkan. Demikian drWilliam Ham selaku nara sumber sambutannya juga mengimbau masyarakat untuk kepentingan partai ke Mamana Sitepu, SH sebagai 1982 ini menjadi Ketua Cabang Sedangkan Syamsul Bahri dari LSM Topan-RI Langkat / Binjai pada talk show bertema‘diabetes dan stroke sebagai mengubah pola makan. ‘’Terkadang kesibukan Ketua Cabang PDIP Kota Bin- PDIP Binjai, sudah diperkirakan depan bukan untuk pribadi dan yang warga Tanjungpura kepada Waspada membenarkannya penyakit utama di Indonesia’, Rabu (6/1). aktivitas seeorang menjadikan pola makan tidak jai Priode 2010-2015. sebelumnya. Sosok tokoh muda berharap semua kader merapat- pemberian santunan dari Pemkab Langkat itu. Dua penyakit menurutWilliam menjadi anca- teratur dan kerap menyantap makanan siap saji, Pemilihan yang berlangsung dari partai berlambang banteng kan barisan dan berjuang untuk Harapannya ke depan kepada Bupati Langkat agar aset Pemda man terbesar di Indonesia sejak beberapa tahun padahal tanpa disadari kurang baik bagi tubuh secara demokratis ini melalui ini adalah satu-satunya Ketua kebesaran partai PDIP dengan yang ada di Langkat yang juga sebagai tempat pertemuan warga terakhir untuk diwaspadai, sebab dewasa ini men- jika tidak diseimbangkan dengan makanan alami voting itu Bob Andika meraih 4 Cabang PDIP termuda untuk melakukan konsulidasi dan itu segera direnovasi yang lebih baik dan ini menjadi contoh jamur makanan siap saji dan masyarakat seakan sayur dan buahan. Selain itu kurang olahraga suara dan saingannya Darta Kabupaten/Kota Se Sumut dan sosialisasi kekelurahan dengan agar ke depan untuk membangun supaya dapat lebih baik lagi. terbiasa menyantapnya. dan istirahat serta stres juga pemicu diabetes Sitepuyang hanyameraih1suara kemungkinan se Indonesia, kata merangkul kader senior partai (c02) Kebiasaan seperti itu secara tidak langsung dan stroke,’’ kata Indra. (a38) yang didapat dari PAC PDIP Binjai seorang kader PDIP ini kepada ujarnya. (a04) Karya Nyata Membangun Serdang Bedagai Menuju Yang Terbaik Di Indonesia TEPATNYA 7 Januari 2010 ADD dan jumlahnya paling ren- diknas di Denpasar Bali, Anugrah yaitu hari ini Kabupaten dah Rp50 juta dan bahkan ada AksaraTingkatMadyatahun2009 yang mendapat Rp200 juta sesuai yang diberikan Mendiknas di Serdang Bedagai genap dengan kebutuhan dan jumlah Cilegon, Provinsi Banten, Juara berusia enam tahun. penduduk desa. II Lomba Mitra PAUD tahun 2009 Namun secara defenitif Selama empat tahun belaka- yang diberikan Menteri Negara ngan ini banyak karya nyata yang Pemberdayaan Perempuan di Kab.Serdang Bedagai baru telah dilakukan oleh Bupati HT Cilegon,Provinsi Banten, Juara memiliki pemimpin sejak 5 Erry Nuradi. Beberapa karya nya- II Tutor Keaksaraan Fungsional Agustus 2005, yakni Bupati ta yang telah dilakukan itu di an- (KF) Lomba Jambore PTK PNF HT Erry Nuradi dan Wakil taranya adalah, dibangunnya Ru- tahun 2009 yang diberikan Men- mahSakitUmumDaerah(RSUD) diknas di Jakarta. Bupati H Soekirman yang Sultan Sulaiman di Sei Rampah, Sementara prestasi tingkat telah memimpin kabupaten merehab seluruh Puskesmas dan Provinsi Sumatera Utara adalah, ini selama 4 tahun 6 bulan. Puskesmas Pembantu termasuk Juara I stand terbaik Pameran membangun Pos Kesehatan di Hari Aksara Internasional (HAI) Pedesaan (Poskesdes), memba- tingkat Provinsi Sumatera Utara Tetapi walaupun kepemim- ngun gedung SMA Negeri baru ke 39 tahun 2004 di Serdang Be- Waspada/Eddi Gultom pinan mereka baru se usia itu, di setiap kecamatan, sehingga 17 dagai, Juara II stand terbaik Pa- Presiden RI DR H Soesilo Bambang Yudhoyono menyematkan penghargaan “Lencana Melati” namun semangat juang HT Erry Dok Waspada/Eddi Gultom kecamatan yang ada di daerah meran Hari Aksara Internasional kepada Bupati Serdang Bedagai HT Erry Nuradi dalam rangka HUT Pramuka ke-48 tahun Nuradi dan Soekirman sangat HOTMIX: Jalan menghubungkan Kec.Tg.Beringin,Kab.Serdang ini sudah memiliki minimal satu ke 39 tahun 2005 Tingkat Suma- Bedagai ke Kec.Bandar Khalifah yang sebelumnya sangat sulit 2009 tingkat Nasional di taman rekreasi Wiladatika Cibubur, Jakarta Timur, Jumat (14-8- menggebu-gebu untuk meraih SMANegeri,padahalsebelumnya tera Utara ke 40 di Kota Binjai, 2009). cita cita masyarakat menjadikan dilalui baik kendaraan roda dua maupun empat, karena jalan hanya ada 7 unit SMA Negeri Juara III Stand terbaik Pameran kabupaten ini menjadi salah satu bagai kubangan kerbau. Namun setelah diperbaiki dan di hotmix walaupun Indonesia sudah 63 HAI ke 41 tahun 2006 di Kabupa- dapat apresiasi yang baik dari rahkan dan disematkan langsung terbaik tingkat nasional untuk kabupaten terbaik di Indonesia. kini jalan yang beada di kawasan Desa Pematang Cermai, tahun merdeka. ten Mandailing Natal, Juara II berbagai kalangan. oleh Presiden Susilo Bambang daerah otonom kabupaten baru Selama empat tahun enam Kec.Tg.Beringin ini sudah lebih baik. Gambar ini direkam, Selain itu juga telah merehab Stand terbaik Pameran HAI ke Dalamtahun2009sajaBupati Yudhoyono pada upacara peri- se Indonesia. bulan mereka memimpin di Jumat(1/1). gedung gedung SD dan SMP 42 tahun 2007 Tingkat Sumatera HT Erry Nuradi telah menerima ngatan HUT ke-48 Gerakan Pra- Menurut Plt Inspektur Jen- daerah ini, sudah banyak meraih Negeri yang selama ini tidak layak Utara di Tanjung Balai, Juara I, berbagaipenghargaan.Padabulan mukatingkatnasionaltahun2009 deral Depdagri H Zainal Arifin kemajuan diberbagai aspek kehi- mendukungpembangunanyang Walaupun kemampuan untuk sarana belajar dan menga- Stand terbaik Pameran HAI ke Juli 2009 Bupati Serdang Bedagai lalu di Jakarta. Pardede selaku ketua tim verifi- dupanmasyarakat,sehinggawar- dilaksanakan pemerintah. Pemkab Serdang Bedagai masih jar, meningkatkan kualitas tenaga 43 tahun 2008 Tingkat Sumatera menerima penghargaan tanda Bahkandipertengahanbulan kasi, tim verifikasi interdep pusat ga secara nyata sudah dapat me- HTErryNuradidalamberba- sangatterbatas,tetapipemerintah pendidik dan para medis. Bukan Utara di Sibolga, Juara III Stand kehormatan“SatyalancanaWira Desember 2009, untuk kedua telah melihat langsung terhadap nikmati dan merasakan hasil gai kesempatan selalu menge- atas dukungan DPRD maupun itu saja sejak kepemimpinan HT Terbaik Pameran HAI ke 44 tahun Karya” dari Presiden RI. Peng- kalinya secara berturut-turut sarana dan prasarana pemerin- pembangunan. Sedangkan ten- mukakan, Kabupaten Serdang masyarakat termasuk bantuan Erry Nuradi kemajuan bidang 2009 Tingkat Sumatera Utara di hargaan sebagai apresiasi atas masyarakat Kabupaten Serdang tahanyangtelahdibangun,tingkat tang pelayanan di berbagai sektor Bedagai yang akan berusia enam lembaga-lembaga seperti BUMN pendidikan sangat menakjubkan Pangururan Kab.Samosir. darma baktinya selama ini yang Bedagai melalui Bupati HT Erry keberhasilan dibidang pelayanan terhadapmasyarakatPemerintah tahun dengan luas wilayah secara terus-menerus berupaya bahkan banyak sekali prestasi Juara I Tutor KF Tingkat Pro- dinilai telah berjasa dan berhasil Nuradi diberikan penghargaan publik, pelaksanaan administrasi Kabupaten Serdang Bedagai se- 190.022 hektar atau tiga kali luas memberikanyangterbaikkepada yang telah diraih. vinsi Sumatera Utara tahun 2007, meningkatkan pelayanan ma- Ketahanan Pangan tingkat na- pemerintah, tenggat pengesahan cara terus menerus berupaya kota Jakarta dengan jumlah pen- masyarakat dan pembangunan Prestasi Yang Diraih Juara I Tutor Paket B Tingkat Pro- syarakat di Kab.Serdang Bedagai sional yang diserahkanWakil Pre- APBD tepat waktu, tingkat partisi- meningkatkan mutunya. duduk saat ini skitar 630 ribu jiwa, yang dilaksanakan di Serdang Di antara prestasi yang telah vinsi Sumatera Utara tahun 2007, melalui Kantor Pelayanan Ter- siden RI Prof Dr Boediono di pasi aktif masyarakat dan indika- Menyangkut perbaikan kehi- masih banyak yang perlu men- Bedagai tampak lebih baik dari diraih itu untuk tingkat interna- Juara I Pengelola PKBM Tingkat padu,meningkatkansumberdaya Jakarta. Demikian juga untuk tor pembangunan ekonomi. dupan warga di daerah ini Pem- dapatkan sentuhan pembangu- sebelumnya dan hal ini patut sional adalah, juara I lomba pan- ProvinsiTahun 2007, Juara I Karya manusia di bidang pendidikan. tingkat Provinsi Sumatera Utara, “Data ini akan dijadikan kab Serdang Bedagai meluncur- nan, baik infrastruktur jalan mau- disyukuri bersama. tun pada tahun 2008 di Brunai Tulis Pengaruh Metode Konseling Sedangkan jasa lainnya yang Gubernur Sumatera Utara telah pendukung dalam evaluasi akhir kan berbagai program bantuan pun sarana pelayanan mendasar Dikatakan HT Erry Nuradi Darussalam. terhadap minat belajar Paket B menjadi dasar pertimbangan menetapkan Bupati Serdang di tingkat pusat untuk menentu- untuk mendorong masyarakat lainnya bagi masyarakat. di setiap memberikan arahan Sedangkan prestasi di tingkat Tingkat Provinsi Sumatera Utara pemberian tanda kehormatan Bedagai HT Erry Nuradi sebagai kan peringkat berikutnya bagi bekerja lebih giat. Hal itu dilaku- Sebagai salah satu lumbung kepada masyarakat, kebersamaa nasionaldiantaranya,Pengharga- Tahun 2008, Juara III Karya Tulis adalah berhasilnya Bupati Sergai peringkat pertama kategori Kab.Serdang Bedagai,’’ ujarnya kanuntukmenjadikankabupaten padi di Sumatera Utara Serdang adalah merupakan modal yang anWidyakrama tahun 2006 yang PKBMTahun 2008, Juara III Karya HT Erry Nuradi dan jajarannya aparat kelembagaan Pemkab/ pada pertengahan tahun 2009 ini menjadi salah satu kabupaten Bedagai yang memiliki areal per- sangat berharga. Melalui keber- diberikanPresidenRISusiloBam- Tulis Evaluasi Program Pendi- serta dukungan semua stakehol- Pemko yang berhasil meningkat- lalu. terbaik di Indonesia dengan ma- tanianseluas41.999hektar(sawah samaan suasana kondusif di bangYudhoyono di Provinsi Ban- dikan Non-Formal pada Jambore derdiSergaidalammeningkatkan kan ketahanan pangan daerah. Atas karya nyata ini, masya- syarakatnya yang Pancasilais, beririgasi 35.546 hektar dan yang tengah tengah masyarakat akan ten, Anugrah Satya Lencana Me- PTK-KFtahun2008,JuaraIIKarya kesejahteraanmasyarakatmelalui Penghargaan itu telah diserahkan rakat Serdang Bedagai berharap religius, modern dan kompetitif, tidak beririgasi 6.453 hektar) dapat terpelihara dan proses latitahun2009yangjugadiberikan Tulis Evaluasi Program Pendi- pengembangan prekonomian Wakil Gubsu H Gatot Pudjonu- agar HT Erry Nuradi dan H Soe- PemkabSerdangBedagaiberusa- merupakan salah satu daerah pembangunan akan dapat diper- Presiden RI Susilo Bambang dikan Non-Formal pada tahun sektorpertaniandanproduktifitas groho ST kepada Bupati HT Erry kirman dapat melanjutkan ke- ha membangun dengan angga- penghasil beras terbesar di Pro- cepat. Yudhoyono, Satya Lencana 2009. usaha melalui kelompok usaha Nuradi pada peringatan Hari pemimpinannya di Sergai hingga ran yang terbatas. Justru itu selalu vinsiSumateraUtaraselainKabu- ADD Mempercepat Pembangunan Pendidikan pada Pemkab Serdang Bedagai kecil ekonomi pedesaan di Kabu- Pangan Sedunia tingkat Provinsi 2015 mendatang. Dukungan ini dilakukan dengan skala prioritas paten Simalungun, Langkat dan Pembangunan tahun 2007 yang diberikan juga telah membangun perpus- paten Serdang Bedagai. Sumatera Utara awal Desember datang dari berbagai elemen ma- yangpalingpentingdidahulukan. Deliserdang. Mulai tahun 2010 Dalam mewujudkan perce- Presiden RI Susilo BambangYu- takaan di kecamatan-kecamatan, Pada Agustus, Bupati HT 2009 lalu di Medan. syarakat karena menurut mereka Gerakan Pembangunan bila proyek raksasa bendungan patanpembangunandipedesaan dhoyono di Pekan Baru Riau, membangun pasar di pedesaan, Erry Nuradi selaku Ketua Majelis Dari sederetan prestasi dan HT Erry Nuradi orangnya sangat Swadaya Rakyat (Gerbang Swara) Sungai Ular telah beroperasi sejak beberapa tahun terakhir Juara III Guru berprestasi tingkat memperbaiki saluran irigasi serta Pembimbing Cabang keberhasilan yang diperoleh itu, peduli untuk membangun dae- yang menjadi program juga telah masalah kekurangan air irigasi ini, Pemkab Sergai melalui Ang- nasional tahun 2007 yang diberi- memperbaiki infrastruktur jalan (Ka.Mabicab) Gerakan Pramuka sehinggatidaklahmengherankan rah yang dipimpinnya demi membuktikanbetapapembangu- dan bahkan ke depan dapat lebih garanPembangunandanBelanja kan Mendiknas di Jakarta, Anu- yang dianggap sangat penting. Kab.Serdang Bedagai menerima jika karya nyata yang dilakukan kepentingan rakyat banyak. nanbisadilakukanbersamawarga. meningkatkan hasil produksi Daerah (APBD) telah mengalo- gerah Aksara tingkat Pratama Denganberbagaikaryanyatayang penghargaan”Lencana Melati” di Kab.Serdang Bedagai berhasil Gerakan ini juga telah berhasil pertanian dari yang ada sekarang. kasikan dana untuk desa yaitu tahun 2008 yang diberikan Men- telahditorehkaniniternyatamen- Pramuka.LencanaMelatiitudise- masuk dalam nominasi 10 besar Eddi Gultom
  • 16. 18 Sumatera Utara WASPADA Kamis 7 Januari 2010 Laka Lantas Di Dairi Mayoritas Akibat Alkohol SIDIKALANG (Waspada): Sepanjang 2009 terjadi 75 kasus Jembatan Amblas, kecelakaan lalulintas (Lakalantas) di jajaran hukum Polres Dairi dan penyebabnya didominasi akibat alkohol. Demikian dijelaskan Kasat Lantas AKP Robihatun Angkat di dampingi Pahumas Kompol Ramasten Purba kepada Waspada, Pemko Tunggu Selasa (5/1). Robihatun Angkat menyebutkan, akibat Laka Lantas tersebut 26 meninggal dunia, 65 luka berat dan 32 luka ringan. Sedangkan kerugian material Rp 304 juta lebih. Setelah diteliti, penyebab Laka Lantas itu pengendara atau sopir saat mengemudikan kendaraan Janji Kontraktor tidak normal karena meminum minuman beralkohol. P.SIDIMPUAN (Waspada): dana yang dicairkanpun baru ran hanya sampai 65 persen itu Dikatakan, sedangkan selebihnya karena pengemudi atau sopir 65 persen dan dihentian. Jadi, merupakan tindak lanjut dari kurang hati-hati. Kasus Laka Lantas di jajaran hukum Polres Dairi Dinas Pekerjaan Umum bukan 95 persen seperti infor- hasil pengawasan di lapangan. di 2009 meningkat 20 persen dibanding 2008 sebanyak 54 kasus. Pemko Padangsidimpuan masi sebelumnya. “Proyek itu terdiri dari 8 Akibatnya 31 meninggal dunia, 30 luka berat dan 31 luka ringan. mengakui amblasnya lantai Kemudian, kontraktor objek pekerjaan. Khusus plat Sedangkan kerugian material Rp 445.850.000. jembatan penghubung di berusaha agar target 100 persen beton tersebut berdana Rp 150 Sedangkan kendaraan yang ditilang karena pelanggaran lalu tercapai pada akhir tahun, pro- juta. Kita tetap mengawasi dan lintas 2008 sebanyak 4.181. Tahun 2009 sebanyak 7747 yang di tilang. komplek perkantoran Pal yek itupun dikerjakan dengan karena hasil pengawasanlah Dari data itu, jumlah pengendara (sopir) yang ditilang tahun 2009 Empat Pijorkoling. buru-buru meski pencairan makanya dana dihentikan meningkat dibanding 2008. (a28) dana telah distop. Sehingga hanya sampai 65 persen saja,” terjadi kualitas bangunan asal ujarnya. Sekarang, instansi itu menu- Puluhan Ha Persawahan nggu keseriusan PT Naga Saribu jadi. Dibuktikan hanya beberapa hari saja timbunan tanah plat Sebelumnya, Wakil Ketua dan Sekretaris Komisi II DPRD untuk menepati janji memper- Di Tinada Terancam Gagal Panen baikinya kembali. betonnya amblas. Sebenarnya kita sudah Padangsidimpuan Khoiruddin Nasution dan Sofyan Harahap, “Sebenarnya itu bukan jem- melihat kejanggalan kerja PT menyesalkan proyek amblas TINADA, Pakpak Bharat (Waspada):Puluhan hektar areal lahan batan tapi plat beton, bentuknya Naga Saribu itu. Karenanya, sebelum digunakan. persawahan yang terletak di Desa Tinada, Kec. Tinada, Kab. Pakpak saja yang menyerupai jemba- sebelum inipun Dinas PU telah Sebenarnya mereka telah Bharat bakal terancam gagal panen pada musim tanam kali ini. tan. Proyek itu bagian dari menghentikan pencairan ang- mengetahui kejadian itu saat Pasalnya, irigasi gabe sasmi yang seyogianya mengairi persawahan delapan jenis pekerjaan berdana garan hingga 65 persen saja, monitoring hasil pembangunan itu tidak dapat difungsikan lagi seperti sedia kalanya, pasokan air Waspada/Alamsatriwal Tanjung Rp 1.499.000.000 dan dikerjakan sesuai kemajuan fisik bangunan. Pemko Padangsidimuan, Selasa macet total. RUSAK PARAH: Satu truk saat melintasi Jalinsum Sibolga tarutung yang rusak parah PT Naga Saribu,” kata Kadis PU, Kamis (24/12) pukul 19:30, (29/12). Macetnya pengairan itu, menurut salah seorang pengguna air dikhawatirkan bisa memakan korban jiwa. Foto direkam, Rabu, (6/1). Hamid Syarifuddin Lubis, me- timbunan tanah plat beton am- Kabid Jalan dan Jembatan di desa itu, M Lubis, kepada wartawan akhir pekan lalu mengatakan, lalui Kabid Jalan Jembatan, Kali blas dan hingga sekarang belum Dinas PU sudah dimintai pen- permasalahan ini dikarenakan tindakan dari pemborong yang saat Maulana, Rabu (6/1). diperbaiki kontraktor. Saat kita jelasan, dan berjanji memerin- itu bertindak semena-mena sewaktu pelaksanaan pembangunan proyek akhir tahun anggaran (TA) 2009 lalu. Hal ini ungkapnya, telah menimbulkan polemik dan persoalan Jalinsum Sibolga-Tarutung Rusak Dijelaskan, tahun anggaran 2009 APBD Pemko P .Sidimpuan tegur mereka berjanji memper- baikinya paling lambat Juni 2010, tahkan kontraktor untuk mem- perbaikinya kembali. Tapi sam- menampung anggaran Rp yang berkepanjangan.”Awalnya, pada tahap pengerukan tanah untuk membuat saluran irigasi, CV Pulung Nola telah mengabaikan hak pemilik lahan. Rekanan mengorek dan menggali tanah tanpa seizin Parah, Sering Terjadi Kecelakaan 1.499.000.000 untuk pembangu- nan sarana-prasarana jalan, sesuai batas akhir masa pemeli- haraan, kata Kabid Jalan Jembatan. pai sekarang belum ada tanda- tanda perbaikan dimulai. “Uang rakyat digunakan TAPTENG (Waspada) :Saat tewas. Hanya luka-luka saja, Raisan hingga keTarutung sudah guna memperlancar hubungan Ditanya apakah PT Naga untuk pembangunan proyek warga dimaksud,” jelas Lubis. (c08) ini kondisi badan jalan lintas namun mobil termasuk rusak agak bagus, meski ada juga yang lalulintas di komplek perkanto- Saribu tetap akan menjadi kon- tersebut. Tapi telah rusak sebe- Sumatera (Jalinsum) dari Sibol- parah,” cerita Tarihoran lagi. masih rusak.Makanya, kita ter- ran Pemko P .Sidimpuan di Pal traktor yang menangani lan- lum digunakan, ada apa dengan Ruas Jalan Dalam Kabupaten ga ke Tarutung, khususnya dari Masih menurut Tarihoran, masuk heran, kenapa kawasan Empat Pijorkoling. Pekerjaannya terdiri dari jutan proyek itu, Kabid Jalan kontraktor dan Dinas PU. Ke- batasTapteng hingga batasTaput beberapa badan jalan yang badan jalan di Taput sudah agak Jembatan mengatakan, pihak- Paluta Berlumpur kondisinya termasuk parah. Aki- rusak seperti di kilometer 7, lumayan bagus, namun badan hotmix, LPB, telpot, lapen, paret beton, plat beton, tembok nya akan mempertimbangkan napa bisa seperti itu, jika dise- but akibat bencana alam tak batnya, sering terjadi kecelaka- kilometer 9 Desa Simaninggir jalan di Tapteng banyak yang perusahaan itu, apalagi jika keru- SIMANGAMBAT, Paluta (Waspada) : Kondisi badan jalan di penahan, dan timbunan. Sete- sakan belum juga diperbaiki mungkin,’’ tegasnya. an. Untuk melintasi badan jalan sekitar kawasan Batu Lobang berlubang,” kata Tarihoran lagi. Karena jembatan itu diba- beberapa titik Jalan Ulu Batang Pane I menuju Desa Ulak Tano, yang termasuk sempit dan dan sejumlah badan jalan lain- Mereka berharap kiranya, lah dilakukan tender, PT Naga hingga batas waktu yang di- Kecamatan Simangambat, Kabupaten Padanglawas Utara dengan Saribu menjadi pemenang ten- tentukan. ngun di atas bekas cekdam tanjakan tersebut, terpaksa para nya hingga batas Tapteng Pemkab Tapteng dan Pemprov- PTPN III dan bukan di atas sungai jarak tempuh 5 KM memprihatinkan. pengendara harus ekstra hati- dengan Taput. su dapat lebih berkoordinasi, der untuk mengerjakannya. Mengenai pengawasan Demikian disampaikan, Adriono, 27 warga Ulu Batang Pane Tapi kerjanya sangat lambat, Dinas PU yang lemah terhadap yang tiap saat dialiri air. Ini lebih hati. ”Bahkan badan jalan tiku- sehingga badan jalan keseluru- kepadaWaspada, Selasa, (5/1), di Simangambat. Dikatakan, dengan A Tarihoran,40, salah se- ngan yang sangat menikuk seki- han Sibolga ke Tarutung ini bisa hingga menjelang akhir tahun pekerjaan proyek itu, Kali Mau- cocok disebut akibat keteledo- kondisi jalan yang begitu berlumpur, kendaraan pengangut sumber orang sopir truk Sibolga- Medan tar kilometer 9, termasuk badan lebih baik lagi di kemudian hari. anggaran 2009, kemajuan fisik lana membantah. Menurutnya, ran kontraktor dan Dinas PU, daya alam (SDA) tidak bisa melewatinya. yang sering melintasi badan jalan yang cukup parah.Untuk ”Kalau kita lihat, jangan bangunan baru 65 persen. Maka penghentian pencairan angga- katanya. (a20) Firman, seorang sopir pengangkut sawit mengungkapkan, kondisi jalan mengatakan, seingatnya melintasi badan jalan itu, para karena dari Tapteng ke Medan jalan yang paling terparah terdapat menjelang jembatan pertama menuju Desa Ulak Tano. Selain berlumpur dengan tinggi hinga 50 cm juga di pinggir jembatan, takut tergelincir ke bawah. Ditambahkan, angkutan sawit yang dilakukan dalam setiap telah banyak kendaraan yang mengalami kecelakaan karena banyaknya badan jalan rusak. pengemudi harus sangat ekstra hati-hati. Kalau tak ekstra hati- hati bisa saja mobil terjerembab telah ada pesawat yang hanya bisa dinikmati para kalangan kelas atas, namun jalan darat 5 Rumah Terbakar pekannya mencapai ribuan ton, namun selalu mengalami hambatan akibat sulitnya jalan. Dia mengharapkan, kiranya pihak-pihak terkait agar memperhatikan kondisi jalan itu. (csp) ”Karena terkadang sesama sopir tak bisa mengelakkan ba- nyaknya lobang, terutama saat dan bisa masuk jurang. Karena selain tikungan tajam, juga termasuk tanjakan dan penuru- harus juga segera diperbaiki, yang sekaligus dapat menghi- dari banyaknya kecelaka- Di Muara Batang Gadis berpapasan, mobil sering terpe- nan,” ucapTarihoran lagi. Parah- an,”harap warga Simaningir dan rosok dan terbalik. Seingatku nya lagi, lanjut Tarihoran kalau P.SIDIMPUAN (Waspada): dian, 51, Aril, 52. Api pertama menggunakan sepeda motor. juga para pengguna badan jalan Kakandepag Tapteng Dukung paling sedikit sekali seminggu, ada saja mobil yang mengalami sopir yang sesekali datang ke Sibolga juga harus sangat ekstra lainnya. Lima rumah warga Desa Sika- pas, Kec. Muara Batang Gadis, kali diketahui berasal dari ru- mah milik Nurmasni dan men- Desa itu berada di kecama- tan paling ujung Kab.Madina. Pantauan Waspada di se- Peningkatan Mutu Pendidikan kecelakaan,”kataTarihoran yang juga berdomisili di Desa Simani- hati-hati.”Karena selain badan jalan yang rusak, juga badan panjang badan jalan lintas Su- Kab. Mandailing Natal, hangus terbakar, Rabu (6/1) sekira jalar ke rumah lainnya, namun penyebab atau sumber api be- Dari Panyabungan harus melin- tasi Kota Natal, Desa Tabuyung, nggir, Kecamatan Sitahuis, jalan termasuk sempit dan pe- matera dari Sibolga ke Tarutung pukul 05:30. Tidak ada korban dan Desa Singkuang sebagai SORKAM,Tapteng (Waspada) : Kakandepag Tapteng Drs. Dur lum diketahui. Tapteng. nuh tikungan,” sebutnya. mulai dari batas Sibolga dengan jiwa dalam kebakaran itu, na- ibukota Kec.Muara Batang Gadis. Brutu sangat mendukung perangkat pembelajaran dan peningkatan “Selain 5 rumah, kebakaran mutu pendidikan termasuk tertib administrasi di MAN Sorkam. Diceritakan, Selasa (5/1) Para warga Simaninggir ini, Tapteng hingga batasTaput kon- mun kerugian diperkirakan Sedangkan dari Padang- ini juga menghanguskan 4 Demikian Kepala MAN Sorkam Elmarianti Marbun, SAg, Rabu ada mobil Kijang yang terbalik juga heran. Karena badan jalan disinya sangat memprihatin- mencapai Rp 540 juta. sidimpuan cukup melintasi sepeda motor. Saat ini saya (6/1) di ruang kerjanya menyangkut kegiatan proses belajar mengajar di sekitaran Desa Simaninggir yang rusak parah hanya antara kan.Bahkan ada sebahagian Gapid, warga desa yang Danau Siais Kab.Tapsel, Desa bersama warga yang lain masih di Madrasah Aliyah Negeri (MAN) Sorkam satu-satunya sekolah yang diduga kuat karena badan batas Sibolga dengan Tapteng badan jalan terkesan seperti ku- berada di pinggir Pantai Barat Batu Mundam Kab.Madina, dan berupaya memadamkan api. agama negeri di 4 kecamatan itu. jalan yang berlubang.”Untung serta batas Tapteng dengan bangan kerbau dan sebahagian Sumatera Utara itu menyebut- menyeberangi muara sungai Sebagian rumah penduduk Dikatakan, baru-baru ini pihak sekolah melakukan kegiatan saja kecelakaan tersebut belum Taput.”Kalau badan jalan dari badan jalan nampak tak ada lagi kannya kepada Waspada via dengan getek. dibongkar agar api tidak me- MGMP (Musyawarah Guru Mata Pelajaran) dihadiri langsung oleh mengambil korban jiwa yang batas Taput atau sekitar Aek aspalnya.(a34) telepon. Katanya, api sangat sulit rembet ke rumah lain,” katanya. Desa Sikapas agak terti- KakandepagTapteng dengan menghadirkan narasumber dari LPMP dipadamkan karena tidak ada Desa Sikapas berada di nggal, dan masyarakatnya Medan Mahmud Arifin, Mpd Pada prinsipnya dalam arahan Kakandepag Tapteng sangat mendukung sekaligus memberikan motivasi kerja kepada seluruh STAKPN Tarutung Diadukan mobil pemadam kebakaran di daerah itu. pinggir Pantai Barat dan ber- batasan dengan Kab.Tapanuli masih menggunakan kayu bakar. Karenanya, untuk semen- dewan guru agar tetap berpedoman pada kurikulum dengan mem- buat RPP (rencana pokok pembelajaran) sebagai tindak lanjut dalam Ke DPRD Sumut Rumah yang terbakar itu milik Nurmasni, 55, Nikmat Harahap, 43, Marina , 40, Mar- Selatan. Jarak tempuhnya lebih dekat dari Padangsidimpuan daripada Panyabungan jika tara penyebab kebakaran itu diduga berasal dari tungku milik Nurmasni. (a19/a20) proses belajar mengajar. Diakui Elma, setiap akhir bulan dilakukan evaluasi kinerja dengan MEDAN (Waspada): Sejum- kutan adalah lulusan Ilmu So- sesuai dengan Bestek, sehingga melakukan musyawarah dewan guru agar kendala yang dihadapi dalam proses belajar mengajar mendapat solusi dalam melakukan pembenahan. lah masyarakat mengatasnama- kan Forum Peduli Perguruan Tinggi Agama Kristen Protestan siologi. Namun STAKPN Taru- tung mengeluarkan surat kete- rangan yang isinya menyatakan meskipun baru dibangun namun sudah rusak. Kemudian soal konsultan pemenang ten- Jaksa Tahan Oknum Raja Paluta Menyangkut program kedepan, Elma mengakui pihaknya sudah Negeri (FP2STAKPN) Tarutung dia menjadi S.PAK (Sarjana Pen- der pembangunan gedung yang P.SIDIMPUAN (Waspada): SDOH keturunan raja di Portibi menyebutkan, sebelumnya membentuk tim kegiatan ekstra kurikuler di antaranya bidang mengadukan sejumlah temuan didikan Agama Kristen). Sehi- mereka tuding memiliki kekera- Kejaksaan Negeri (Kejari) dan pengusaha kebun sawit,” SDOH melaporkan Baginda keagamaan diketuai Arsyad Nasution,SAg, Bidang Kesenian Siti penyimpangan di bidang kead- ngga data kepegawaiannya di- batan dengan pejabat di STAKP Pdangsidimpuan menahan ujar seorang Jaksa yang menolak Mangaraja Endar Harahap alias Aminah Gorat,SAg dan Olah Raga Pirdaus,Spd. (a34) ministrasian dan kepegawaian ubah dari S.Sos menjadi S.PAK,” NTarutung, serta sejumlah pem- seorang oknum yang disebut- ditulis identitasnya. Marasahlim Harahap dengan perguruan tinggi itu ke DPRD kata Situmorang. bangunan gedung dan audito- sebut keturunan Raja di Portibi, Informasi diperoleh Was- tuduhan telah menjual tanah Sumut, Senin (4/1). Menurut Marjo, proses rium yang ditargetkan selesai SPDP Tersangka Mereka diterima Ketua yang sama juga dilakukan pada tahun anggaran 2009, SDOH, warga Lingkungan II, Pasar Gunung Tua, Kab. Pa- pada, karena sudah tiga kali tidak menghadiri panggilan miliknya. Padahal tanah itu telah dibeli Komisi E DPRD Sumut, Brilian terhadap salah seorang kerabat Penganiaya Balita Ke Kejari Moktar didampingi anggota Ko- Pejabat STAKPN Tarutung yang namun sampai sekarang masih terbengkalai. danglawas Utara, Selasa (5/1) sore. jaksa, akhirnya personil Polres Tapsel yang sebelumnya mena- SDOH dari Baginda Mangaraja. Namun setelah di persidangan, misi E dari Fraksi Demokrat, lain, sehingga kedua kerabatnya Ketua Komisi E DPRD Su- SIBUHUAN (Waspada): Polsek Barumun menyerahkan Surat Nurhasanah. Dalam pertemuan berhasil menjadi dosen PNS di Dia ditahan karena tiga kali ngani perkara dan telah melim- majelis hakim memutuskan Pemberitahuan Dimulainya Penyelidikan (SPDP) atas nama tersangka mut, Brilian Moktar mengata- tidak menghadiri panggilan jaksa pahkan berkasnya ke jaksa, vonis bebas terhadap Baginda itu, pimpinan rombongan, STAKPN Tarutung.“Kasus ijazah AP 28, penganiaya balita Putra Harianto. , Marjo Situmorang melaporkan gate ini sebenarnya telah men- kan akan mengagendakan pe- dalam perkara pemalsuan tan- menjemput paksa SDOH. Mangaraja. Karena berdasar- Kapolres Tapsel AKBP Subandria melalui Kalpolsek Barumun tentang perekrutan Calon Pega- jadi rahasia umum di masyara- manggilan pihak rektorat datangan yang dilaporkan Ba- Setelah diserahkan ke Kejari kan keterangan saksi dan barang AKP H. Herwansyah Putra mengungkapkan itu di Sibuhuan, Rabu wai Negeri Sipil (CPNS) dosen kat. Tapi tidak pernah menda- STAKPN Tarutung pada Fe- ginda Mangaraja Endar Hara- P. Si d i m p u a n , t e r s a n g k a bukti di persidangan, tuduhan (6/1). Dikatakan, SPDP diserahkan ke Kejaksaan Negeri Padangsi- di perguruan tinggi itu yang ter- patkan perhatian dari pemerin- bruari mendatang. Dia juga me- hap alias Marasahlim Harahap, diperiksa Kasi Datun Agussalim SDOH tidak terbukti. dimpuan Cabang Sibuhuan, Senin (4/1). indikasi korupsi, kolusi dan ne- tah ataupun Departemen minta FP2 STAKPN untuk me- 53, warga Lorong II, Desa Portibi Nasution sebagai jaksa yang Usai mendengar putusan “Penyerahan berkas tersangka belum merupakan pelimpahan, potisme (KKN). Dimana kera- Agama RI,” katanya. lengkapi data yang mereka Jae, Kec. Portibi, Kab.Paluta. menangani perkara itu. Sore hakim, Baginda Mangaraja tapi menunggu pemberitahuan hasil penelitian Jaksa apakah berkas Mereka juga melaporkan laporkan. “Kalau soal ijazah, itu bat salah seorang pejabat STAKP “Yang bersangkutan telah harinya tersangka ditahan atas membuat laporan ke polisi. tersebut sudah lengkap atau P .21”, ujar H.Herwansyah. bukan kewenangan kami untuk Kata Kapolsek, kepada tersangka dikenakan pasal berlapis yakni N Tarutung diteriman menjadi soal penyelewengan dalam pro- ditahan untuk memudahkan surat perintah penahanan dari Pasalnya, SDOH telah memal- Pasal 82 No.23/2002 tentang perlindungan Anak dan Pasal 351 KUH dosen, padahal latar belakang yek pembangunan fisik kampus menentukan ijazah itu palsu proses pemeriksaan sebelum Kejari P .Sidimpuan, Indrasyah sukan tandatangannya pada Pidana tentang penganiayaan berat. Ditambahkan, keluarga tersangka pendidikannya tidak sesuai. STAKPN Tarutung. Seperti atau tidak, tapi kewenangan berkasnya dilimpahkan ke Djohan. surat keterangan ganti rugi ta- melakukanupayadamai,namunhalituadalahwewenangpengadilan. “Sebenarnya yang bersang- gedung yang dibangun tidak instansi terkait,” katanya. (h11) Pengadilan Negeri. Katanya Informasi lain diperoleh nah seluas 15 hektar. Pemalsuan Kasus penganiayan itu dengan korban yang berusia 4 tahun tandatangan itu diketahui 2 bulan. Korban dianiaya dengan pukulan dan sulutan api rokok ayah tirinya, hanya karena balita itu buang air kecil di tempat tidur. Secara terpisah, keluarga korban Raja Syahnan Hasibuan dan Kelestarian Danau Toba Harus Dijaga Bersama setelah surat tersebut diperiksa di Laboratorium Forensik Polri. PARAPAT ( Waspada): dangan juga terlihat para tamu akhirnya merusak alam. Tapi karena jaksa yang Ija Hasibuan kepada Waspada di Sibuhuan mengatakan, kasus menangani perkara pengaduan penganiayaan oleh tersangka AP terhadap keponakan mereka itu, Danau Toba merupakan karu- dari umat beragama lain seprti Upaya melestarikan Danau nia Tuhan yang luar biasa bagi Muslim Parapat, Bhiksuni dari Toba ini merupakan kewajiban SDOH terhadap Baginda Ma- diharapkan berjalan sesuai prosedur hukum yang berlaku.“Kami berharap agar pengadilan mengadili dan menghukum tersangka umatnya, sehingga sangat vihara darma batham graha semua pihak termasuk guru dan ngaraja mengajukan permoho- dengan hukuman yang seadil adilnya”, harap Raja Syahnan. (crif) disayangkan apabila keindahan dan pastor dan turut pula diha- para toko masyarakat. Oleh ka- nan kasasi atas putusan PN alam yang mempesona itu ti- diri para undangan dari umat rena itu, dengan semangat P.Sidimpuan ke Mahkamah dak dijaga dan dilestarikan de- beragam lain seperti dari tokoh Natal ini mari kita jadikan mo- Agung, maka proses penanga- Camat Pakantan Utusan ngan baik. Kemudian, menjaga bergama Islam di Parapat, Bhik- mentum, untuk membangun nan hukum pengaduan Baginda kelestarian Danau Toba dimak- suni dariVihara Darma Batham kehidupan ke depan jauh lebih Mangaraja terhadap SDOH ter- Sumut Ke Jepang sud tidak bisa hanya dengan Graha dan pastoran, serta peja- baik, lebih berkualitas dan tunda dan menunggu putusan kata-kata atau retorika belaka, bat jajaran Pemkab Simalungun, meningkatkan rasa tanggung MA. PANYABUNGAN (Waspada): Camat Pakantan, Kab. Mandailing tetapi harus dilakukan secara muspika dan ribuan masyarakat jawab setiap insan khususnya Natal Drs Parlin Lubis, AP menjadi utusan Sumatera Utara ke Jepang , Selanjutnya, MA melalui bersama oleh seluruh stakehol- setempat. di kota turis Parapat sebagai putusan No: 802 K/PID/2009, dalam The Training Programme For Young Leaders bidang Local Administration dari 15 November 2009 - 5 Desember 2009. der yang ada. Bupati Simalungun itu me- pelaku pariwisata yang harus menolak permohonan kasasi Parlin kepada Waspada, Selasa (5/1) di Panyabungan “ Pekerjaan ini dimulai dari nekankan, kepada masyarakat bisa membuktikan diri menjadi JPU Kejari P .Sidimpuan terha- mengemukakan, keberangkatannya ketika itu bersama 16 rekannya seluruh masyarakat, khususnya yang mempunyai usaha keram- tuan rumah yang baik bagi wisa- dap putusan PN P .Sidimpuan dari seluruh Indonesia di lepas Perwakilan Biro KTLN Sekretariat yang ada di seputar DanauToba. bah (jaring apung) di perairan tawanyangdatang,”harap bupati. No:398/Pid.B/2008/PM.PSP . Negara Republik Indonesia dan Japan International Cooperation Diantaranya, para tokoh ma- Danau Toba diharapkan turut Sementara itu, T Sinaga Untuk itu, Baginda Manga- Agency (JICA) Pusat Jakarta. syarakat dan seluruh unsur pe- serta menjaga kebersihan dan salah seorang tokoh Masyarakat raja meminta proses penanga- Pelatihan ini, katanya, dilaksanakan dalam meningkatkan merintah, dan bukan hanya di keindahannya, tidak boleh di Kec. Girsang Sipangan Bolon Simalungun dengan Parapatnya merusak keindahan alam yang dalam sambutannya pada nan hukum pengaduannya hubungan perdamaian dan kesejahteraan abadi, berdasarkan saling pengertian dan persahabatan yang tulus untuk memberikan saja, tetapi melibatkan seluruh sudah Tuhan berikan, apalagi acara Natal Oikumene tersebut Waspada/Hasuna Damanik yang sudah dilimpahkan Polisi DISAMBUT HANGAT: Bupati Simalungun, HT Zulkarnain ke jaksa untuk segera dilanjut- kesempatan kepada peserta agar dapat mengamati dan mengenal kabupaten yang ada disekitar ekosistemnya.Kerambah bukan juga mengajak agar semua ma- Damanik, disambut hangat panitia Natal Oikumene di Parapat. langsung wajah asli Jepang Danau Toba,” tegas Bupati Sima- tidak boleh, tetapi harus ada syarakat yang ada di Kecamatan kan. Kemudian jaksa melaya- Selama di Jepang, papar Parlin, mereka diberikan pelatihan lungun, HT Zulkarnain Dama- batasan-batasanya. Artinya di girsang, terutama di kota turis rasa syukurnya atas kehadiran Gurning dalam laporannya ngkan surat panggilan kepada kepemimpinan meliputi aspek umum tentang politik, ekonomi nik, dihadapan masyarakat Kec. zona - zona tertentu yang telah Parapat dapat menumbuhkan para umat agama yang lain, menyebutkan, kegiatan itu SDOH, namun sudah tiga kali dan pemerintahan Jepang serta aspek khusus meliputi pemberdayaan Girsang Sipangan Bolon, Para- ditetapkan. rasa kebersamaan dan menjaga yang menurutnya menunjuk- didukung oleh seluruh umat dia tidak pernah hadir. masyarakat desa, pertanian, perikanan, kebudayaan dan pariwisata. pat, saat menghadiri acara Na- “Membuat kerambah men- kelsetarian Danau Toba sehi- kan rasa kebersamaan dan tole- beragama lain yang berada di Sehingga, Selasa (5/1) polisi Untuk memudahkan komunikasi dan koordinasi antara peserta tal Oikumene se- Kec. Girsang jadi penghasilan keluarga boleh. ngga akan bisa mendatangkan ransi antar umat beragama yang Parapat dan sekitarnya. Semen- menjemput paksa dan menye- di Jakarta dan di Jepang, peserta The Training Programme For Sipangan Bolon, akhir Desem- Tetapi setiap masyarakat yang wisatawan, yang merupakan baik di Simalungun. tara soal pendanaan, disebut-kan rahkan tersangka ke jaksa. Se- Young Leaders mengangkat Ketua kelompok yang terdiri dari Ketua ber 2008 lalu. mengusahainya tidak boleh bagian dari mata pencaharian Sebelumnya, Ketua Panitia peran serta Bupati Simalu-ngun Drs. Parlin Lubis, AP (Sumut), Sekretaris, Rachmad Firdaus (Jambi), lanjutnya SDOH ditahan dan Bendahara Halwiyah (Sulawesi Selatan) dan Dokumentasi Pradipta Selain dihadiri 27 jemaat ge- egois dan tanpa mempertim- di Parapat. Natal Oikumene Se-Kec. Gir- yang memberikan donasi dana dititipkan di LP Kelas IIB Salam- Anggi Wirasanto (Kebumen, Jawa Tengah). (a24) reja denominasi, di bangku un- bangkan sisi kelestarian danau, Sinaga pun mengungkapkan sang Sipangan Bolon Marolop Natal sebesar Rp10 juta. (a15) bue. (a20)
  • 17. WASPADA Kamis 7 Januari 2010 Sumatera Utara 19 Sat Pol PP Diminta Tertibkan Bangunan Liar TANJUNGBALAI (Waspada) : Satuan Polisi Pamong Praja diminta menertibkan bangunan liar atau IMB, karena keberadaannya Tarif Naik, Distribusi Air Masih Diragukan melanggar Perda. nannya,” jelas Irwansyah. Selain usulkan. Jika itu terealisasi, nal listrik dan bahan kimia. Iro- untuk pengolahan 450 ribu lannya, itu masih dua kompo- Hal itu dikatakan anggota DPRD Kota Tanjungbalai dari Fraksi TANJUNGBALAI (Waspada): itu, kata Irwansyah, setelah tarif distribusi air tidak akan terken- nisnya, untuk biaya dua kompo- meter kubik air bersih perbulan, nen saja, belum komponen Golkar Romay Noor, Selasa (5/1), terkait menjamurnya bangunan Penyesuaian tarif dasar disesuaikan, Pemerintah Pusat dala lagi,” kata Dedi. nen itu, perusahaan daerah itu kita harus mengeluarkan biaya lainnya,” kata Kordinator Tim tanpa IMB termasuk pengalihan fungsi bangunan tanpa izin. “ Harus yang diberlakukan PDAM juga bakal menghapus utang Sebelumnya, tarif lama yang minus sebesar Rp 200 per meter Rp 350 juta. Jadi, dengan tarif Sosialisasi Penyesuaian tarif ditertibkan, sebagai wujud penegakan Peraturan Daerah Kota Tirta Kualo, belum PDAM Tirta Kualo sebesar Rp diberlakukan PDAM Tirta Kualo kubik setiap bulan. dasar Rp 600 permeter kubik, PDAM Tirta Kualo Dedi Adrian Tanjungbalai yang dikeluarkan Pemko,” kata Romay. 4,5 miliar dari Rp 6 miliar. Kota Tanjungbalai, tidak mam- “ Biaya operasional khusus maka terjadi minus sebesar Rp kepada Waspada, Selasa (5/1). Jika Perda ini tak dilaksanakan, lanjut Romay, yang rugi justru menjamin peningkatan Sementara, Kordinator Tim pu memenuhi biaya operasio- tarif listrik dan bahan kimia 200 permeter kubik setiap bu- (a37) Pemko Tanjungbalai, baik moral maupun materi. Maksudnya, kata kualitas dan distribusi air Sosialisasi Penyesuaian tarif Romay, PAD dan penataan kota dirugikan, seperti pengalihan fungsi bersih kepada para PDAM Tirta Kualo Dedi Adrian bangunan ruko menjadi rumah atau sarang walet serta penambahang pelanggan. menambahkan, tarif lama ini bangunan tanpa izin. berlaku sejak Februari 2002 lalu, “ Saya sering menerima laporan masyarakat, beberapa tahun dan pihaknya sudah tiga kali terakhir ini banyak bangunan tanpa IMB sehingga menimbulkan “ Kenaikan tarif dasar ini mengajukan penyesuaian tarif, tanda tanya apa saja kinerja instansi terkait, padahal instansi itu tidak serta merta kualitas dan namun ditolak Pemko. “ Tiga punya peran vital dalam hal pengawasan,” tegas Romay. (a37) distribusi air bersih kepada kali kita sudah mengajukan pe- pelanggan meningkat, tapi ini nyesuaian tarif, tapi tidak dise- Sungai Silau Akan Dikeruk merupakan langkah awal me- nuju pelayanan prima,” kata tujui Pemko, dan diganti dengan subsidi selama 3 tahun mulai KISARAN (Waspada): Penanggulangan banjir di Kab. Asahan, staf ahli PDAM Tirtanadi Me- 2007 sampai 2009 untuk meme- Sungai Silau akan segera dikeruk, terkait adanya banjir musiman dan, Drs Irwansyah kepada nuhi kebutuhan operasional. yang disebabkan sungai tersebut meluap. Waspada di kantor PDAM Tirta Tahun ini tidak ada lagi subsidi, “Sungai Silau sudah dangkal, sehingga kami berusaha agar sungai Kualo Tanjungbalai, Selasa (5/ maka tarif kita naikkan,” kata itu dapat dikeruk secepatnya,” ujar anggota Komisi C DPRD Asahan 1) sore. Dedi. Ilham Harahap S.Ag dikonfirmasi Waspada, Selasa (5/1). Dan, menurut konsultan Dedi juga menyatakan, Pengerukan sungai tersebut, katanya, berdasarkan keputusan penyesuaian tarif dasar PDAM penyesuaian tarif ini bukan rapat dengan Dinas Pekerja Umum (PU), Pertanian, Pengarian Tirta Kualo itu, dengan diberla- menjamin meningkatnya kuali- dan Otorita Asahan, beberapa waktu lalu, dengan memakai kapal kukannya tarif dasar baru atau tas dan distribusi air bersih. “ keruk yang digunakan di Sungai Asahan. penyesuaian, Pemerintah Pusat Kapasitas WTP I dan II hanya “Berdasarkanpantaukami,penanggulanganbajiryangdisebabkan bakal membantu penambahan 205 liter perdetik dengan jumlah sungai meluap,tidakbisaditanggulangidenganmembentengpinggiran debit air melalui kelanjutan pelanggan mencapai 17 ribu, sungai, namun sungai harus didalamkan, agar aliran air lancar,” pembangunan WTP III. padahal idealnya 1 liter perdetik ujar Harahap, anggota komisi yang menangani tentang lingkungan. “ Pusat tidak akan memban- itu melayani 70 pelanggan. Jadi, Selain itu, katanya, Komisi C akan berangkat ke Jakarta untuk tu jika tarif PDAM Tirta Kualo dengan adanya penyesuaian tarif menindak lanjuti rencana tersebut dengan pihak Otorita Asahan masih di bawah standar, tapi ini, mudah-mudah Pemerintah pusat,karena banjiryangdisebabkansungaimeluapsudahmerepotkan kalau sudah disesuaikan, bukan Pusat mengabulkan bantuan sebahagian warga yang tinggal dekat aliran sungai tersebut. hanya WTP III, tapi WTP IV juga pembangunan WTP III dan IV, Disinggung,rencanapenggulanganbanjirmenunggupengerukan akan dibantu pembangu- dan permohonannya sudah kita dilakukan, Harahap belum bisa memberi komentar. (csap) Tiga Kali Dipanggil DPRD, PDAM Gubsu Didesak Keluarkan Belum Menunjukkan Perubahan SK Pimpinan DPRD T. Balai KISARAN (Waspada): Seba- “Kita tidak tahu apa penye- TANJUNGBALAI (Waspada) : Gubernur Sumatera Utara didesak nyak tiga kali Direktur PDAM babnya PDAM menghindar menerbitkan Surat Keputusan pimpinan definitif DPRD KotaTanjung- Tirta Silau Piasa (TSP) Kisaran memberikan informasi, akibat- Waspada/Surya Efendi balai periode 2010-2015. dipanggil DPRD Asahan, na- nya, masyarakat menilai mereka TANJUNGBALAI – HONGARIA: Walikota Tanjungbalai, Soetrisno Hadi sebelum menyampaikan persentasi didampingi Jika, Kamis (7/1), SK itu tak kunjung turun, maka seluruh anggota mun hingga saat ini penyaluran tidak peduli dan gagal dalam penerjemah (duduk paling kiri) dan Ketua Kadin Sumut (duduk paling kanan) mendengarkan sambutan Gubernur Bekes DPRD Kota Tanjungbalai akan mendatangi Kantor Gubsu, dan tidak air bersih terhadap masyarakat tugas,” ujar Zainal. County, Hongaria, Mr Domokos Laseos (berdiri) pada pertemuan di Hotel JW Marriott Medan, Rabu (6/1). Hari ini, Kamis akan pulang sebelum SK itu dikeluarkan. belummenunjukkanperubahan. Menurutnya, bila PDAM (7/1), rombongan Gubernur Bekes County, Hongaria akan mengunjungi Kota Tanjungbalai menjajaki kerjasama di berbagai Hal itu dikatakan Ketua sementara DPRD Kota Tanjungbalai Hal itu dinyatakan anggota merasa tidak mampu mengu- bidang. Artati dan Hakim Tjoa Kian Lie kepada Waspada, Selasa (5/1). “ Komisi B DPRD Asahan Abdul rusi kebutuhan air di Kisaran, Hingga saat ini SK dua pimpinan definitif DPRDTanjungbalai periode Kholik Harahap dikonfirmasi maka serahkan tugas itu kepada 2010-2015 belum turun, apabila sampai Kamis depan tak rampung Waspada, Rabu (6/1). Menurut- orang lain, dengan demikiankan Sidak Melihat Langsung Inalum Santuni 125 Anak Yatim juga, kami akan datang ke kantor Gubsu,” kata Artati. nya, panggilan itu tidak diacuh- selesai masalahnya, dan jangan Dua nama yang diajukan sebagai pimpinan DPRD KotaTanjung- balai yakni Eka Hadi Sucipto Hadi dari Fraksi Golkar dan Surya kan PDAM TSP sehingga tidak , mengambing hitamkan warga Kesiapan Aparatur Daerah TANJUNGGADING(Waspada): HUT ke-34 PT Inalum yang diperingati pada, Rabu(6/1) diisi dengan penyerahan santunan kepada ada perubahan yang tidak bayar iuran, sehingga Darma AR dari Fraksi PDI Perjuangan. Pengajuan nama kedua calon “Komisi B akan berencana air macet. LIMAPULUH ( Waspa- penambahan personil sebagai 125 anak yatim yang tersebar dari 11 desa dan kelurahan disekitar itu, berdasarkan hasil paripurna khusus DPRDTanjungbalai beberapa memanggil pihak PDAM kem- “Jangan pancing kemara- da):Melalui sidak diharapkan langkah mengisi kekurangan PT Inalum. waktu lalu, dan telah diajukan Pemko Tanjungbalai ke Gubsu. bali untuk keempat kalinya, han warga, bila mereka sudah dapat melihat langsung kesia- tenaga PNS selama ini sesuai Hadir di sana Direktur Umum dan SDM PT Inalum Ir H Nasril “ Jika SK itu tak turun, kapan lagi DPRD membahas kegiatan untuk menanyakan sejauh mana bertindak, maka semuanya pan aparatur daerah dalam posisi dibutuhkan. Kamaruddin, MBA, Direktur Bisnis Drs Sahala Sijabat, Bupati Batubara 2010 yang dituangkan dalam APBD. Sebelum pembahasan antisipasi dalam mangatasi pe- akan hancur, karena ini masalah menjalankan tugas sehari-hari. ‘’Di sini sudah jelas diutama- OK Arya Zulkarnain, dan pejabat lainnya. dilaksanakan,tentunyaDPRDlebihdahulumenyusunalatkelengkapan nyaluran air bersih,” ujar hak mereka yang telah dikang- Di samping untuk mengisi pe- kan dari kelulusan SMK Dinas Nasril dalam sambutannya mengatakan, santunan kepada anak dewan serta jadwal pembahasan,” tukas Artati. Harahap. kangi,” ujar Zainal. rangkat SKPD yang kekurangan Kelautan karena sudah porsi- yatim ini adalah bentuk kepedulian sosial perusahaan kepada Hakim Tjoa Kian Lie menambahkan, rencana kedatangan anggota Harhap menjelaskan, masa- Sebelumnya, Kabag Humas tenaga personil dengan me- nya,’’ ujar OK Arya. masyarakat sekitar. DPRD ke kantor Gubsu, bukan ancaman, tapi desakan tugas yang lah macetnya air bersih kepada Pemkab Asahan Rahmad Hi- nempatkan PNS yang baru lulus Penempatan PNS segera “ Kami menyadari bahwa jumlah anak - anak yatim dan bantuan harus segera dirampungkan. (a37) masayarakat, merupakan hal dayat Siregar menjelaskan, pe- pada penerimaan seleksi baru dilakukan dalam waktu dekat ini tidaklah besar, walaupun demikian kami berharap agar bantuan menyangkut hidup orang ba- nyebab tersendatnya penyalu- lalu. yang diharapkan dapat me- ini dapat memberikan manfaat meringankan beban kehidupan anak - anak yatim yang juga sebagai upaya untuk mengingat tali Komnas HAM Minta Gubsu nyak, karena kebutuhan itu adalah kebutuhan mutlak bagi ran air bersih dari PDAM salah satunya terkendala pada ang- Bupati Batubara OK Arya Zulkarnain, SH.MM mengata- ningkatkan kinerja SKPD dalam menjalani roda pemerintahan kasih antara perusahaan dan masyarakat sekitar,” ujar Nasril. Diterangkannya, berkat doa dan restu serta dukungan dari Klarifikasi Soal Wabup Batubara warga, sehingga mereka berhak mendapatkannya. garan, karena PDAM hingga saat ini sedang melakukan perbaikan kan, itu kepada Waspada di sela-sela melakukan kunjungan dan pelayanan dimasyarakat. Kedatangan bupati diterima masyarakat sekitar, perusahaan dapat beroperasi dengan aman Menghindar pada saluran yang bocor, inspeksi mendadak (sidak) ke Kadis Perikanan dan Kelautan dan stabilselama tahun 2009. (a31) LIMAPULUH (Waspada): Komisi Nasional Hak Asasi Manusia (KOMNAS HAM) Indonesia melalui surat nomor 3.578/K/PMT/ Sementara di lain tempat, karena perbaikan itu memakan sejumlah SKPD di lingkungan Ir Azwar Hamid MSC beserta XII/2009 meminta Gubsu mengklarifikasi pengaduan anggota Ketua LSM Jaringan Penegak Masyarakat Demokrasi (JPMD) terlalu lama sehingga timbullah kemacetan dalam pendistri- Pemkab Batubara sekaligus me- ninjau proses pembangunan staf. Turut mendampingi Kepala 4.443 Orang Kenaikan Angkatan 45 H Mukhtar Tanjung tentang Wakil Bupati Batubara. H. Mukhtar Tanjung kepada Waspada, Selasa (5/1) mengatakan, Asahan Zainal Abidin S.Pd.I menjelaskan, pihak PDAM di- busian air, selain itu, kata Hidayat, ditambah lagi banyak dari ma- kantor pemerintahan di Desa Perupuk dan Gambus Laut, Kec Badan Kepegawaian Daerah (BKD), Ahmad Ilham, SH.MAP , Pembaca Buku Di Asahan ia telah membuat pengaduan tertulis kepada Presiden RI, Mahkamah Konstitusi dan Komnas HAM meminta fatwa tentang persoalan nilai menghindar dan tutup syarakat yang tidak membayar, Limapuluh, Senin (4/11). Kabag Umum Asmunan, Kabag KISARAN (Waspada): Pembaca buku di Asahan mengalami Wakil Bupati Batubara Drs Gong Matua Siregar yang tidak diberi mulut dalam memberikan in- sehingga PDAM tidak mendapat Salah satunya, lanjut bupati Humas Efrianis, SH, Kasat Pol kanaikan, terbukti bertambahnya jumlah pengunjung di Kantor tugas apapun di Pemkab Batubara. formasi tentang penyebab ma- cukup dana untuk membayar pada Dinas Perikanan dan Ke- PP Raja Imbalo Lubis dan Kadis , Perpustakaan dan Arsip Daerah Kab Asahan sebanyak 4.443 orang Selain itu, personil pengamanan dari Kesbang Linmas di rumah cetnya air kepada masyarakat. listrik. (csap) lautan direncanakan dilakukan PU. (a11) di tahun 2009. dinasWakil Bupati sejak Mei 2009 dicabut tanpa ada pemberitahuan “Sepanjang 2008, jumlah pengunjung mencapai 15.606 orang, sebelumnya kepada yang bersangkutan. Bupati Batubara juga melarang keras untuk bertemu wakil bupati, apabila ada yang melanggar perintah akan diberikan sanksi berupa Pemimpin PDIP Harus Pro Rakyat Kecil namun pada tahun 2009 meningkat sebanyak 4.443 orang, atau menjadi 20.049 pengunjung,” jelas Kakan Perpustakaan dan Arsip Daerah Fahyuri Sembiring didampingi Kabid Perpustakaan Nurdiana mutasi atau pencopotan jabatan. Akibatnya, 80 persen kepala dinas TANJUNGBALAI (Waspa- Oleh sebab itu, kata Eko, tingan partai daripada kepen- Muslim Sitompul bersedia, dikonfirmasi Waspada, Rabu (6/1). tidak kenal wakil bupati. da) : Calon pemimpin Dewan untuk menentukan pimpinan tingan pribadi,” kata Manik. maka mereka siap mendukung- Menurutnya, dari jumlah itu, yang mendominasi pembaca adalah Komnas HAM, berdasarkan pengaduan itu sesuai dengan kewe- Pimpinan Cabang PDI Perjua- DPC PDI Perjuangan periode Di tempat terpisah, 6 PAC nya memimpin PDI Perjuangan dari kalangan pelajar SD, karena perpustakaan berdekatan dengan nangan dan pemantauan dalam Pasal 89 Ayat (3) Undang - undang ngan Kota Tanjungbalai harus 2010-2015, dibutuhkan pertim- PDI Perjuangan se Kota Tan- Tanjungbalai lima tahun ke SD. “ Bila waktu istirahat sekolah, banyak pelajar datang kemari No. 39/1999 tentang Hak Asasi Manusia, Komnas HAM mengingatkan mampu memperjuangkan hak bangan matang agar tidak salah jungbalai, meminta kesediaan depan. “ Kepemimpinan Muslim untuk membaca,” ujar Sembiring. Gubsu, hak mengembangkan diri dijamin undang-undang. rakyat kecil, peduli dan cinta pilih. “ Pemimpin harus rendah Muslim Sitompul untuk me- Sitompul selama 5 tahun ini cu- Selain itu juga, kata Sembiring, banyak pembaca dari pelajar Surat yang ditandatangani oleh Komisioner Komnas HAM Johny partai serta disenangi seluruh hati, tidak opurtunis, tapi mam- mimpin kembali partai berlam- kup baik, dan agar PDI Perjua- lainnya ditambah lagi mahasiswa dan kalanagan umum, yang Nelson Simanjuntak,SH memberi waktu kepada Gubsu paling lama lapisan masyarakat. pu memperjuangkan hak ‘wong bang Banteng itu. ngan lebih baik lagi khususnya menghabiskan waktu senggangnya untuk membaca. 30 hari kerja sejak diterimanya surat ini. (a31) “ Kriteria seperti itulah yang cilik’ dan tidak bertentangan Hal itu dinyatakan delegasi di Tanjungbalai, maka dia harus memimpin kembali partai ini,” “Oleh sebab itu, kami akan tingkat terus minat membaca mampu menentukan langkah antara keinginan pribadi dan PAC masing-masing yakni, kata mereka. masyarakat dengan menyediakan buku-buku yang mereka perlukan, PDI Perjuangan, karena kredi- partai,” tukas Eko. Datuk Bandar Konradin Barasa, Sementara, Muslim Sitom- dan hingga saat ini buku yang tersedia di perpustakaan sebanyak bilitas, kompetensi dan tang- Hal sama dikatakan simpa- Datuk Bandar Timur Rolet pul dikonfirmasi Waspada me- lebihkurang21ribueksemplar,dengan700judulbuku,”ujarSembiring. gung jawab pimpinan sangat tisan PDI Perjuangan, Hendri Simanjuntak, Tanjungbalai Sela- nyatakan siap menerima ama- Sembiring juga menjelaskan, pihaknya akan merencanakan menopang maju dan berkem- Manik. Menurutnya, PDI Per- tan Khairul Amri, Tanjungbalai nah yang diberikan 6 PAC PDI pengadaan perpustakaan mini di setiap ibu kota kecamatan, sehingga bangnya partai,” kata Wakil juangan harus dipimpin sosok Utara Erwin, Sei Tualang Raso Perjuangan itu.“ Jika sudah 6 PAC minat baca masyarakat dapat terpenuhi. Ketua PAC PDI Perjuangan Tan- yang mampu mengembangkan M Buyung Sitorus dan Teluk yangmeminta,makadenganrasa “Menunggu rencana itu, kami tetap menjalankan mobil pintar jungbalai Utara, Eko Ramadhani sayap partai di seluruh lapisan. Nibung Amiruddin Sitompul. haru saya akan menerima ke sekolah-sekolah dan desa yang dapat dijangkau, sehingga warga kepada Waspada Rabu (6/1). “ Lebih mengutamakan kepen- Dikatakan mereka, apabila amanah itu,” jelas Sitompul. (a37) tetap terdidik untuk membaca,” ujar Sembiring. (csap) Penderita Tumor Mulut Butuh Uluran Tangan Kasus Judi Seperti DILANTIK: Pengurus PDM Kab.Labusel saat dilantik oleh PWM Waspada/ist TANJUNGBALAI (Waspa- sakan ke dokter gigi, usai giginya rujukan ke RSU Adam Malik. Tanjungbalai,” kata Hakim Tjoa Fenomena Gunung Es Provsu di Balai Pertemuan Kantor Bupati, pekan lalu. da) : Penderita tumor di mulut, dicabut, gusinya kian mem- “ Sampai kemanapun, harus di- Kian Lie. Ganti Mahlela alias Lela, 43, bengkak. obati, dan kami siap membantu Hal sama dikatakan Romay KISARAN (Waspada): Kapolres Asahan menegaskan, kasus judi warga Link III, Kel. Sei Raja, Kec. “Semakin membengkak, sekaligus mendampinginya,” Noor. Menurutnya, secara pro- di wilayah itu bagaikan fenomena gunung es, yang tidak diketahui PWM SU Lantik PDM Labusel Sei Tualang Raso, Kota Tanjung- dan kami membawanya ke RSU kata Romay Noor. sedur, Pemko Tanjungbalai persis berapa besarnya. Hal itu dinyatakannya di Mapolres, Senin (4/1). Menurutnya balai, terpaksa menahan sakit Adam Malik, hasil diagnosa Selain itu, mereka juga mem- harus membantu keluarga mis- KOTAPINANG (Waspada): PimpinanWilayah Muhammadiyah selama belasan tahun. Setiap dokter, istriku terkena tumor bahas masalah ini dengan Dinas kin, dan mengenai seluruh bia- tahun 2009 ditemukan 263 kasus, dan masih banyak kasus judi (PWM)SumateraUtaramelantikpengurus PimpinanDaerahMuham- saat, benjolan itu mengeluarkan jinak dan harus segera diope- Sosial sehingga biaya di luar yanya, mereka akan membahas- yang belum terungkap. madiyah (PDM) Kab.Labuhanbatu Selatan (Labusel), Kamis (31/ darah kental dan air. Jika lubang rasi. Keterbatasan dana meng- perobatan dapat dibantu. “ nya. “ DPRD komitmen mem- “Kasus judi bagaikan fenomena gunung es di lautan, yang kami 12) di Balai Pertemuan Kantor Bupati Labusel. amankan itulah yang tampak dipermukaan, dan diduga masih banyak kecil di benjolan itu tersumbat, akibatkan kami tak mampu Biaya di luar perobatan biasanya bantunya, dan akan kita per- Panitia pelantikan Hasanuddin Harahap mengatakan, sejak lagi kasus judi terselubung dan mungkin lebih besar lagi,” ujar Kapolres. maka Lela terpaksa merintih menjalankan saran dokter, sehi- dibantu, dan nasib Lela ini harus juangkan sampai sembuh,” terbitnya Surat Keputusan Pimpinan Pusat Muhammadyah dari Sedangkan tindak pidana, kata Kapolres, tahun 2009 ada 2.586 Yokyakarta tentang pendirian PDM Kab.Labusel, dan Surat Keputusan menahankan nyeri. ngga istriku kami bawa pulang,” menjadi perhatian Pemko tegas Romay Noor. (a37) Untuk menyembuhkan pe- kata Sangkot yang hanya be- kasus, yang diselesaikan berkisar 1.326 kasus. Angka ini menurun PWM Sumut tentang kepengurusan PDM Labusel, sejak Agustus dibandingkan 2008 dengan 2.593 kasus, dan yang telah diselesaikan lalu, PDM Labusel sudah mulai bekerja untuk membebaskan tanah nyakitnya, ibu dua anak itu kerja serabutan itu. sudah berulangkali berobat, dan Sangkot mengungkapkan, 1.275 kasus. “Untuk Polres sendiri, menangani 1.128 kasus, dan 16 rante di Jalan Kalapane, Kelurahan Kotapinang. selebihnya 1.458 kasus ditangani Polsek-Polsek di wilayah hukum Tanah dimaksud Insya Allah untuk pembangunan MasjidTaqwa, terakhir di RSU Adam Malik penyakit istrinya itu pernah di- Medan sekitar 4 tahun lalu. Me- sampaikan kepada Walikota Polres Asahan. Kantor PDM Labusel dan sekolah TK Iqrak. Namun saat ini tanah Dari kasus tersebut, kata Kapolres, didominasi pencurian dengan dimaksud belum lunas, dan Panitia Pembangunan masih berutang mang keluarganya tercatat se- Tanjungbalai, dan disarankan bagai peserta Jamkesmas, na- berobat ke RSUD Tanjungbalai. senjata tajam 586 disusul kekerasan rumah tangga 446 kasus. kepada pemilik tanah, sedangkan harga per meter Rp 121 ribu. Sedangkan propesi pelaku tindak pidana tersebut, kata dia, Panitia mengucapkan terima kasih kepada umat Islam yang sudah mun biaya yang dipikul cukup “ Kami memang ke rumah sakit, berat. tapi tak berlanjut karena keter- didominasi pekerja swasta (serabutan-red) 324 kasus, dan menunurut memberikan infaqnya. data, kebanyakan tindakan pelaku pidana tersebut dikerjakan malam Sedangkan Pj.Bupati Labusel Ir Hj R Sabrina, MSi menyambut “ Kami tak punya uang, ka- batasan ekonomi, meskipun rena untuk operasi dokter me- kami pemegang kartu Jamkes- hari 1.201 kasus. “Sementara berdasarkan usia, pelaku tindak pidana baikberdirinyaPDMdiLabusel,karena persyarikatanMuhammadyah mulai umur 26-35 tahun 375 kasus, sedangkan yang berumur 0- dikenal selalu peduli pendidikan. Muhammadiyah ikut mencerdaskan minta biaya sebesar Rp 50 juta, mas,” tutur Sangkot. belum lagi untuk kebutuhan Oleh sebab itu, saat ini me- 17 ada 16 kasus,” jelas Kapolres. SumberDayaManusia(SDM)olehkarenaituPj.Bupatimengharapkan Berbeda dengan kasus Narkoba, lanjut Kapolres, mengalami agar PDM Labusel terus melaksanakan program kerjanya. lainnya, “ kata Lela kepada ang- reka hanya menanti uluran ta- gota DPRD Kota Tanjungbalai ngan dermawan untuk mem- kenaikan 13,5 persen, dengan jumlah kasus pada 2008 ada 118, dan SedangkanKetuaPWMSumutDrsHDalailAhmad,MA,mengata- tahun 2009 menjadi 134 , dengan rincian 192 pelaku, 69 pengedar kan biasanya di Persyarikatan Muhammadyah kalau dapat dana Romay Noor, Hakim Tjoa Kian bantu perobatan istrinya. “ Ter- Lie, Surya Darma AR dan Leiden nyata hari ini masih ada yang dan 123 pemakai. pembangunan,misalnyaRp1M,nilaibangunannyapastinantimelebihi. Waspada/Rahmad F Siregar Pelaku tersebut banyak berumur 20-24 tahun berkisar 82 kasus, Pengurus PDM Labusel dilantik terdiri dari Penasehat Ustadz Butar-butar di rumahnya, Rabu perduli kepada kami,” kata Sang- MENANTI BANTUAN: Penderita tumor mulut, Ganti Mahlela (6/1). kot kepada empat anggota dan remaja 16. Dan, alat bukti yang dikumpulkan 22.437,43 gram M Arif Nasution, Aliono Abdy, BA, Khayalan Siregar, M Syafii Nasution alias Lelam 43, warga Link III, Kel Sei Raja, Kec Sei Tualang Suami Lela, Sangkot, 43, me- DPRD Tanjungbalai tersebut. (22,5 kg) ganja, sedangkan shabu-shabu 781,5 gram. dan Abdurrahman. Ketua dr Chairul Bachry Manurung,Wakil Ketua Raso, Kota Tanjungbalai, menanti uluran tangan dermawan Hasanuddin Harahap, Zainuddin Nasution, Jafar Hamdani dan nuturkan, awal penderitaan Menyikapi hal itu, Romay “Kenaikan kasus ini merupakan kerja keras Sat Narkoba, atau untuk biaya perobatannya. Dan, empat anggota DPRD Kota H.IqbalMuhammad,SekretarisAhmadFaridRangkuti,WakilSekretaris istrinya terjadi sekitar lima belas Noor, HakimTjoa Kian Lie, Surya mungkin pengguna narkoba mulai banyak di Asahan,” ujar Kapolres. Tanjungbalai Romay Noor, Hakim Tjoa Kian Lie, Surya Darma Umar Dhani. tahun silam. Saat itu, gusi kanan Darma AR dan Leiden Butar- Sedangkan untuk kecelakaan lalu lintas, jelas Kapolres, terjadi AR dan Leiden Butar-butar siap mendampingi dan Bendahara H Hendra Pulungan dan H Armada Sayuti Pohan. bawah Lela membengkak se- butar menyarankan Sangkot penurunan, pada 2008 terjadi 210 laka lantas, meninggal 241 orang, memperjuangkan nasib ibu anak dua ini. Begitupun, perhatian Dilengkapi dengan Majelis Tablig dan Dakwah, Majelis Pendidikan, besar biji jagung. Kemudian, kata membawa istrinya ke RSUD sedangkan 2009 terjadi 152 kasus, tewas 163, laka lantas ini banyak Pemko Tanjungbalai sangat dibutuhkan bagi kaum marjinal Majelis Kesehatan serta Majelis Zakat, Infaq, Wakaf. (c05) Sangkot, benjolan itu diperik- Tanjungbalai untuk mengambil terjadi di wilayah Jalinsum Medan-Rantauprapat 111 kasus. (csap) seperti Lela. Foto direkam, Rabu (6/1).
  • 18. 20 Sumatera Utara WASPADA Kamis 7 Januari 2010 Pro Kontra Pusat Perkantoran Pemkab Tapanuli Selatan Laporan Merekamerasadaerahnyayang nama Sipirok saja sesuai bunyi indikasi pihak tertentu mempe- tidak akan pernah berpindah, ke- penuhdengansejarahtelahdileceh- keduaUUitu.Darisegiadministrasi lesetkanbunyiUUdalamhalwaktu cuali ada perubahan pada UU Sukri Falah Harahap kan.Hinggakinimerekatetapme- pemerintahan,ditemukanadanya pemindahan dan lokasi. No.37dan38tahun2009.Mengenai lakukanprotesyangidentiksebagai nama wilayah Kelurahan Pasar “Indikasiitudilandasi, deadline tenggatwaktu10Februari2009tidak 10 AGUSTUS 2007, Presiden perjuanganhargadiridaerahdalam Sipirok, dan Kecamatan Sipirok. pemindahansesuaiUUadalah10 masalah.KarenaDepdagrisebagai Republik Indonesia DR H menentangpihakyangmenentang Waspada memperoleh satu Februari 2009, namun belum pengawaspelaksanaanUUtersebut Susilo Bambang Yudhoyono undang-undang. bundelan berjudul Rencatan terlaksanahinggasaatinidanlokasi juga mengerti dan dibuktikan Waspada/ist Tokoh masyarakat Sipirok itu UmumTataRuangKota(RUTRK) yang dimaksud oleh UU tersebut sampaisaatinibelumadateguran Rencana kantor Bupati Tapsel mensahkan Undang-undang semakin ‘panas’ setelah Pemkab Sipirokyangdibuattahun2006.Di menurutpersepsikamiadalahKota untuk Pemkab Tapsel. Nomor 37 tahun 2007 tentang Tapselmembuatsatuperencanaan dalamnya disebutkan, kantor Sipirok. Sementara ada pihak ter- “Pindahitugampangsaja.Tapi Mereka Melihat Dan Berbicara Pembentukan Kabupaten Padanglawas Utara dan pusatpemerintahandengansarana prasaranaterlengkapdiataslahan BupatiTapsel harus berada mak- simal radius 9 kilometer dari titik tentuterkesanmengalihkannyajadi Kecamatan Sipirok, sehingga ada mau kita tempatkan dimana ? Fasilitas sekarang sudah lengkap, seluas275hekataredisekitarDesa nolKotaSipirok.Tapiyangjadima- usulan pertapakan kantor bupati pegawaikitajugadominanberdo- BELUMdipindahkannyapusat Sidimpuan,berartiyangmenikmati Diamenilai,saatinilebihbanyak Undang-undang Nomor 38 Tolang.Jaraknyasekira12kilometer salah,RUTRKituhinggakinibelum bukandiKotaSipirok,tetapidekat misilidiP .Sidimpuan.Kalaudipak- pemerintahanKab.T apanuliSelatan pajak dan lain-lainnya kan masih masyarakat yang setuju dengan tahun 2007 tentang dari Pasar Sipirok. pernahdisahkanmenjadisebuah perbatasan Kecamatan Sipirok sakansekarang,pelayananbirokrasi dari Kota Padang Sidimpuan ke Kota P .Sidimpuan,” katanya. sikap dan langkah pelan tapi pasti Lokasirencanapertapakanitu Peraturan Daerah (Perda) di dengan AngkolaTimur,” katanya. pemerintahankepadamasyarakat ibukotaSipirok,jugamenimbulkan ParluhutanSiregardariKomisi yang diambil PemkabTapsel saat Pembentukan Kabupaten banyakkomentardarimasyarakat A DPRD SU juga menyampaikan ini.Diaberandai,jikamemangada Padanglawas. merupakan hutan produksi milik Pemkab Tapsel. akan semraut dan acak-acakan didaerahdanwakilrakyatdiDPRD. komentarnya.DiamengakuiBupati masyarakatSipirokatauTapselyang negarayangmerupakanarealkerja Akhirnya, tuntutan pusat Tetap Pindah akibatfasilitasyangserbadarurat,” Syahrul M Pasaribu, anggota Tapsel Ongku P Hasibuan sangat tidaksetujudengankeputusanitu, PT Toba Pulp Lestari (TPL) dan perkantoranPemkabTapselharus Menyikapi hal itu Pemkab sebut Isrhok. Fraksi Golkar DPRD Sumatera pintar,tapidiamenyayangkanjustru tentunya gelombang unjukrasa Inhutani, atau persisnya hutan di Pasar Sipirok sekitarnya, dan Tapseljugamelakukanupayaagar Meskipunsudahadadesakan Kedua daerah itu merupakan pinus selepas markas Detasemen rencanaPemkabTapselyangakan semua pihak menyikapi perma- agar segera memindahkan pusat Utara,ketikadimintaipendapatnya bupatisangatpintarmenggunakan tanpadituggangikepentinganpolitik daerah pemekaran Kabupaten mengatakan,undang-undangharus kepintarannya. “Mohonlah pak sekelompokpihakkekantorBupati CBrimobdasu.Tepatpadaperbata- membangunpusatpemerintahan salahaninidenganjernihdantanpa pemerintahankeSipirok,Pemkab TapanuliSelatan.Setelahsebelum- san Kecamatan Sipirok dengan di Desa Tolang, menimbulkan politisasi. “Perpindahan pusat Tapsel tidak bergeming dan tetap ditegakkan. PemkabTapsel harus bupatidengansegalakerendahan Tapsel sudah kerap terjadi. nyajugamemekarkanKabupaten mendengarkanaspirasimasyarakat hati,cepatmenyelesaikanpersoalan Menurut dia, yang namanya Angkola Timur. gejolak politik yang tinggi. pemerintahan Kab.Tapsel dari pada perencanaan semula. Pusat MandailingNatalsesuaiUndang- Masyarakat Sipirok memiliki Tanggal9Februari2009,Wakil P.Sidimpuan ke Sipirok tetap akan pemerintahan tetap di atas lahan Sipirok,karenamerekajugabagian ini sehingga tidak berlarut-larut,” keputusanpemerintahdaerahtidak undangNomor12tahun1998dan dari masyarakat Tapsel. katanya. selalu bisa memuaskan semua alasandanargumentasitersendiri BupatiTapsel Aldinz Rapolo yang dilaksanakan. Hanya saja setelah seluas 275 Ha di DesaTolang. Se- Kota Padangsidimpuan sesuai agar pusat pemerintahan Kab. merupakan putra daerah asal fasilitasnyaselesaidibangun.Tidak dangkankotaSipirokdiproyeksikan Kemudiandiamemintasemua Sekretaris Komisi A dari PPP , pihak.Jadiwajarsajajikaadapihak pihakagartetapobjektifdankom- NurulLubis,menyampaikankalau yangprodankontra.Tapiharusnya Undang Undang Nomor 4 tahun Tapsel dibangun di Pasar Sipirok Sipirok menyurati Bupati Ongku adaniatbupatidanPemkabTapsel sebagaikotapelayananbarangdan prehensif serta berjiwa besar dan inginmajusatuperiodelagidiPilkada keduapihaksalingmenghargaidan 2001. dan sekitarnya. Demikian juga PHasibuan.Denganmenggunakan untuk tidak mematuhi UU No37 jasa, pendidikan, agropolitan, berpikiran jernih dalam mengar- Tapsel 2010, hendaknya bupati bukanmemanas-manasi.Karena PadaPasal21ayat1UUNo.37 dengan Pemkab Tapsel, punya kop surat dan stempel bupati, dia dan38tahun2007,”kataSekdaKab. kesehatan, pertanian, dan wisata. tikanisiundangundang.Tujuannya melakukanstudibandingkedaerah dapat mengganggu ketenangan dan 38 tahun 2007 disebutan, alasan dan argumentasi sendiri menyuratibupatidanmenyatakan Tapsel, Affan Siregar. Berdasarkan penelusuran agartidak terjadi polemik berke- yang sudah berhasil. Jangan ke masyarakat Sipirok dan Tapsel. Kab.Tapsel beribukota di Sipirok. tentangpenetapanlahanpertapa- tidak akan berkantor lagi di di Menurutnya, tidak mungkin Waspada, sebenarnya pro kontra panjangan. daerah yang gagal ataupun yang Sejumlahtokohmasarakatdaei Pada ayat ke 2 disebutkan, paling kandiperbatasanduakecamatan. P.Sidimpuanlagi,tapidiSipirokatau kantorbupatidanseluruhinstansi letak pusat perkantoran Pemkab PemkabT apseljanganberjuang terlambat. 12 kecamatan juga pernha mem- lambat 18 bulan setelah undang Berdasarkan penelusuran persisnya di Situmba dengan pindah sekaligus ke Pasar Sipirok. Tapsel ini tidak akan menjadi sendiridanberhentijikamenemui “Sehingga nantinya tujuan buatpernyataanbersama.Mereka undang itu diundangkan secara Waspada,alasandanargumentasi memakai rumah kebunnya. Pasalnya,tidakadabangunanyang masalah besar, jika pemerintah jalan buntu. Gerakkan segela po- memakmurkanmasyarakatterca- HMaraMudaSiregardariSipirok, depenitif, maka pusat kegiatan kedua belah pihak ini sama-sama “SayapindahkantorkeSipirok mampu menampung keseluru- pusattegasdalamUndang-undang tensi,termasukputradaerahyang pai,mengenaianggaranperpinda- MansuruddinNasutiondariMuara penyelenggaraan pemerintahan benar.Pokokpermasalahanhanya untuk menjaga agar tidak ada hannyadisana.Andaidipaksakan, Nomor 12 tahun 1998 tentang ada di DPRD Sumut, DPR RI , dan hanKomisiAakanberupayamem- Batang Toru, MS Marpaung dari Kab.Tapsel berada di Sipirok. padafaktorketersediaanlahanyang gugatan kepada lembaga peme- tentumenimbulkankesemrautan pembentukan Kabupaten Man- institusi serta lembaga negara bantudariAPBDProvinsiSumatera Saipar Dolok Hole, H Maraganti Tapi sampai sekarang atau tepat dan cara menerjemahkan rintahan dan bupati atas pelang- danmengganggupelayananbiro- dailingNataldanUndang-undang lainnya.“Marisama-samabersinergi Utara,” katanya. HarahapdariAngkolaSelatan,Kari- sudah29bulansejakdiundangkan, mencari jalan keluarnya, karena Sony Firdaus dari PPRN me- sos Limbong dan Sutan Kumala bunyiPasal21ayat1UUNo.37dan garan UU No.37 dan No.38 tahun krasi masyarakat. Nomor4tahun2001tentangPem- ternyatapusatkegiatanpenyeleng- 38 tahun 2007, Kab.Tapsel beribu- 2007yangmengamanahkanpaling “Dengan sarana perkantoran bentukanKotaPadangsidimpuan. lebihcepatlebihbaikdaripadame- nyoroti efek ekonomi terhadap dari Sayur Matinggi. garaan pemerintahan Kab.Tapsel nunda-nunda atau mengulur Pemkabdanmasyarakatyaapabila Baginda Paringgonan Hasi- kota di Sipirok. lambat 10 Februari 2009 pusat danfasilitasyangadadiP .Sidimpuan Tidak satupun pasal yang masihberadadiKotaPadangsidim- ParatokohmasyarakatSipirok pemerintahan Kab Tapsel sudah saatini,segalapelayananbirokrasi menyebutkantentangibukotaTap- perpindahanpusatpemerintahan ibukotaTapsel berada di wilayah buan dari Angkola Barat. A Kaslan puan yang merupakan daerah ke ibukota,” kata putra daerah sendiri.Bilatadinyaada2.000pegawai Dalimunthe, S Galingging , dan berpendapat, yang dimaksud berada di Sipirok,” katanya. lancar. Jika sekarang dipindah ke sel di dua UU itu. Harusnya, jika pemekarannya. SipirokdalamkeduaUUituadalah Sejak saat itu tuntutan agar Sipirok,semuaakansemrautakibat dalamUUNo.12tahun1998tidak Marancar itu. berdomisili di wilayah sendiri dan SalokotDaulaydariBatangAngkola. Sejumlah tokoh masyarakat Sementara Mulkan Ritonga pengeluarannyaperbulandikalikan Sorimuda Harahap dari Angkola Sipirok yang dalam administrasi kantor pusat pemerintahan Kab. tidak adanya sarana pendukung. dicantumkan, maka pemerintah Sipirok di dalam dan luar daerah, pemerintahannyadisebutKelura- TapselsegeradipindahkandariKota Kita juga harus mempertimbang- pusatmencantumkannyapadaUU yangbmerupakan putra daerah denganRp2jutasaja,makaperpu- Timur,BagindaPanusunanRambe sepertiYoppieSBatubara,Dharma asalSipirokdanjugaanggotaFraksi taran uang tambahan di ibukota dari Marancar , MTamrin Siregar han Pasar Sipirok sebagai ibukota P.Sidimpuan, dan Sipirok adalah kankepentinganseluruhmasyara- No.41 tahun 2001, karena Kota Indra Siregar, Arifin Siregar, Aldinz Kecamatan Sipirok. ibukota Tapsel semakin gencar. kat Tapsel dan bukan sebagian P.Sidimpuanyangdimekarkanitu PartaiGolkarDPRDSUmengatakan, TapselsudahmencapaiRp4miliar dariArse.JustinPasaribudariBatang RapoloSiregar,FaisalRezaPardede, Sedangkan Pemkab Tapsel Unjukrasadangerakanmengadu kecilnya saja,” katanya. adalahibukotaKab.Tapselselama UU 37 dan 38 tahu 2007 memang per bulan dan ini merupakan po- Toru dan Mahlil Rambe dari Aek tidak mengatur soal sanksi kalau tensi PAD. Bilah. Osa Iskandar, Amir Syarifuddin, menerjemahkan kata Sipirok itu ke lembaga pemerintahan lebih PemkabTapsel, lanjut Sekda, ini. bupatitidakmematuhiisinya.Na- SementaraitumasyarakatTap- Merekamendukungsepenuh- BurhanuddinHarahap,melakukan secaraluas,yakniKecamatanSipi- tinggidaripadaPemkabTapseldan telah berupaya agar Departemen Kemudianadasatuhallagiyang munsebagaiseorangkepaladaerah, seldi12kecamatanjugamenyam- nyasikapdanlangkahyangdiambil aksi protes terhadap sikap Bupati rok. Sehingga pusat perkantoran kelembaganegaraterusdilakukan. Kehutananmemberiizinpenggu- tidak boleh dilupakan pada UU sikapnya itu jelas-jelas melanggar paikankomentar.SepertiRencong PemkabT apseldalammenentukan Tapsel Ongku P Hasibuan. pemerintahdaerahbisadibangun Sakingpanasnya,ketikasejum- naan 275 hektare lahan hutan No.37 dan 38 tahun 2007. Yakni sumpahjabatannya.Jadisudahtidak PusakaHutasuhut,tokohmasyara- pertapakanperkantoranpemerin- MerekamerasaPemkabTapsel dimanasajaasalmasihtetapberada lah tokoh masyarakat Sipirok ber- produksidiDesaTolangsekitarnya, bunyi Pasal 23, “ketentuan pelak- layak lagi menjabat. kat Sipirok yang hingga kini ber- tah daerah di Desa Tolang dan danbupatitelahmenentangundang diwilayahkecamatanitu.Semen- temu dengan Gubsu di Medan, untuk pertapakan pusat perkan- sanaan undang undang ini diatur Penyegeraan pusat pemerin- domisili di Sipirok. Dia minta sekitarnya yang masih cakupan undang. Mereka melakukan aksi tarajikaditinjaudarikulturalmasya- Aldinz Rapolo Siregar tidak mem- toranPemkabTapsel.TimDephut denganperaturanperundangun- tahanTapselkeSipiroksangatpen- oknum-oknum mengaku tokoh wilayahKecamatanSipirok.“Demi mendesakperpindahanpusatpe- rakatTapsel,sebutanSipirokitubisa posisikan diri lagi sebagai wakil telah meninjau dan izin itu telah dangan” Sampaisekarang,peratu- . tingbagimasyarakatTapsel.Karena masyarakatSipirokyangbermukim sebuahkebersamaanmasyarakat merintahan dari P .Sidimpuan ke lebihluaslagikarenameliputiKeca- bupati, tapi sebagai tokoh masya- diperoleh dengan cara tukar me- ran perundang undangan yang bila pusat pemerintahan sudah di di luar daerah agar tidak merusak Tapselkedepan,kamimendukung Sipirok.Yaknidengancaramelapor matanArsedanSaiparDolokHole. rakat Sipirok. Katanya, sejauh ini nukar lahan. diharapkanbisamemperjelascarut Sipirok,otomatispendapatanper- kondusifitas dan tatanan hidup penuhupayaPemkabT apsel,karena danmengadukanhalitukeGuber- Anehnya, setelah ditelusuri, belumtampakkemauansignifikan Sementara Asisten I HM marutnyapermasalahantersebut, kapitadiSipirokakanikutmening- bermasyarakat dengan statemen mengakomodir semua kepenti- nur dan DPRD Sumatera Utara, kat. “Kalau masih bertahan di P . di media massa ngan,” kata mereka.**** ternyatatidakadasatupundaerah pihak bupati memindahkan Isrhok Harahap menegaskan, belum pernah diterbitkan. Depdagri, DPR RI dan DPD RI . di wilayah Tapsel yang memiliki ibukota. Sedangkan disisi lain ada ibukotaTapseltetapdiSipirokdan **** Bupati: Tapsel Bukan Daerah Pemekaran, Tapi Terimbas Akibat Pemekaran puan anggaran daerah untuk memnuhi tuntutan sedikit daerah sekaligus. tor, Pemkab Tapsel telah mem- TorSibohi,tapiberbatasandengan kung lainnya lebih mudah. Jika tor Pemkab Tapsel dan sarana memindahkannya sekaligus. Ka- kelompok. Tapsel adalah daerah yang bentuk tim untuk menganalisa hutan Suaka Alam yang ekosis- ditinjau dari segi geologis, lokasi prasarana lainnya. rena pemindahan secara ber- Mengenai penafsiran kata terkena imbas akibat pemekaran. sejumlah lokasi yang strategis di temnya tidak dapat diganggu. itu realtif lebih stabil dan aman. Sekarang izin inklap itu telah tahaptelahkitalakukan,”sebutnya. ‘Sipirok’ dalam dua UU itu, sebe- Imbas dimaksud adalah, harus Kecamatan Sipirok. Tim itu Kemudian kurang menguntung- Biayapembangunannyajuga dikantongi Pemkab Tapsel, dan Ongku mengatakan, dia bu- narnya bisa diterjemahkan de- memindahkan pusat pemerinta- bekerja berdasarkan 6 landasan kanbagipengembanganwilayah. akan relatif lebih murah, dan bagi masyarakat pemilik lahan kanlah orang hukum.Tapi menu- ngan bebas karena tidak menun- handariKotaP .SidimpuankeSipi- utama.Yakni secara geografis se- LokasikeempatdisekitarSitumba pembebasan lahan atau inklap selebar 250 meter di kiri kanan rut pemahamannya dan dibantu jukkan lokasi yang spesifik.Tolang rok dalam tempo 18 bulan. Harus baiknya merupakan pertenga- dan Baringin. Posisinya tepat dan dari Departemen Kehutanan jalan dan sepanjang 11 KM (550 staf di bidang hukum, pelangga- juga masih termasuk Sipirok. mensubsidi Kab.Paluta dan Palas han dari seluruh wilayah Kab. memungkinkan bagi pengemba- memberi manfaat tambahan Ha) mulai dari areal pertapakan ran terhadap batas waktu yang Lagipun ibukota kabupaten itu masing-masing sebesar Rp 5 mi- Tapsel. nganwilayah,tetapibanyaklahan bagi masyarakat. Saat ini Pemkab menuju Pasar Sipirok, sudah bisa diamanatkan UU itu tidak mem- tidak harus merupakan kantor liar per tahun selama dua tahun. Kemudianketersediaanlahan produktif masyarakat. Tapsel telah memiliki izin dari membuat sertifikat lahannya. punyaisanksipidanakarenabersi- pusat pemerintahan. Anggaranyangdimilikihanya yang memadai atau minimum Lokasi kelima adalah Desa Menteri Kehutanan untuk meng- Sampai saat pemkab Tapsel fat pengaturan. Jika masalah ini Seperti Kabupaten Mandai- sesuai yang tertampung di APBD. 50 Ha, mempertimbangkan ke- Tolang yang merupakan wilayah gunakan lahan seluas 275 hektar telah memiliki beberapa penca- ternyata mengandung unsur ling Natal dengan ibukotanya Tentunya anggaran itu tidak akan stabilan geologis, aspek hydrol- hutan produksi milik negara yang di lokasi itu membangun pusat paian dalam hal usaha pemin- pidana, dia siap bertanggung- Panyabungan, tapi pusat perkan- dihabiskan untuk perpindahan ogis, dan aspek topgrafis. Tidak ditanami pinus dan selama ini pemerintahan. dahan pusat pemerintahan dari PERPINDAHAN pusat jawab. torannya di Bukit Paya Loting, kantor pemerintahan ke Sipirok, mengganggu kawasan hutan, areal kerja PT Toba Pulp Lestari Izin tertuang dalam Surat P.Sidimpuan lokasi pertapakan perkantoran pemerintah Ada berbagai alasan kenapa yang dulunya masuk wilayah danmengabaikanpembangunan terutama hutan lindung, konser- (TPL) dan Inhutani. Setelah dila- Menhut RI No:S.534/Menhut- yanglebihtepat.YakniBeritaacara Kabupaten Tapanuli Selatan pusat perkantoranTapsel belum Kecamatan Kotanopan. Bila di- sarana prasarana di daerah lain. vasi, dan suaka alam. kukan analisa secara menyeluruh VII/2009 tertanggal 7 Juli 2009. tukar menukar kawasan dan dari Kota Padang dipindahkan ke Sipirok. Antara perlukan, kota dapat diperluas Meski mengetahui pasti akan Tidakmenggangufungsieko- maka dipilihlah lokasi terakhir Lahan 275 Ha di Kecamatan BATB defenitif. Pembuatan mas- lain sarana perkantoran yang me- sesuai kebutuhan daerah. Karena menemui jalan buntu, Pemkab nomi lahan-lahan produktif ma- ini sebagai rencana pertapakan Sipirok itu diganti dengan lahan ter plan, studi banding dalam Sidimpuan ke Sipirok, madai belum tersedia dan kalau- salah satu tujuan pemekaran itu Tapsel tetap mengajukan permo- syarakat. Memperhatikan pe- kantor pusat pemerintahan Pem- seluas 277 Ha di BatangToru. Izin rangka pendanaan, pengajuan merupakan isu paling pun disewa, kapasitas ruang serta adalah meningkatkan pelayanan honan anggaran ke provinsi dan ngembangan wilayah dengan kab Tapsel. tersebut tidak diperoleh dengan pembiayaanmelaluiAPBN,pinja- hangat di daerah itu saat ini. kualitasbangunanyangmemadai kepada masyarakat secara pusat, agar bisa dengan segera memperhatikan tendesi per- Hal itu juga mempertim- mudah oleh Pemkab Tapsel. mandankerjasamadenganpihak Bahkan mengalahkan isu sangat kurang. keseluruhan dan bukan parsial. pindah dan membangun fasilitas kembangan demografi, pusat- bangkanpilihanmasyarakatAng- Harus melalui perjalanan dan swasta. Katanya, PemkabTapsel me- Ongku menjelaskan, dia dan kantor. Dari Departemen Dalam pusat pertumbuhan, dan perpin- kolaSipirokyangsaatTimAdhock perjuangan panjang. Kegiatan lanjutan yang akan Pilkada yang akan digelar miliki dua solusi untuk pemin- Pemkab Tapsel tidak diam saja Negeri diperoleh jawaban,Tapsel dahan masyarakat dalam jangka IDewanPerwakilanDaerah(DPD) Melalui proses waktu hampir dilaksanakan adalah pembuatan Mei 2010 di daerah seluas dahan itu. Yakni melaskanakan menyikapimasalahperpindahan adalah daerah induk dan bukan waktu panjang. RIjugaTimPanitiaKerjaPembaha- dua tahun, bupati menyurati Detail Enginering Desaint (DED) 4.450,07 KM2 dan pemindahandengansaranayang ini. Banyak usaha yang telah daerah pemekaran. Sehingga Timmelakukananalisadilima san Pemekaran diketuai Drs HM Menhut, Sekjen Dephut, Ka.Biro dan penataan areal pertapakan berpenduduk 287.366 jiwa, minim atau menunda peminda- dilakukan, termasuk merencana- tidak diprioritaskan pembangu- lokasi. Pertama, lahan di sekitar Kafrawi Rahim di akhir 2006. Hukum dan Organisasi Setjen pada 2010. Pembangunan insfra- han hingga sarana memadai. Jika kanlokasipusatperkantoranyang nan fasilitas perkantorannya. AekLatong,tapitidakdimasukkan Saat itu masyarakat yang me- Dephut, Kepala Badan Planologi 248 kelurahan/desa, dan 12 memilih alternatif pertama, maka tepat dan pengajuan anggaran Karena keterbatasan dana, sebagai bahan pertimbangan ka- nginginkan pemekaran Kab. Kehutanan Dephut, Kapu Inven- struktur/jalan, 2010 sampai 2011, kecamatan itu. harus mengeluarkan biaya yang ke provinsi dan pusat untuk pem- PemkabTapsel pun secara berta- rena kondisi daerahnya yang Angkola Sipirok menghadang tarisasi dan Perpetaan Gubernur, dan pembangunan kantor secara sangat tinggi dan sesuai perhitu- bangunan fasilitas perkantoran hap memindahkan kantor-kan- berada di patahan bumi. iring-iringantimdanmemintanya PTTPLsebagaipemilikIUPHHK- bertahap, 2010 sampai 2012. nganyangdilakukan,bisamenca- di tempat baru. torSatuanKerjaPerangkatDaerah Lokasi kedua di arah Keca- untukmeninjaulokasipertapakan HT, dan Gubernur. “Direncanakan tahun 2012 Bupati Tapsel Ongku P Hasi- pai Rp dalam se- Dari segi anggaran, bupati (SKPD) ke Sipirok. Saat ini Kantor matan Saipar Dolok Hole, secara kantor bupati yang mereka sedia- Kemudian muncullah SK semuanya sudah terwujud. Se- buanmenjadisatu-satunyaorang tahun. mengajak semua pihak untuk BadanPenyuluhPertaniansudah geografis memungkinkan untuk kan jika daerah itu dimekarakan. MenhutNo.14/Menhut-VII/2009 moga langkah yang kita tempuh yang dipojokkan karena belum Pembiayaan itu terdiri dari menyadaridanmengingatbahwa berada di Sipirok dan menyusul pengembangan wilayah.Tapi di- Adapun keuntungan dari tanggal 15 Januari 2009 tentang ini menjadi jelas bagi semuanya dipindahkannya pusat pemerin- sewa kantor per tahunnya men- PemkabTapselbukandaerahyang kantorPariwisata,kantorPemuda karenakan banyak lahan produk- lokasi itu ialah, legalitas kawasan pembentukan tim terpadu peng- dan marilah kita satukan langkah tahan ke Sipirok. Besar kemung- capai Rp 695.000.000, biaya pe- di mekarkan dari satu daerah in- Olahara,DinasNakertransos,dan tif masyarakat dan tidak efisien lokasi lebih mudah pengemba- kajian lapangan untuk tukar untuk mempercepat proses kinan pencalonannya untuk pe- mindahan(renovasi,instalasi,jari- duk. Tapi daerah induk atau SKPD lainnya. untukmasyarakatkecamatanlain. ngannya.Penataankawasanpusat menukar kawasan hutan untuk pembangunan dan pemindahan riode kedua di Pilkada 2010 ini ngan, transportasi) Rp 5.922. daerah yang memekarkan dua Untuklokasipertapakankan- LokasiketigadibelakangHotel pemerintahandansaranapendu- pembangunan pertapakan kan- tersebut,” kata Bupati.**** akan terganggu akibat masalah 000.000, dan operasional pega- itu. Lantas apa dan bagaimana pendapatnya tentang hal itu ?Ter- wai/kedinasan Rp 3.600.000.000 pertahun. Sehingga dana Rp itu akan terbuang Duo Pardede ‘Berseteru’ nyata Ongku P Hasibuan tidak sia-sia jika dibandingkan dengan MASALAH pusat kantor pe- diamenegaskan,sikapnyaselama walaupun tidak ada konsekwensi untuk mencapai sebuah kesepa- Rencanapembangunanpusat pintanya. mempermasalahkannya. Karena kondisi di P .Sidimpuan saat ini. merintahan Kab.Tapanuli Selatan ini murni untuk rakyat dan dae- hukumdariUUitu,karenainime- katanyangmenghasilkankebaikan pemerintahan Kab. Tapsel di To- Kemudiandiamengingatkan menurutnya,apayangdiperbuat- Efek negatif lainnya jika dila- telah memunculkan dua nama rah,khususnyaSipiroksebagaita- rupakan tanggungjwab moral se- dantanpaharusadayangdicederai, lang lebih identik dengan kepen- agar jangan ada pihak yang ingin nya bersama segenap unsur pe- kukan pemindahan dengan sa- intelektual muda Sipirok. Mereka nah kelahirannya. Bukan terkon- orang pemimpin dalam menjun- dijolimi, apalagi dirugikan. tingan beberapa pihak dan tanpa mengambil kesempatan dalam merintahan Kab.Tapsel saat ini rana yang minim akan berdam- Fasial Reza Pardede Ketua DPP taminasi provokasi atau politisasi jung hukum. Saya sangat setuju Menurut Faisal, pada RUTR memikirkanprinsiptujuanpeme- kesempitandaripermasalahanini. merupakan satu kebenaran yang pak pada pelayanan birokrasi dan Naposo Nauli Bulung Napa Napa oknum lain. terhadapsikapKomisiADPRDSu- KotaSipiroktahun2006disebutkan, karan. Masalah ibukota bukan Apalagimengorbankanmasyarakat harus dipandang secara jernih pelayanan masyarakat. Karena ni Sibualbuali, dan Ficki Padli SementaraFickipadaprinsip- mutyangmendesakBupatiTapsel ± 3 Km dari titik nol Kota Sipirok semata persoalan masyarakat untuk kepentingan pribadi atau dan netral. saat ini 2.000 pegawai Pemkab Pardede Ketua Umum Gerakan nyamenyetujuisikapdanlangkah agar segera memindahkan pusat sebagai Tapsel berfungsi sebagai SipirokdenganBupatiTapsel,tetapi golongan. Pasal21ayat1dan2UUNo.37 TapselberdomisilidiP .Sidimpuan, Mahasiswa Angkola Sipirok. ditempuh PemkabTapsel dalam pemerintahankeKotaSipirok,”kata kawasan inti kota. Kemudian ± 3- seluruhmasyarakatdenganbupati. Dimanapunletakpusatpeme- sarana yang minim menyulitkan Komentar duo Pardede ini pemindahan pusat perkantoran Faisal. 6 Km sebagai kawasan pengem- “UUNo.37dan38tahun2007 rintahanKab.Tapsel,tentuharapan dan 38 tahun 2007 tentang Pem- sering memicu ‘adrenalin’ pihak dan penetuan lokasi pertapakan. “Pada prinsipnya, kita semua bangan, dan ± 6-9 Km berfungsi adalahsatuketetapanhukumyang kita jangan ada masyarakat yang bentukan Kabupaten Padangla- pelayanan dan koordisi antar yang pro dan kontra. Faisal lebih Diadiidentikkansebagai‘orangnya’ juga setuju kalau amanah UU No sebagaikawasanpenyangga(hin- wajibdilaksanakansiapapun.Andai terzolimidanterkorbankan.Karena was Utara dan Padanglawas yang lembaga yang masih berada di mengarah pada penentangan BupatiOngkuPHasibuan.Kepada 37dan38Tahun2007harusdijalan- terland). UUmenetapkanKotaBatangToru pusatpemerintahanitudibangun menyebut Sipirok ibukotaTapsel, P.Sidimpuan akan terganggu. terhadap sikap Pemkab dan bu- Waspada, Ficki membantah ang- kan. Tetapi kita juga harus mem- NamunhalitudiabaikanPem- sebagaiibukota,tentunyakitasemua untuk seluruh masyarakatTapsel, danpalinglambat18bulansetelah Jika memilih alternatif kedua pati Tapsel yang tidak mematuhi gapan itu. pertimbangkan dan melihat apa kabTapseldengantidakpernahnya jugaakanmematuhinya,”kataFaisal. bukan segelintir orang. UU itu disahkan maka pusat ke- atau menunda pemindahan, UUsertamengabaikanRUTRKota Menurutnya,pemekaranme- penyebabamanahitubelumterlak- mensahkan RUTRK itu menjadi Sementara menurut Ficki, Ficki yakin, di hati penguasa giatanpenyelenggaraanpemerin- makabiayatidakakanbertambah Sipiroktahun2006dengancaraterus rupakan suatu usaha ataupun sana secara keseluruhan. Bisa saja Peraturan Daerah (Perda). Malah sebagai generasi muda yang cinta dan elit-elit politik Tapsel masih tahan berada di Sipirok, diakui dari sebelumnya dan anggaran melakukan penundaannya men- upaya dalam percepatan pemba- karenaketidakmampuananggaran mengalihkanpusatpemerintahan akan tanah kelahirannya, dia tersimpan rasa untuk sebuah Ongku. Rp itu bisa diguna- jadi Perda. ngunanyangberorieantasikepada daerahdanpertimbanganlainnya,” keDesaTolangdiwilayahMaragor- memintakepadasemuapihakagar pengabdiandankebenaran.Masih Belumdipindahkannyapusat kanuntukpembangunandaerah. Faisalmenentangperencana- pelayanan publik, dengan tujuan ujar Ficki. dongatautepatnyaperbatasanKec. berbesarhati,profesional,dewasa, ada hati nurani dan memegang pemerintahan daerah secara Pelaksanaan layanan birokrasi an pusat pemerintahan di Desa mensejahterakan masyarakat Faisal berharap masyarakat Sipirok dan Angkola Timur. arifdanbijaksana,dalammenyikapi teguh amanah rakyat. Sehingga keseluruhankeSipirok,meskipun dan masyarakat tidak terganggu Tolang atau kawasan Maragor- secara keseluruhan. tidak dibenturkan secara politis Faisalmenilailokasiitutidaklah setiap masalah mengenai pusat tidak mungkin membiarkan telah melewati batas waktu 18 dan tetap seperti sedia kala. Per- dong,karenamenuruthematnya, Ficki hanya melihat sisi positif dengan persoalan ini. Mudah - tepat,karenajarakyangbegitujauh pemerintahan Kab. Tapsel. masyarakat Tapsel terlantar dan bulan,jugadiakuinya.TapiOngku siapanperpindahanbisadilakukan pusat pemerintahan itu haruslah dannegatifdaripersepsiataupan- mudahan bupati secara arif dan dari pusat Kota Sipirok dan tidak “Marikitaserahkandanperca- terkorbankan karena sebuah tidak setuju jika Pemkab Tapsel dengan lebih baik. diSipiroksebagaiibukota.Diajuga danganyangberbedahariini.Me- bijaksanasertadenganpikiranyang menyentuh masyarakat Tapsel yakansemuainikepadapihakyang kepentingan. Denganmempertimbangkan menyesalkansikapbeberapaorang nurutnya,PemkabTapselberpan- jernih,bisamenyelesaikanmasalah secarakeseluruhan.Lokasiitulebih bertanggung jawab dan berkom- “Apapun yang jadi keputusan dan dia selaku bupati disebut pe- yangkinicoba-cobamembentur- dangan lokasi pertapakan pusat ini demi kemajuan masyarakat dekat ke Pemko P .Sidimpuan dan peten,agarmasyarakattidakterkor- penguasadanelit-elitpolitikTapsel, nentang atau pembangkang dua jalan alternatif itu, Pemkab kan masyarakat Sipirok dengan perkantoran di DesaTolang lebih Tapsel secara keseluruhan. daerahPaluta,sehinggatidakakan bankan. tentusudahdikajisecaramendalam undang-undang. Tapsel memilih alternatif kedua. Batang Toru. tepat,tentunyatelahdidasarikajian Ficki juga berharap segenap salingmendukungdengankegiatan Kami mohon kepada semua dan ditinjau dari beberapa aspek. “Ini bukan masalah menen- Karena bagaimanapun, putusan Akibat komentar-komentar matangdantinjauandaribeberapa masyarakatTapsel menyikapi se- pusatperekonomiandipusatKota pihakagartidakmenimbulkanpro- Sehinggaditemukanlahkeputusan tang atau pembangkangan terbaik bagi kebayakan masya- ‘pedasnya’, Faisal dikonotasikan aspek. cara arif dan bijaksana masalah Sipirok dan akan menimbulkan vokasiyangberpotensimencipta- terbaik yang kita harap bermuara terhadap undang undang. Tapi rakat Tapsel adalah yang terbaik sebagai ‘orangnya’ lawan politik “Amanah UU No 37 dan 38 pertapakandanpemindahanpusat pembengkakanbiayaekonomibagi kankonflikdanmemecahpersau- pada kemaslahatan seluruh tidak lain karena ketidak mam- daripadatergesa-gesademiuntuk bupati.Padahal,kepadaWaspada Tahun 2007 harus dilaksanakan, perkantoranini.Dudukbersamalah masyarakat. daraan masyarakat Tapsel,” masyarakatTapsel,”tutupnya..****
  • 19. WASPADA Kamis 7 Januari 2010 Aceh 21 HM Sudirman Dukung Pelantikan Polisi Masih 29 Kades Terpilih Kota Subulussalam Selidiki Kasus SUBULUSSALAM (Waspada): Menanggapi bersikeras dengan prinsipnya menentang Mark Up hiruk-pikuk hasil Pilkades di 29 Desa Kota Subu- pelantikan terhadap para Kades bermasalah. lussalam, tokoh masyarakat H. Muhammad Khususnya Kades yang diduga menggunakan REDELONG, Bener Meriah Sudirman dan HM Idris menyatakan duku- ijazah palsu. (Waspada): Polres Bener Meriah ngannya kepadaWalikota Merah Sakti melantik “Memang sejak awal pendaftaran para masih melakukan penyidikan, para Kades terpilih sesuai rencana Pemko. kandidat Kepala Desa, kami telah curiga pengumpulan barang bukti Namun, adanya indikasi kasus ijazah palsu terhadap sejumlah kandidat yang menyer- yang lengkap untuk mengusut yang digunakan sejumlah Kades terpilih tetap takan copy ijazah SLTA dileges. Karena tuntas beberapa kasus dugaan harus diusut pihak berwajib, tak boleh didiam- sepengetahuan kami yang bersangkutan sama mark up dan tukar guling di Ka- kan begitu saja. “Polres Aceh Singkil harus sekali tak pernah bersekolah SMA,” sebut bupaten Bener Meriah. bertindak dan melakukan pengusutan secara anggota BPG saat dikonfirmasi wartawan, Hal tersebut seperti dikata- tuntas,” sebut HM Sudirman saat berkunjung Selasa (5/1). kan Kapolres Bener Meriah ke Medan, Rabu (6/1). Menurut anggota Badan Permusyawa- AKBP Drs. Hari Apriyono di- Dalam kesempatan itu, Sudirman meminta ratan Gampong di Kec. Rundeng itu, meski dampingi Kasatreskrim Ipda Kapolres Singkil tidak bermain api untuk men- curiga, pihaknya tak mungkin menolak pen- Kaspi Darwis, SH, MH di ruang- diamkan adanya dugaan kasus ijazah palsu daftaran para kandidat. Rencana pelantikan an kerjanya, Selasa (5/1). Dia yang digunakan para kandidat, termasuk di 29 Kades itu ditentang 10 panitia pemilihan menyebutkan, untuk beberapa kasusmark up dan tukar guling antaranya 29 Kades terpilih, yang disebut-sebut di antaranya tersebut nama Amansyah Pa- masih perlu pengumpulan alat akan dilantik 8 Januari 2010. yung, Mardi dan Bonjol. bukti, seperti surat-surat admi- Meski soal penetapan tanggal pelantikan Seperti diketahui, HM Sudirman dikenal nistrasi yang berkaitan dengan belum diungkap Walikota Merah Sakti, namun sebagai tokoh pemikir di kota Subulussalam kegiatan tersebut. bocoran dari sumber terpercaya di Tata Praja dan Aceh Singkil. Selain putera asli Rundeng, Disebutkan, sebagian alat Setdako menyebut hari Jumat, 8 Januari para beliau adalah pelopor pembuka jalan bukti sudah diminta ke dinas Kades akan dilantik. sepanjang 100 Km dari Subulussalam menuju terkait, tetapi hingga saat ini be- “SilahkanWalikota Merah Sakti tetap melan- Kota Cane. Saat itu Subulussalam masih lum mereka berikan. “Polisi be- jutkan rencana melantik 29 Kades terpilih dari bagian dari Pemkab Aceh Singkil. lum bisa meminta BPKP meng- 4 Kecamatan yang melaksanakan pemilihan “Bersama Bupati Aceh Singkil H. Makmur audit, karena bahan bukti yang ada saat ini masih berupa foto- Kades. Namun kami tetap mendesak pihak Syahputra, SH, MM, pak Sudirman sengaja copy, karena fotocopy tidak bisa kepolisian menelusuri adanya dugaan ijazah diminta bupati untuk mengimplementasikan menjadi alat bukti. Jika semua palsu yang digunakan sejumlah Kades terpilih,” pemikirannya merancang pembukaan jalan Waspada/Muhammad H. Ishak bukti lengkap kami akan me- tegas HM Sudirman. ke Kotacane, untuk lebih memudahkan AMBRUK: Pejabat Inspektorat Aceh Timur menunjuk lokasi pembangunan proyek TPI di Desa Paya Peulawi, Kecamatan Birem minta BPKP mengauditnya,” Di tempat terpisah, unsur panitia pelaksana distribusi hasil pertanian warga,” beber Bayeun, Kabupaten Aceh Timur yang ambruk ke sungai dan sama sekali tidak terlihat setelah dibangun beberapa bulan. Foto diambil ungkap Kapolres. pemilihan Kades di Desa Muara Batu-Batu Idris.(m16) baru-baru ini. Yang berkaitan dengan mark-up tersebut, menurut Ka- Siap Dibangun, Proyek polres, diduga berada di Dinas BRA Aceh Tamiang Tampung Kesehatan atau Puskesmas dan beberapa rumah sekolah di Ka- Ribuan Proposal Korban Konflik bupaten Bener Meriah, dugaan mark-up tersebut berkaitan dengan pengadaan komputer KUALASIMPANG (Waspada): Badan Rein- tegrasi Damai Aceh (BRA) Kabupaten Aceh Tamiang sudah menampung ribuan proposal yang diajukan korban konflik Aceh di Kabu- sebanyak 132 unit. Menyangkut tudingan dari Mariani yang menyatakan bantuan untuk dirinya sudah dialihkan kepada “Mariani” yang lain, menu- Rp262 Juta Ambruk dan printer. Sedangkan tukar guling tanah, yang berlokasi di depan Pendopo Bupati Bener Meriah, lokasi tanah tersebut saat ini sedang dibangun ruko paten Aceh Tamiang. rut Ismail tidak benar dan sangat mengada- bat kurangnya pengawasan dari akhir 2008 dan selesai awal 2009. karena itu, Ketua LSM KANA dan Gedung Olah Seni dan Olah “Sudah ribuan proposal korban konflik ngada, sebab bantuan rumah tersebut me- IDI (Waspada): Beberapa Raga milik Pemkab. Aceh yang kami tampung di BRA Aceh Tamiang, mang untuk “Mariani” yang lahir di Mabar, pihak konsultan, sehingga pe- Ketika pembangunan mulai di- mendesak pihak terkait untuk bulan setelah dibangun, Berkaitan kasus-kasus itu, namun belum semua terealisasi bantuannya, sedangkan bantuan untuk Mariani yang lahir ngerjaan yang dilakukan meng- kerjakan pihak rekanan, Muza- mengusut hingga tuntas proyek proyek Rp262 pembangunan Kapolres memastikan akan sebab proposal yang masuk harus diseleksi di Sei Kuruk itu memang belum cair. gunakan Dana Alokasi Khusus kir mengatakan telah memberi yang dikerjakan asal jadi itu. Tempat Pelelangan Ikan memberi titik terang tentang ke- terlebih dahulu oleh Tim BRA Pusat,” ungkap “Kami mana berani mengalihkan bantuan (DAK) tahun 2008 itu asal jadi. sinyal bahwa pembangunan “Kita menyesalkan kondisi pastian hukumnya akhir bulan Kabid Ekonomi BRA Kabupaten Aceh Tamiang, yang telah disetujui BRA Pusat. Tuduhan Ma- (TPI) di Desa Paya Peulawi, “Ini kepentingan masyarakat tersebut akan ambruk dalam proyek saat itu, dan kini terbukti ini, sedangkan untuk audit BPK Tgk Ismail didampingi Tgk Fenddi dan Tgk riani itu tidak benar sama sekali dan kami juga banyak, terutama nelayan di waktu dekat, sebab sama sekali hasilnya sama sekali tidak dapat Kecamatan Birem Bayeun, Kpolres mengatakan anggota- Syam yang bertugas di BRA Aceh Tamiang itu sudah pernah menjelaskan hal tersebut daerah itu, maka pihak rekanan tidak sesuai dengan perenca- dimanfaatkan oleh masyarakat, Kab. Aceh Timur ambruk. nya sedang melengkapi bahan- kepada Waspada, sehubungan adanya tu- kepadanya,” tegas Ismail. atau pun konsultan harus ber- naan sebagaimana sebuah bahkan kini sedikitpun sisi pro- bahannya. (cb04) Bahkan sama sekali tidak tanggungjawab,” ungkap Ketua proyek TPI. yek tidak nampak akibat teng- dingan dari Mariani, warga Sei Kuruk III, Ke- Selain itu lagi, Menurut Ismail dan rekan- kelihatan. LSM Komunitas Abeuk Nang- Proyek pembangunan TPI gelam ke sungai,” tambah Mu- camatan Seruway, Kabupaten Aceh Tamiang, rekannya itu, Mariani Sei Kuruk juga pernah Selasa (5/1). menarik dana bantuan pola Diyat untuk groe Aceh (KANA), Muzakir. Kepada Waspada, Rabu (6/ dikerjakan dengan jumlah ang- garan mencapai Rp262.720.000. zakir yang juga tokoh pemuda Peran Geucik Menurut Tgk Ismail dan rekan-rekannya itu, proposal untuk bantuan rumah untuk korban konflik yaitu bantuan untuk adiknya yang meninggal dunia akibat konflik. “Mariani Diduga kuat, ambruknya 1) di Idi, Muzakir mengungkap- Proyek DAK yang telah ambruk berpengaruh Aceh Timur. Kepala Inspektorat Aceh Ti- Pantau bangunan 6 X 20 meter itu aki- kan, proyek tersebut dibangun itu dikerjakan oleh CV AR. Oleh korban konflik yang telah masuk ke BRA Aceh Tamiang sampai tahun 2009 tercatat ada 3000- pernah menarik dana pola Diyat. Jadi jangan- lah dia mengatakan adiknya yang meninggal mur, Saiful Azhar, SH, ketika di- mintai keterangan kepada Was- Kinerja Bides an proposal. Namun yang sudah terealisasi 458 unit rumah bantuan rumah bagi korban konflik. Sedangkan proposal bantuan untuk korban dunia akibat konflik tak dapat bantuan dari BRA. Truk Interculer Terjungkal pada kemarin mengatakan, ketidakberesan proyek itu mas- yarakat setempat melaporkan LANGSA (Waspada): Peran Geucik sebagai pimpinan ter- tinggi di gampong diharap Malah dia yang menarik dananya,” konflik yang mengalami cacat yang masuk ke ungkap Ismail. Bukan itu saja, sebut Ismail, IDI (Waspada): Akibat oleng ke kiri jalan dan Medan. ke Bupati Aceh Timur untuk di- mampu memantau kinerja para BRA Aceh Tamiang tercatat sejak tahun 2008 ayah Mariani yaitu Aliudin yang rumahnya mengelakkan truk dari arah masuk parit, selanjutnya Sesampai di lokasi, truk lakukan pengecekan. Dan pe- Bidan Desa (Bides). s/d Februari 2009 ada 2.280 proposal dan sudah juga mengalami rusak akibat konflik Aceh, berlawanan, satu truk terjungkal ke areal terjungkal ke sawah akibat jabat nomor satu itu memerin- Harapan tersebut disampai- terealisasi sampai 2009 sebanyak 60 proposal. juga sudah dibantu BRA. “Bantuan rumah Interculer BL 9992 HF persawahan. mengelakkan truk Colt yang tahkan ke Inspektorat setempat kan Sekretaris Dinas Kesehatan “Hingga saat ini Badan Reintegrasi Damai Aceh untuk orang tua Mariani juga telah kami cair- terjungkal ke areal “Interculer itu muncul dari arah untuk mengeceknya. (Dinkes) Kota Langsa, Drs. Mu- hammad, MM.“Geuchik jangan (BRA) telah membangun 458 unit rumah kor- kan,” tegas Ismail. persawahan di Desa mengangkut beras dari Kota berlawanan. “Setelah kita cek ternyata mau menandatangani Surat ban konflik di kabupaten Aceh Tamiang,” sebut Sedangkan bantuan rumah untuk Maria- Gampong Baroe, Kecamatan Lhoksemawe tujuan Medan, “Sehingga truknya benar bahwa sama sekali tidak Pernyataan MelaksanakanTugas Ismail dan rekan-rekannya tersebut kepada ni, menurut Ismail, proposal yang diajukan Darul Aman—Idi Cut, Aceh Sumatera Utara, sesampai di terjungkal, namun tidak ada sesuai dengan gambar dan ren- (SPMT)paraBidesyangbekinerja Waspada, Selasa (5/1). sedang diproses oleh BRA dan nanti akan Timur, Provinsi Aceh, Rabu lokasi terjungkal dalam areal korban dalam musibah cana. Dan setelah ambruk juga buruk,” katanya, Senin (4/1). Menurut Ismail, Pembangunan rumah diverifikasi kebenarannya. “Bukan proposal (6/1) sekira pukul 06:00. persawahan warga, namun tersebut,” terang Adi. kita turun ke lapangan,” ungkap “Ini perlu karena kita tidak untuk para korban konflik yang tersebar di Mariani saja yang perlu diverifikasi, namun Laka tunggal itu terjadi tidak ada korban jiwa. Kita Kasus tersebut kini telah Inspektur Saiful Azhar seraya mampu selalu memantau ki- beberapa kecamatan di Kabupaten Aceh Ta- semua proposal masih perlu diverifikasi. persis di lintasan jalan duga sopir ngantuk,” ujar ditangani pihak kepolisian. menandaskan, dalam hal ini nerja para Bides di lapangan, miang telah dilakukan sejak 2005 lalu. Pada Bukan Mariani saja yang belum terealisasi, negara. seorang warga di lokasi. “Ya benar, kasus itu telah pihaknya akan akan memanggil bantuan seluruh elemen mas- 2005 dibangun 75 unit, tahun 2006 sebanyak tetapi masih banyak warga lainnya juga Sebelumnya, truk yang Adi, 24, sopir truk yang ditangani petugas Sat Lantas pengawas konsultan selaku yarakat terutama para geucik, 50 unit, tahun 2007 sebanyak 100 unit, tahun diperlukan verifikasi oleh Tim BRA,” tegas mengangkut puluhan ton didampingi Tami, 26, kepada Kota Idi,” tandas Kaopolres pihak pertama bertanggung- akan sangat membantu Dinas 2008 sebanyak 101 unit dan pada tahun 2009 Ismail.(b24) beras itu melaju dari arah wartawan di lokasi Aceh Timur, AKBP Drs jawab dalam proyek terse- Kesehatan memantau kinerja Medan – Banda Aceh. menyebutkan, truknya Ridwan Usman.(cmad) but.(cmad) mereka,” paparnya.(b25) Terjungkal diduga kuat berangkat dari Kota akibat kelebihan muatan. Lhoksemawe sekira pukul Sehingga ketika sopir 04:00 dengan muatan beras mencoba mengelak truk 28 ton. Direncanakan beras Colt yang lain truk tersebut itu akan dipasok ke Medan Waspada/Ibnu Sa’dan LORONG BUNTU: Jalan aspal di lorong buntu sepanjang 90 x 2,5 meter, dikerjakan CV. Energindo Enterprise, di wilayah Kota Langsa. Lorong Buntu Ke Rumah Pejabat Mulus, Jalan Umum Dibiarkan Hancur LANGSA (Wspada):Warga Kota Langsa mempertanyakan kebi- jakan pemerintah melalui Dinas Pekerjaan Umum (PU) yang mem- proritaskan pengaspalan jalan di lorong buntu daripada jalan umum lalinnya. KetuaLSMCakraDonya,HelmidiLangsa,Sabtu(2/1)mengatakan, pengaspalan jalan buntu di Lorong Mandiri, Gampong Paya Bujok Teungoh, Kecamatan Langsa Barat, mengundang pertanyaan warga. Jalan di lorong buntu yang diaspal sepanjang 90 x 2,5 meter dan dikerjakan CV Energindo Enterprise, di Jalan Gabungan, menurutnya . bisa saja ditunda, karena masih banyak jalan yang lebih padat penduduknya, dibanding hanya empat rumah yang ada di lokasi. “Saya prihatin dan bertanya-tanya,” tambahnya, karena sejum- lah tempat lain, seperti Lorong Pusri Gampong Teungoh samping Mapolres Langsa, dan Jalan Damai di belakang Kantor Disdik yang setiap hari padat lalulintas justru dibiarkan hancur dengan kondisnya lebih parah. Berdasarkan fakta tersebut, duga’an pengaspalan jalan buntu itu sarat kepentingan pribadi, ada benarnya. Karena jalan yang di aspal itu berada di depan rumah salah seorang Pengendali Kegia- tan/Pimpro Bina Marga Pekerjaan Umum Kota Langsa. Seharusnya, dalam melaksanakan pembangunan di Kota Lang- sa pemerintah lebih merngutamakan kepentingan umum daripada kepentingan pribadi pejabat. Karena itu dia minta Walikota Langsa Drs. Zulkifli Zainon, MM meninjau pejabat di jajarannya yang hanya mementingkan diri sendiri, agar masyarakat tidak berpikir negatif terhadap Walikota.(b22)
  • 20. 22 Aceh WASPADA Kamis 7 Januari 2010 Tim PTB Bireuen Pemerintah Tak Punya Tinjau Desa Bersengketa Niat Bentuk KKR BIREUEN (Waspada): Tim Penyelesaian Tapal Batas BANDA ACEH (Waspada): Komi- tidak memasukkan RUU KKR seba- (PTB) Kabupaten Bireuen serta Muspika Kecamatan si untuk Orang Hilang dan Korban gai regulasi yang akan dibahas. “Jelas Peusangan meninjau lokasi Desa Krueng Dhee dan Karieng Tindak Kekerasan (KontraS) Aceh me- sudah, Pemerintah selama ini tidak Peusangan terkait persengketaan tapal batas kedua desa. nilai pemerintah pusat tidak punya menganggap serius tuntutan kor- Hal itu dikatakan Asisten Pemerintahan Setdakab Bi- niat membentuk Komisi Kebenaran ban, bahkan terkesan menghindar reuen H. Hamdani A. Gani, SH, M. Hum saat ditemui Was- dan Rekonsiliasi (KKR). Mereka meni- dari tanggung jawab,” katanya. padadi ruangan kerjanya kemarin. Menurut Asiten Peme- lai pemerintah terkesan menghindar Menurut dia, dalam konteks rintahan Setdakab Bireuen itu, peninjauan ke lokasi dua dari tanggungjawab. Aceh perdebatan panjang yang terja- desa ini untuk melihat langsung kondisi riel dilapangan Koordinator KontraS Aceh, Hend- di tetap saja tidak bisa memuluskan terkait sengketa tapal batas yang belum selesai. ra Fadli kepada wartawan Selasa (6/ pembentukan Qanun KKR Aceh, ka- “Yang turun langsung ke lapangan pada hari Selasa 1) di Banda Aceh, mengatakan peme- rena Pemerintah Aceh tetap bersiku- (5/1) selain saya (Asisten Pemerintahan-red) juga ikut rintah sudah menunjukkan tidak kuh regulasi mensyaratkan adanya serta Kabag Mukim dan gampong, Dra Anisa, juga turut pentingnya agenda penyelesaian pe- KKR nasional terlebih dahulu sebe- dilibatkan pihak kepolisian serta Muspika Kecamatan langgaran masa lalu di Aceh. “Janji lum Qanun KKR disahkan. Namun, Peusangan,” terangnya. Departemen Hukum dan HAM lanjutnya, terlepas dari berbagai dalil Lanjutnya untuk saat ini, tim yang telah turun ke lokasi (Depkumham) untuk menyerahkan yang dibangun Pemerintah Aceh, batas yang disengketakan tak langsung mengambil draf RUU KKR ke DPR RI pada Juli belum terbentuknya KKR di Aceh keputusan di lapangan, hal itu dilakukan menghindari 2009 tidak ditepati hingga akhir ta- adalah indikator utama Pemerintah terjadinya silang pendapat antara masyarakat kedua desa. hun,” sebut dia. tak punya kemauan politik yang kuat “Untuk sementara waktu permasalahan sengketa tapal Ini diketahui dari Program Legis- untuk menghadirkan KKR di batas kedua desa itu akan terus dirumuskan kembali lasi Nasional (Prolegnas) 2010 yang Aceh.(b05) dengan tim Muspika Kecamatan Peusangan,” ujarnya.(cih) Rp5.000/KK Biaya Foto Copy Kasus Korupsi Aceh Ke KPK BANDA ACEH (Waspada): Hasil nyebabkan rasa apatisme yang cu- 7000 Duafa Terima PENYERAHAN POHON: Wakil Gubernur Aceh, Muhammad Nazar, menyerahkan bibit secara simbolis kepada Geuchik Waspada/Iskandar monitoring dan catatan selama tahun kup tinggi dari kalangan masyarakat. 2009, tercatat sejumlah kasus tindak “Oleh karenanya, kami (GeRAK Bantuan Kompor LPG Gampong Komplek Cinta Kasih, Desa Neuhen, Kecamatan Baitussalam, Kabupaten Aceh Besar, baru-baru ini pada acara gerakan menanam pohon Indonesia (HMPI) “One Man One Tree” dan bulan menanam nasional (BMN) Tahun 2009. pidana korupsi dengan potensi duga- Aceh) dan MaTA mengambil lang- an kerugian negara yang cukup besar kah konkrit yaitu melaporkan kem- PANTONLABU, Aceh Utara (Waspada): Puluhan kaum di Aceh yang hingga batas waktu akhir bali kasus itu ke KPK,” ungkapnya. duafa di Kec Tanah Jambo Aye, Aceh Utara, mengeluh Gaji 10 Ribu PNS tahun belum ditangani secara baik Kasus korupsi itu, sebut dia, karena pembagian kompor bantuan dikutip uang, oleh aparat penegak hukum. kasus yang bersinggungan langsung Rp5.000/orang. Terkait lemahnya upaya penyele- terkait dana-dana publik, sehingga “Itu ulah oknum perangkat desa (gampong), pada saian atas kasus itu, maka GeRAK jika kasus ini tak dituntaskan, maka hal sebelumnya kita sudah larang agar jangan ada yang Aceh dan MaTA akan melakukan per- pihak yang paling dirugikan adalah mengutip uang dari para kaum duafa,” kata Camat Tanah Jambo Aye, Aceh Utara, T M Yacob, SE kepada Waspada, Rabu (6/1). Kompor itu bantuan pemerintah kepada kaum duafa, dalam rangka mengalihkan kebiasaan memakai kompor bahan bakar minyak tanah (BBM-Minah) kepada kompor Pidie Belum Dibayar temuan resmi dan menyerahkan kembali sejumlah kasus tindak pida- na korupsi itu, kepada pihak Komisi Pemberantasan Korupsi (KPK) di Jakarta pada pertengahan Januari ini. masyarakat Aceh secara keseluru- han, sebab telah menyebabkan Aceh makin miskin dan terperosok keda- lam lubang yang cukup nista akibat ulah orang-orang bermental korup. Sejumlah kasus itu adalah kasus “Diserahkannya kembali kasus BBM gas LPG. “Untuk Kec Tanah Jambo Aye, mendapat SIGLI (Waspada): Diduga karena di Dinas tempat ia bekerja belum ada baru menerima gaji Januari hari ini bobolnya Kasda Pemkab Aceh Utara ini KPK merupakan pukulan telak bagian sebanyak 7000 unit, disebarkan kepada 7000 kepala gaji dan kemungkinan baru ada nanti (Rabu kemarin-red),“ kata seorang kondisi keuangan yang masih belum senilai Rp220 M, kasus mark up CT- akibat runtuhnya kepercayaan mas- keluarga (KK) kaum duafa,” jelas T M Yacob. pada tanggal 15 Januari 2010. PNS yang bekerja di Dinas Pertanian pulih di Pemkab Pidie, sehingga Scan dan MRI di RSUZA sekitar Rp yarakat Aceh terhadap institusi apa- Pengutipan uang Rp5.000/KK di Gampong (Desa) Kondisi demikian sangat menyu- dan Peternakan. 17,6 M, kasus penjualan aset daerah rat penegak hukum yang gagal me- Lhok Reudeub, Kemukiman Jambo Aye Tengah, Kec Tanah membuat puluhan ribu Pegawai sahkan para PNS yang berpenghasilan Sekdakab Pidie, M. Iriawan, SE ke- /negara dengan dugaan kerugian ne- wujudkan mimpi masyarakat dalam Jambo Aye, sesuai keterangan Tgk Ibrahim Datu Bayak, Negeri Sipil (PNS) mengeluh karena rendah dan bahkan pas-pasan. Telam- pada wartawan menyatakan, sebenar- gara senilai Rp1,5 M, dan kasus Yaya- pemberantasan korupsi,” tegas Isra. 70, salah seorang kaum duafa di desa itu. Keterangan yang batnya pembayaran gaji akan sangat nya gaji bulan ini yang bersumber dari hingga Rabu (6/1) kemarin Pemkab san Tarbiyah dengan indikasi keru- Mengapa? Karena, kata dia, sela- sama diungkapkan A Gani Abdullah, 40. Keduanya menyulitkan keuangan kami untuk DAU senilai Rp26 miliar sudah terse- belum membayar gaji Januari 2010. gian negara senilai Rp 2,6 M. ma ini masyarakat menilai penyelidi- mengaku telah menyetorkan uang itu melalui Keplor. memenuhi kebutuhan hidup keluarga dia, tetapi pembayarannya tertunda Demikian disampaikan Kepala kan dan penyidikan yang dilakukan Pj Keuchik Lhok Reudeub, Syahbuddin Hasyem yang serta biaya lainnya sehar-hari. Apalagi, atau terbentur persoalan administrasi Divisi Kajian dan Advokasi Kebijakan oleh kepolisian dan kejaksaan di dikonfirmasi Waspada mengakui pengutipan itu, atas sejumlah tempat kami berutang bia- yang masih harus dilengkapi. Publik GeRAK Aceh, Isra Safril, kepada Aceh tidak tertangani dengan baik dasar sukarela untuk keperluan foto copy kartu KK dan Namun hal itu dibantah Sekretaris sanya dilunasi pada setiap awal bulan, Sekdakab menjelaskan, ada peru- Waspada di Banda Aceh, Kamis (7/ dan serius, sehingga kasus-kasus di KTP para calon penerima kompor tersebut.(b10) Daerah Kabupaten (Sekdakab) setempat untuk kemudian bisa berutang kem- bahan adiministrasi yang harus diper- 1), terkait rencana mereka untuk me- atas harus segera diambil alih oleh yang menyebutkan, uang gaji januari bali, katanya lagi. baharui pada daftar gaji PNS, di ma- laporkan ke KPK kasus korupsi yang KPK. MTsN Lhokseumawe 2010 bersumber dari dana Alokasi Umum (DAU) sudah ada, tetapi pemba- “Jika disebutkan keterlambatan pembayaran gaji itu disebabkan kare- sing-masing SKPD (Satuan Kerja Pe- rangkat Daerah). Seperti perubahan hingga kini belum dituntaskan oleh Ini penting, sebab jika hal ini aparat penegak hukum. terus dibiarkan maka rasa apatisme Raih Piala Bergilir Walikota yarannya terbentur karena persoalan administrasi. na terbentur persoalan administrasi, itu kurang logis. Karena semuanya itu tunjangan keluarga dan surat men- duduki jabatan. “Kedua item ini tidak Menurut dia, lemahnya upaya masyarakat atas pemberantasan ko- penyelesaian atas kasus tindak pida- rupsi akan semakin besar sehingga KOTA LHOKSEUMAWE (Waspada): Madrasah Tsana- Persoalan belum dibayarnya gaji Ja- sudah ada mekanisme baku. Tapi ke- diperbaharui oleh SKPD,” jelas Sekda. na korupsi besar yang melibatkan akan menjadi bola es yang sewaktu- wiyah Negeri (M.Ts.N) Lhokseumawe, gondol juara umum nuari 2010, bagi sebagian besar PNS yang napa tiba-tiba bisa terjadi begini, yang Menurut Sekda M. Iriawan, berda- penjabat negara di Aceh yang di- waktu dapat mengancam upaya HAB Depag ke 64/2010 kota Lhokseumawe. jumlahnya mencapai 10.000 lebih itu, belum pernah terjadi sebelum-sebe- sarkan aturan setiap berkas permin- tangani oleh aparat hukum, telah me- pemeberantasan korupsi.(b07) Dengan demikian, M.Ts.N ini berhak meraih piala tidak biasanya terjadi pada bulan-bulan lumnya, “ketus dia. taan gaji PNS yang masuk ke Dinas dan tahun sebelumnya, yang biasa sudah Tapi anehnya, kenapa PNS di jaja- Pengelolaan Keuangan dan Kekayaan bergilir Walikota Lhokseumawe tahun 2010. “Dari seluruh rangkaian kegiatan Hari Amal Bakti (HAB) Departemen agama (Depag) kota Lhokseumawe, seni dan olah raga mereka terima setiap tanggal 1 bulan ber- jalan. Kecuali, jika tanggal 1 atau 2 jatuh ran Sekretariat kantor bupati dan satu dua dinas tertentu, pembayaran gaji Daerah (PKKD) dilakukan verifikasi kembali. Berkas yang tidak memenuhi 9 Km Jalan Jiemjiem Rusak Parah yang diselenggarakan panitia sejak 21 Desember 2009 pada hari Sabtu dan Minggu karena bank Januari 2010 sudah dilakukan. “Per- persyaratan otomatis tidak bisa dila- LUENG PUTU, Pidie Jaya (Was- wai negeri maupun pejabat putra – 1 Januari 2010, MTs.N Lhokseumawe, menjuarai semua tidak buka, namun tanggal 3 sudah diba- soalan ini jangan dianggap sepele ka- kukan pembayaran gaji sehingga bu- pada): Sepanjang sembilan kilometer daerah setempat. Karena, banyak item kegiatan, sehingga piala bergilir yang sebelumnya yarnya, kata seorang PNS. rena menyangkut hajat hidup pulu- tuh waktu untuk diperbaiki sekaligus jalan di lima desa pedalaman Kemu- pembangunan justru karena ada du- dari Sekolah Madrasah Aliyah (MA) Lhokseumawe, kini “Kami biasanya sudah menerima gaji han ribu orang,“ imbuh seorang PNS membuat tertundanya pembayaran kiman Jiemjiem, Lueng Putu, Keca- kungan pejabat putra daerah setem- berpindah ke sekolah MTs.N tersebut,” kata Kakandepag tiap tanggal 1 tiap bulannya. Namun un- yang minta jati dirinya dirahasiakan. gaji bagi PNS di SKPD bersangkutan, matan Bandar Baru, Kabupaten Pidie pat dalam menganggarkan dana. Lhokseumawe, Drs Salahuddin kepada Waspada, usai tuk Januari 2010, hingga tanggal 6 belum Namun, Waspada memperoleh katanya. Diakui Sekdakab, keterlam- Jaya, dilaporkan sejak puluhan tahun “Jangankan pejabat, seorang PNS upacara HAB Depag di halaman kantor Walikota Lhok- juga dibayar,“ ujar seorang PNS kepada keterangan dari seorang PNS lain yang batan pembayaran gaji kerap terjadi mengalami rusak parah. saja tidak ada putra dari sini. Padahal, seumawe, Senin (4/1). Waspada yang dihubungi melalui telefon mengaku sudah menerima gaji Janua- di awal tahun, menyusul adanya peru- Warga setempat mengaku, akibat Wakil Bupati (Wabup) Pidie Jaya se- Kegiatan lain yang diselenggarakan Depag setempat genggamnya, Rabu (6/1) seraya mengaku ri 2010, Rabu (6/1). “PNS di dinas kami bahan data PNS.(b21) utama terisolirnya masyarakat lima karang, M. Yusuf Ibrahim, dulu guru dalam kaitan HAB, berupa amal sosial dan penyerahan desa di pemukiman pedalaman di sini. Makanya, dengan ada peneri- bingkisan kepada Pegawai Negeri Sipil (PNS) Depag Lhok- seumawe yang sudah menjalani masa pension, kata Kabag TU Depag kota ini, M Jakfar, S.Ag pada keterangan terpisah, Sengketa Lahan Sawit Memanas Lueng Putu itu, yakni meliputi Desa Jiemjiem, Abah Lueng, Blang Krueng, Aki Neungoh, dan Desa Sarah Pa- maan CPNS sekarang ini, tolong dibantu agar warga Jiemjiem bisa lulus,“ demikian M. Nur diiyakan Senin kemarin.(b10) ACEH UTARA (Waspada): Sengketa ujar Kapoktan M Amin Cut Amat. menuntaskannya, jalan satu-satunya nyang, hanya karena tak pernah di- warga lainnya. lahan sawit PIR/plasma PTP Nusantara Kendati keduanya bersikukuh lewat meja perundingan yang dimediasi bangunnya jalan baru di wilayah itu. Selain masih sulit dijangkau me- I Cot Girek, Aceh Utara, memanas. Ketua pada pendiriannya masing-masing, Pemkab Aceh Utara,” paparnya. Padahal, wilayah itu termasuk salah lalui jalan darat Kemukiman Jiem- Depag Bireuen KUD versus Kapoktan, saling menuding. namun kedua pimpinan pekebun Muridho (ketua Kopbun), penye- satu wilayah yang mempunyai hasil Jiem juga tidak memiliki fasilitas bumi terbesar, seperti biji coklat publik lainnya. Bahkan dilaporkan Peringati HAB Ke-64 Ketua Koperasi Unit Desa (KUD) per- kebunan (Kopbun), Muridho menuding sawit ini masih berpikir dalam koridor positif. “Sebaiknya Pemerintah Kabu- lesaian perkara ini di tingkat Muspika Kec Tanah Jambo Aye – Kec Langka- (kakao-red). lebih 70 persen penduduknya masih BIREUEN (Wasapada): Jajaran pegawai Departeman ketua kelompok tani (Kapoktan) sebagai paten Aceh Utara/instansi terkait sege- han, tidak akan pernah mendapat titik Tgk. Muhammad Nur, Kepala berada di bawah garis kemiskinan. Agama (Depag) Kabupaten Bireuen yang terdiri dari kepala penjarah. Tudingan itu disebutkan dalam ra mencari solusi agar persoalan ini temu. “Saya merasakan dilematis, Dusun (Kadus) Tunong Desa Jiem- Camat Bandar Baru, H. Usman, madrasah berbagai tingkatan, para guru dan murid serta surat laporannya ke Polisi Militer (PM) tidak berlarut-larut,” ujar Ketua Kopbun. mau saya lepaskan kepada Kapoktan jiem mengatakan, bila jalan baru di SE menjawab Waspada, mengakui Lhokseumawe, 15 Desember 2009. “Saya Pendapat yang sama dikemuka- M Amin Cut Amat Cs tak punya hak, wilayah itu bisa dibangun oleh pe- kondisi warga di kawasan itu amat undangan lainnya, memperingati Hari Amal Bahkti (HAB) adukan ke PM karena dalam aktivitas kan Kapoktan (M Amin Cut Amat, Cs). karena itu kebun milik 205 lebih ang- mertintah, maka transportasi mas- memprihatinkan. Mereka masih ke 64 di MAN Bireuen Senin (4/1). penjarahan itu disinyalir terlibat oknum “Pemkab Aceh Utara harus secepat- gota koperasi yang mempunyai kekua- yarakat menuju pusat Kecamatan terus berbalut dengan keterisoliran Kakandepag Bireuen, Zulhelmi Abdur Rahman me- anggota Koramil/14 Pantonlabu, Serma nya turun tangan menyelesaikan per- tan hukum (sertifikat). Sebaliknya, saya Bandar Baru akan mudah. dengan warga desa lain dan ibukota ngatakan, selain upacara resmi walaupun sedikit terlambat Siregar,” kata Muridho kepada Waspada soalan ini, sehingga jangan terus me- pertahankan juga sisa hasil petani “Dalam setiap pertemuan de- kecamatan. karena hujan turun bupati juga menyerahkan penghar- ngan siapapun, kami selalu meminta di Lhokseumawe, Selasa (5/1) malam. ngalun dan berpotensi fitnah, seperti (SHP) terus berkurang, akibat (versi Mengatasi hal itu, Camat Bandar gaan berupa satya lencana 30 tahun, 20 tahun dan peng- agar jalan Jiemjiem diperbaiki, tapi Baru mengharapkan pemerintah hargaan lainnya kepada yang berprestasi. Keterangan Kapoktan pada kesem- fitnah yang dialami anggota Koramil/ ketua Kopbun-red) selalu terjadi pen- patan terpisah pada hari yang sama, 14 Pantonlabu saat ini. Saya sesalkan, jarahan,” tandasnya. tidak terealisasi juga, kini jalan itu sulit segera membangun kawasan itu, “Usai upacara bendera, bupati juga mengadakan dilalui terutama kendaraan roda terutama sarana perhubungan jalan dialog dengan kepala Kantor Urusan Agama (KUA), dan membalas tudingan itu dengan menga- ia hanya mengawasi penggalian tapal Menjawab pertanyaan terhadap takan, pihak Kopbun Peurata Jaya, Dusun batas, tapi ketua Kopbun menuding surat pengaduannya bersama Keu- dua,“ ujarnya seraya menambahkan, dan jembatan. Pasalnya, warga sulit kepala madrasah di Kantor Depag Bireuen, sekaligus acara rata-rata selama ini yang dibangun mengangkut hasil pertanian atau resepsi makan bersama,” ujar Kakandepag. (b03) Bola Mas Gampong (Desa) Langkahan, ikut serta menjarah sawit,” ujarnya. chik/Kepala Desa (Kades) Langkahan, Aceh Utara, menyerobot lahan masyara- Tawaran solusi lewat jalur perdata Muhammad Usman ke PM Lhokseu- pemerintah adalah jalan yang dekat hasil panen ke kota kecamatan. kat Gampong Matang Serdang dan Gam- ataupidana,menurutMAminCutAmat mawe, terhadap tuduhan penjarahan, dengan perkotaan kecamatan, se- Menurut H. Usman, jika peme- eCwosway Mulai pong Buket Jrat Manyang, Tanah Jambo bukan terapi yang tepat. “Kasus ini katanya. “Saya komit dan dapat mem- dangkan warga pedalaman sering terabaikan. rintah memberi perhatian serius membangun kawasan tertinggal di Aye. “Sekitar 21 tahun lalu lahan kami bagian integral dari konflik Aceh, akar pertanggungjawabkan apa yang saya Rambah Pasar Bireuen diserobot dan dinikmati hasil kebun se- persoalannya mulai masa Peme- laporkan itu, berikut saya minta PM Menurut dia, ada kemungkinan tak kunjung dibangunnya desa itu desa pedalaman itu, saya yakin pen- dapatan dan kesejahteraan masya- BIREUEN (waspada): eCwosway yang biasa hanya luas sekitar 140 hektar itu, ketika kini kami rintahan otoritarian orde baru, berlan- Lhokseumawe dan instansi terkait kuasai kembali dituduhnya penjarah,” jutkemasakonflik.Kalaukitamauikhlas dapat menindak lanjutinya.(b10) akibat tidak ada seorang pun pega- rakat akan lebih meningkat.(b21) ditemui di luar negeri atau di kota-kota besar Indone- sia, kini mulai merambah pangsa pasar Bireuen. Demikian Iktial Tandia didampingi Lieliena, pengelola eCwosway cabang Bireuen saat acara peresmian perusa- haan Multi-Level Marketing (MLM) di jalan Banda Aceh- Medan Desa Cot Gapu, Kabupaten Bireuen, Rabu (6/1). Mansur Izzuddin: Meski Cacat Tubuh Tidak Cacat Ilmu “Masyarakat Bireuen mulai antusias dengan produk ANGGAPAN orang-orang terhadap tronik, televisi dan barang-barang hari belum memiliki sarana transpor- sung di bidang Elektronika. kerja kami semua akan belajar sung- eCwosway. Terbukti sejak dua bulan ke belakang sebelum penyandang cacat tidak bisa bekerja dan elektronik lainnya di Jakarta.Membuka tasi khusus beca motor penyandang Ikhsan dan kawan-kawan siswa guh-sungguh untuk menimba ilmu diresmikannya kantor ini seratusan warga Bireuen sudah berusaha keliru besar. Penyandang cacat usaha di Jakarta,kata Mansur Izzuddin, cacat untuk pulang pergi dari rumah praktek menyatakan salut dan kagum pengetahuan dan pengalaman Pak menjadi member kami,”kata Iktial Tandia itu.(cih) telah membekali dirinya dengan ilmu sambil menyekolahkan anaknya kuliah ketempat usaha. maupun panggilan terhadap Pak Mansur, seorang penyan- Mansur sebagai bekal yang paling pengetahuan untuk bekerja dan berusa- di Jakarta, tiga dari tujuh orang anak untuk memperbaiki TV ke rumah- dang cacat mampu memberikan pela- berharga bagi kami menjadi generasi ha sesuai dengan pekerjaan seorang sudah berhasil meraih sarjana teknik. rumah penduduk di kota Bireuen dan tihan praktek kerja bagi siswa sekolah yang mandiri,” demikian Ikhsan dan Pakar Ekoturisme IPB Minta penyandang cacat. Sejak 2002 kembali ke Aceh mem- sekitarnya. menengah kejuruan jurusan elektronika kawan-kawan mengakhiri pem- Jaga Keunikan Wisata Sabang Meski cacat tubuh tapi tidak cacat ilmu sehingga dapat bekerja dan berusa- buka usaha Citra Baru Electronik di kota Bireuen, sambil melatih generasi Selama ini menggunakan fasilitas transportasi RBT (ojek), selain butuh dan bagi masyarakat non cacat. “Selama melaksanakan praktek bicaraannya. H. AR Djuli SABANG (Waspada): Pakar Ekoturisme Instititut Perta- ha seperti orang-orang non cacat dan me- muda bidang elektronika,teknik audio biaya besar belum dapat memenuhi nian Bogor (IPB) Bandung, Dr Ricky Avenzora meminta latih praktek kerja siswa SMK Negeri-I video termasuk praktek kerja delapan kebutuhan yang diharapkan. Jika pelaku wisata di Sabang, untuk konsisten menjaga dan Bireuen. orang siswa SMK Negeri-I Bireuen sudah memiliki sarana transportasi menggarap even dan menjaga keunikan daerah. Mansur Izzuddin,58,seorang penyan- jurusan Elektronika. Praktek kerja khusus beca motor penyandang cacat dang cacat warga Desa Glanggang Ku- siswa SMKN-1 Bireuen berlangsung akan lebih lancar dalam menjalankan Supaya obyek wisata Sabang lebih menjual menarik lam, Kecamatan Kota Juang, Bireuen, da- setiap tahun 8 orang sejak tahun 2002 usahanya sehari-hari. dan bisa dijual, Ricky menampik jika pengembangan pari- lam percakapan denganWaspada di tem- sampai sekarang. Menurut Mansur Izzuddin yang wisata Sabang harus mengandalkan seluruh kebutuhan pat usahanya Citra Baru Elektronik di Mengamalkan ilmu kepada gene- juga sebagai ketua penyandang cacat wisatawan. Di samping itu, political will pemerintah sangat kota Bireuen, Selasa (5/1). rasi muda, bukan berarti ilmu kita ber- Bireuen mengatakan, pihaknya sudah diperlukan dalam rangka pengembangan pariwisata Dia merasa berbahagia dengan terpi- kurang, tapi akan lebih berkembang mengajukan permohonan kepada Sabang sebagai salah satu wilayah strategis di Republik lihnya usaha reparasi elektronik milik dan bermanfaat bagi kepentingan Dinas Sosial Bireuen agar membantu Indonesia. penyandang cacat, tempat praktek kerja pendidikan kejuruan dan pelatihan beca motor para penyandang cacat di Ricky didampingi jajaran Sabang Tourism Promo- siswa SMKN-1 Bireuen. “Untuk meng- elektronika bagi siswa dan masyara- kecamatan-kecamatan se-Bireuen. tion Board (STPB) Hijrah Saputra dan Evi Purnamawati amalkan ilmunya kepada generasi muda kat. Mengamalkan ilmu elektronika “Begitupun, permohonan yang kepadaWaspada Jumat (1/1) mengatakan hal yang harus tanpa pamrih,” ujarnya. kepada generasi muda adalah sebagai diajukan awal tahun 2009 hingga konsisten dilakukan pemangku kepentingan sektor pariwi- Dikatakan, pekerjaan yang digeluti- ibadah, salah satu upaya mengatasi memasuki tahun 2010 belum ada rea- sata Sabang adalah dengan menghidupkan semua keuni- nya berawal sebagai montir radio di Peu- pengangguran dalam mewujudkan lisasinya,” papar Mansur Izzuddin. kan yang dimiliki. dada, tahun 70-an, tak hanya berakhir generasi ke depan yang handal mam- Kedelapan siswa-siswi SMKN-I “Tanpa ini suatu destinasi wisata tidak akan menarik di situ. Tahun 1974, dia menggeluti pelati- pu mandiri. Bireuen yang melaksanakan praktek bagi wisatawan. ”Teruslah membuat even-even unik secara han elektronika di Palembang, selama Suatu organisasi tanpa regenerasi kerja di Citra Baru Elektronik kata kontinu. Kalau turis sudah melihat event satu atau dua setahun. Lalu tahun 1981 pelatihan itu dinilai gagal. Seseorang yang berilmu Mansur, Ikhsan, Makhrisal, Israwati, kali. Maka di tahun ketiga dan keempat, percayalah event dilanjutkan lagi di Solo, Jawa Tengah, tanpa mengamalkan ilmunya kepada Jumiati, Ferdi Maulana, Kusnadi, Riki itu sudah mulai dicari. Jadi harus kreatif dan kerja keras,” selama satu bulan. generasi jika meninggal dunia pe- Wahyuni dan Zulfahmi. Praktek kerja pungkas penulis buku Ekoturisme terbitan BRR NAD Nias Berbekal ilmu pengetahuan, elektro- ngembangan ilmunya sudah terputus, siswa SMKN-I Bireuen, dimulai 3 Waspada/H. AR Djuli tahun 2008 ini yang juga mengingatkan pentingnya nika yang diperoleh dalam pelatihan di ibarat pohon kayu yang tidak berbuah. Januari 2010 akan berlangsung selama KERJA PRAKTEK: Para siswa SMKN 1 Bireuen jurusan Elektronika sedang kebersihan lingkungan. (b29) Palembang dan Solo, pada tahun 1997- Kendala yang masih dialami tiga bulan penuh. Setiap hari mereka mendapat bimbingan praktek kerja dari Pak Mansur Izzuddin, seorang 2002 membuka usaha reparasi elek- dalam menjalankan usahanya sehari diberi bimbingan praktek kerja lang- penyandang cacat di Citra Baru Elektronik Bireuen, Selasa (5/1).
  • 21. WASPADA Kamis 7 Januari 2010 Agenda 23 Shah Rukh Khan Gaet 10 Ribu Follower Twitter Sehari Tambah satu lagi lakon di nya. Januari 2010. hangatdariparapenggunaTwitter dunia hiburan terjun ke situs Bisa jadi ia mencetak rekor Akun Twitter @iamsrk ini untuknya. “thanx everyone this microbloggingTwitter. Kali ini gili- baru di dunia per-Twitter-an de- dibuatnya untuk tetap terhubung is really sweet...didnt expect such ran aktor Bollywood papan atas, ngan meraih jumlah follower se- dengan penggemarnya. Selain a warm welcome. love to u all” Shah Rukh Khan. banyak itu dalam waktu sesingkat itu juga guna mempromosikan demikian isi tweet keduanya. Tak tanggung-tanggung, itu. Aktor besar tersebut menga- film teranyar Shah Rukh berjudul Kini, akun tersebut, sudah dalam waktu 24 jam, aktor kela- takan bahwa ia bergabung di ‘MyNameisKhan’ jugadibintangi memiliki lebih dari 31 ribu pengi- hiran 1965 ini sudah ‘ngehit’ di Twitter atas saran sahabat karib- artis ngetop Bollywood lainnya, kut. Selain aktifitas berkaitan de- Twitter. Di hari pertamanya Shah nya, sutradara Karan Johar. Hal Kajol. ngan film ia bintangi, Shah Rukh Rukh sanggup menggaet 10.000 tersebut diungkapkannya dalam Shah Rukh sendiri merasa juga menuliskan kegiatan-kegia- Shah Rukh Khan/ist/dth akun untuk menjadi follower- tweet perdananya, tertanggal 2 sedikit terkejut dengan sambutan tan pribadinya.(dth) Okie Siap Sumpah Pocong Yakinkan Majelis Hakim Elton John Sidang ke tiga terdakwa tidak kekerasanSigitPurnomoSaidalias nya. Okie membeberkan semua jugadihadirkansaksilainnyayakni ibunda Okie Sri Mulyani, dan dua Namun majelis hakim be- ranggotakan Ekova serta Djoni Elton John Bantu Eminem PashavokalisbandUnguterhadap mantanistrinya,diwarnaipernya- kejadian dialaminya dilakukan Pasha ketika keduanya terlibat pembantunyaUundanIyah,me- reka menjadi saksi karena se- Witanto itu juga menyarankan Pasha dan Okie untuk berdamai Lepas Dari Narkoba taan Okie Agustina Sofyan siap pertengkaran pada persidangan waktu peristiwa berada di rumah. dan saling memaafkan bahkan ELTON John teman sejati bagi mereka yang tengah berjuang melakukansumpahpocongguna digelar mulai pukul 12.30. Bagai- Satu persatu mereka mem- meminta keduanya untuk rujuk. melepaskan diri dari jeratan narkoba. Hal itu dinyatakannya meyakinkan majelis hakim atas mana Pasha melakukan kekera- berikan kesaksian, mulai dari Okiesendirimengakuibahwa sendiri. kesaksiannya. san terhadap dirinya, selain men- Iyah, Uun hingga ibunda Okie, dirinya sudah memaafkan Pa- “Sayasiapmembantusiapasaja membutuhkanpertolongan. Penyataan itu dilontarkan cengkram mukanya, juga me- SriMulyaniberadadikamarlantai sha.Namundiatetapinginproses Jika ada meminta nasehat, Anda harus menuntun mereka Okie pada persidangan penyam- mukul dan menendang dirinya, 2. Uun dan Iyah mengaku me- hukum terhadap mantan suami- ke jalan yang benar, tapi jangan pernah menceramahi mereka paiankesaksiannyadiPengadilan beber Okie dalam kesaksiannya. ngetahui kedatangan Pasha dan nya itu tetap berjalan. Hal itu kata Negeri(PN)Bogor,Selasa.Iaberani Namun semua yang diucap- marah-marah di dalam rumah. Okie, agar tidak terjadi lagi pada yang tidak ingin bertobat.” bersumpah setelah Pasha mem- kanOkiedibantah Pasha.Kembali Suasana agak berbeda ketika siapapun nantinya. Dan Elton bukan sekedar ngecap, dia membuktikannya bantah telah melakukan pemu- Okiemenceritakan,peristiwayang ibunda Okie mendapat giliran “Sayasudahmemaafkan,tapi pada Eminem (si rapper berwajah ganteng itu). Dia selalu ada kulan terhadap dirinya. dialaminya terjadi pada Rabu 29 memberikan kesaksiannya. Dia tindakankekerasannyatetapsaya di sisi Eminem selama penyanyi rap, terkenal lewat ucapan- Mendengar penyataan Okie Juli 2009 lalu. Peritiwa itu berawal tampak emosi. Sri mengaku sakit laporkan. Karena dia ayah dari ucapan kontroversinya benar-benar ingin berhenti dari tersebut, ketua Majelis Hakim dari SMS Okie yang dikirim ke hati dengan ulah Pasha yang sela- anak-anakku, yang aku perma- kecanduan benda haram itu. Wedhayati Kembali menya- Pasha kalau dirinya ingin me- lu memukuli Okie. salahkan adalah perbuatannya. “Saya membantu Eminem selama 18 bulan terakhir dan nyakan keyakinan. “Saya berani ngajakKisya(anaknya-red)untuk “Namanya orang tua, mana Untuk rujuk, saat ini tidak, tapi syukurlah kemajuannya sangat menggembirakan,” kata Elton. disumpah pocong sekalipun, apa berlibur ke Pantai Pangandaran. bisa terima anak saya diperlaku- untuk kedepan atau suatu saat Mei tahun lalu, Eminem mengakui bahwa dirinya kecanduan yang saya katakan adalah benar,” PashamenangapipesanOkie kankasar.SaatkejadianOkiesem- nanti, saya tidak tahu,”kata Okie berat narkoba sehingga dalam sehari dia bisa menenggak 20 ujar Okie tegas. dan langsung menelponnya, tapi pat minta tolong tapi saya tidak menjelaskan kepada majelis butir obat-obat terlarang. Menanggapi pernyataan melarang Okie membawa anak- berani menolongnya karena saya hakim. “Dan jumlah obat saya minum semakin tinggi,” katanya Okie, Ketua Majelis Hakim lang- nya. juga trauma,” tutur Sri di persi- Namun diakhir persidangan pada majalah Vibe.“Saya bahkan tidak sadar obat apa saja yang sung menyatakan bahwa di PN Percekcokan lewat telpon- Okie/dth dangan. saran Majelis Hakim untuk ber- saya makan.” tidak berlaku sumpah Pocong pun terjadi. Sekitar pukul 08.30, Suasana persindangan men- damaidiikuti mantansuamiisteri Setelah menjalani proses rehabilitasi pertama kali di tahun “Disini tidak ada sumpah yang Okie mengakui dirinya sempat mahan Bukit CimangguVilla Blok cengkram wajah saya. Dia me- jadi semakin menegang ketika itu.Walaupun sempat ragu-ragu, 2005, Eminem (37) bukannya tobat, malah tergelincir makin anda maksud,” bantah ketua mengatakanbahwahakasuhanak A10 tersebut, dan marah-marah. mintasayamenandatanganisurat Okie menolak diminta berdamai, namun akhirnya kedua pihak “Saya lagi makan, selain dimarah- perjanjiansambilmenariktangan dalam sampai pernah mengalami overdosis setelah seorang Hakim ada padanya. didepan peserta sidang yakni pe- yangbertikaiinipunlangsungber- kenalan memberinya pil biru tidak dikenalnya, kemudian KontanOkielangsungmenja- Pasha tidak terima, langsung marahin,Pashajugasempatmen- saya untuk naik ke atas, tapi saya ngacara, JPU dan para pewarta, salaman dan langsung berpe- dorong kursi hingga terjatuh lalu menolak,” tutur Okie. disebutkan dokter menanganinya sebagai methadone.Syafri/ wab dia bersedia disumpah apa- mendatangi rumah yang dulu Okie memperlihatkan sikap keras lukan.(ant) pun, demi kebenaran kesaksian- sempatditempatiberduadiPeru- memukul paha saya dan men- Dalam persidangan tersebut hatinya. BPA Fanny Bauty Minta Mark Willi, Olivia Dan Ozy Menuju Pentas Idola Sungkar Lepaskan Anak-anak Pentas Idola Cilik minggu kalah rocker dalam menden- mentator berpendapat penam- terakhir ini tinggal tersisa tiga dangkan lagu ‘Mimpi’nya Ang- pilan Ozy kali ini sama bahkan Setelah mediasi antara Fanny Bauty dan Mark Sungkar peserta yaituWilli asal Makassar, gun. Komentatorpun puas dan tidak memberikan kejutan baru. gagal, aktris berusia 44 tahun itu meminta agar hak asuh Shireen Olivia asal Jakarta dan Ozy juga menganggap Olivia dan Papa su- Petampil pamungkas adalah dan Zaskia Sungkar jatuh ke tangannya. asal Makassar . Di penampilan dah memberikan pertunjukkan Willi dengan lagu ‘Cobalah Me- “Selama ini anak-anak selalu sama aku, aku yang manajerin. kedua, peserta tampil sendiri de- terbaiknya. ngerti’nya Peterpan.Walau dibe- Mereka kalau syuting aku antar. Yah semoga bapaknya bisa ngan membawa lagu-lagu mere- LainhalnyadenganOzy tam- berapanadaterdengaragakmele- legowo bisa lepaskan anak-anak untuk aku. Karena keperluan ka dengan Bintang Tamu Hijau pil bersama Tantenya mem- set namun para komentator me- mereka yang antisipasi adalah aku. Selama ini kan anak-anak Daun. bawakan lagu‘Cinta Gila’nya An- rasa penampilanWilli mengesan- sama aku,” ujar Fanny usai sidang cerai di Pengadilan Agama Saatberduet,tampildiurutan drea Hirata. Komentator berpen- kan. Hanya saja nafasWilli nam- Jakarta Barat, Rabu (6/1). pertama adalahWilli didampingi dapat kalau penampilan mereka pak tersengal-sengal karena ku- Selain meminta hak asuh anaknya, Fanny juga ingin agar Oma tercinta. Komentator ber- lepas dan vokal terkenal asyik. rang mampu mengimbangi ko- rumah mereka berlokasi di Jakarta Barat menjadi miliknya. pendapat kalau penampilan me- Tiba saatnya mereka bertiga reo yang harus dibawakan. Alasannya, rumah itu memang atas nama Fanny. “Masalah rekaberduatidakseimbang.Oma harus tampil solo dengan meng- Dengan demikianWilli harus rumah juga atas nama aku. Aku yang menyelesaikan sendiri, Ozy tampil lebih dominan.Walau de- hadirkan Olivia yang tampil men- menerimakenyataanpahituntuk udah nggak pantas kalau rumah dibagi-bagi lagi. Aku kan juga mikian mereka satu suara bahwa cengangkan dengan memba- tinggal kelas, sementara Ozy dan Menjadi Idola Cilik memang udah ikhlaskan rumah Puncak dan Bangka Belitung, udah aku WillidanOma menyanyikanlagu wakan lagu‘Tak AdaYang Abadi’- OliviamelajukebabakpentasIdo- menjadi impian bocah kelas 6 SD relakan. Aku nggak haus hartalah,” tuturnya. Black OrWhite nya Michael Jack- nyaPeterpan.Lagudannadayang la akan digelar mulai 16 Januari St.YosefRajawaliini.Bakat dimiliki Namun Fanny dan Mark sepakat agar harta gono-gini son dapat membawakan lagu itu sulit,berhasildikuasaidenganbaik. pukul 13.00 dilanjutkan dengan secara otodidak itu memang be- sepenuhnya diberikan kepada kedua putrinya. Sidang Fanny dengan baik. Oliviapun mendapat pujian se- Rapor di hari Minggu 17 Januari lum begitu memberikan hasil na- dan Mark akan kembali dilanjutkan pada 13 Januari Sylvester Stallone/ist/dth Kesempatan kedua diikuti cara khusus dari Emilia Contessa pukul 14.30. mun dalam beberapa kesem- mendatang.(dth) Leher ‘Rambo’ Retak OliviadenganPapa.Merekatampil ala rocker. Suara Olivia juga luar dalam telewicara. Pujian demi pujian disam- Willi sangat mengidolakan Michale Jackson ini mengaku sa- patandiadimintaitampildiacara- acara sekolah. TapiWilli berjanji biasa, mampu mencapai nada- paikan komentator. Sementara ngat sedih dan kecewa. Anak ke- tak akan larut dalam kesedihan. Akibat Adegan Berkelahi nada tinggi. Sementara Papanya yang mantan anak band, ternyata Ozy menyanyikan lagu ‘Coba- lah’nyaHijauDauntampildengan dua dari dua bersaudara ini terus menundukkan kepala saat diwa- Ia berencana untuk mengambil kursusvokalagardapatmencapai Demi totalitas akting, aktor Sylvester Stallone harus melakoni mampu mengimbangi penam- penuhpercayadiridankoreoyang wancara, walau sahabat-saha- cita-citanya menjadi penyanyi adegan berkelahi dengan lawan mainnya. Karena terlalu sengit, pilan anaknya dengan suara tak cukup baik. Hanya saja para ko- batnya terus menghibur. cilik.(m09) leher Stallone retak. Kejadian bermula saat Stallone dan mantan atlet gulat Stone ColdSteveAustinmelakukanperkelahianuntukfilm‘TheExpendables’ Keduanya memiliki tubuh besar dan berotot saling memukul dan . Sherlock Holmes 2 membanting. Tiba-tiba terdengar suara rintihan ternyata Stallone sudah berusia 63 tahun mengalami cidera. Pemain film sekuel‘Rambo’ itu terlentang Terancam Batal di lantai sambil menahan sakit dan memegang lehernya. Rencanapenggarapansekuel “Kamiadalahduapria berba- Setelah diperiksa, Stallone ternyata mengalami cedera cukup Sherlock Holmes terancam gagal. gi kamar, sering bergulat dan serius. Beberapa tulang di lehernya retak. Beruntung nyawa Stallone Halituterjadisetelahsangbintang seringberbagitempattidur,”ucap tak sampai melayang karena tim medis segera membawanya ke utama, Robert Downey Jr, meng- bintang ‘Iron Man’ itu saat mela- rumah sakit klaim Sherlock bisa digambarkan koni wawancara dengan David “Sakitnya luar biasa. Saya sampai berteriak ketika Austin sebagai seorang gay di film beri- Letterman, beberapa waktu lalu. menendang saya,” ujar Stallone seperti yang dilansir Contact Music, Rabu (6/1). Leher Stallone pun harus ditopang perban untuk kutnya. Menurutnya, komentar Ro- membantu proses penyembuhan. Seperti dilansir Female First, bert itu sangat tidak tepat. Adrea Film ‘The Expendables’ adalah film terbaru Sylvester Stallone. Selasa (5/1), Adrea Plunket, pe- pun menilai Robert telah me- Film bercerita soal aksi sekelompok tentara bayaran menumbangkan megang hak cipta karya literatur nghina karakter detektif legen- seorang diktator di Amerika Selatan itu juga akan dibintangi sejumlah Sir Arthur Conan Doyle, sangat daris itu. “Saya akan pikir-pikir aktor laga papan atas. Nama-nama seperti BruceWillis, Jet Li, Mickey tidak senang dengan ucapan untuk memberikan izin jika me- Rourke dan Jason Statham adalah di antaranya. Downey menyebutkan kalau reka memang mengangkat tema Film disutradarai Stallone itu menurut rencana akan tayang HolmesdanDrWatsonbisasaling gaydifilmyangakandatang,”jelas di Amerika Serikat 20 Agustus 2010.(dth) Sherlock Holmes/ist/dth jatuh cinta. Andrea.(dth) Fanny Bauty/dth 07.30 Status Palsu 07.30 Musik : Inbox 07.00 Kartun 07.00 Pororo The 07.30 FTV Pagi 07.05 Bedah 07.30 Sinema 08.30 Nama & 08.00 Avatar 07.30 I Gosip Pagi 09.00 Musik : Dahsyat 09.30 Halo Selebriti Spesial Little Penguin 09.30 FTV Editorial Media Spesial Pagi Peristiwa 09.00 Obsesi 08.00 Mancing 11.00 Silet 10.00 SCTV FTV 08.00 Masquerade 07.30 Kartun Drama Indonesia 09.30 Musik 09.00 Kabar 9 10.00 Bukan Mania 12.00 Seputar Indone- Pagi 09.00 Layar Pagi Kimba 11.30 Patroli 08.05 Healthy Life Derings 09.30 Kabar Sinetron 09.00 Dunia sia Siang 12.00 Liputan 6 10.30 Di Antara 08.30 Espresso 12.00 Fokus 09.05 Indonesia This 11.00 Insert Pasar 11.00 Selebritis Binatang 12.30 Sergap Siang Kita 09.30 Sinema Siang Morning 12.00 Reportase 10.00 Documen- Dan Kasus 10.30 60 Minutes 13.00 Menuju Pentas 12.30 SCTV FTV 11.00 Sidik Religi 12.30 Happy 09.30 Markiet Siang tary One 11.30 Impianku 11.30 Redaksi Siang Idola Siang 13.00 Layar 11.30 Topik Siang Song Review 13.00 Mr Bean 11.00 Opini 12.00 Awas Ada 12.00 I Gosip Siang 15.00 Kabar Kabari 14.30 Status Kemilau 12.00 Musik : Klik 14.30 KiSS Sore 10.05 Chat Club 13.30 Online 12.00 Kabar Sule 12.30 Bocah 15.30 Selebriti Berbagi Selebritis 14.30 Go Show 13.00 Transformer 15.30 Boys 10.30 Metro Xin 15.00 Missing Siang 13.00 Global Petualang 16.00 Bedah Rumah 15.00 Playlist 15.00 Upin & Ipin 15.00 Hari Yang Before Wen Lyrics 13.00 Kabar Siang 13.00 Laptop Si 17.00 Seputar Indone- 16.00 Lemon Tea 15.30 FS Kera Aneh FLowers 11.05 News Maker 16.00 Kejar Keadilan 14.00 MTV Unyil sia 17.00 Liputan 6 Sakti 15.30 Lajang 16.30 The 11.30 Megapolitan Tayang 14.00 Satu Jam Ampuh 14.00 Cita Citaku 17.30 Rumah Hadiah Petang 17.00 Viking 17.30 Topik Petang Great Queen 12.05 Metro Siang 16.30 Orang Lebih Dekat 16.30 Berita 14.30 Dunia Air 18.00 Kejora Dan 17.30 Buku Harian 18.00 Sinetron Si 18.00 Super Soendoek 13.30 Mata Najwa Ketiga 15.00 Kabar 15 Globall 15.00 Koki Cilik Bintang Baim Mamat Candid Kids 18.00 Seruni 15.05 Bisnis Hari Ini 17.00 Reportase 17.00 Telusur 17.30 16.00 Jejak Petualang 19.45 Safa Dan 18.30 Cinta Juga 19.00 Kisah 18.30 Super 19.00 16.05 Discover Sore 17.30 Kabar Spongebob 17.30 Kamisnya Marwah3 Kuya Fantasi Family Pengorbanan Indonesia 17.30 Insert Sore Petang 18.00 Naruto Wara Wiri 20.30 Doa Dan 19.00 Hafizah 20.30 Kisah 19.30 OMG Anggun 19.05 Suara Anda 18.00 Suami 19.30 Satu Jam 19.00 Awas Ada 18.00 On The Sport Anugerah 20.00 Bayu Cinta Fantasi 20.30 Tawa Sutra 20.00 Baghdad 20.30 Genta Suami Takut Istri Lebih Dekat Sule 19.00 OKB 22.00 Pilihan Mama Luna 21.30 Big Show 21.30 Sinema Aksi 22.00 Gelar Demokrasi 19.00 Angel’s 20.30 Tanpa 20.00 Big Movies 20.00 Opera Van Java 00.00 Box Office Movie 21.30 Kesetiaan Best Of The Best 23.30 Mata Rantai Film Indonesia 21.05 Top Nine Diary Tanda Jasa 22.30 Big Movies 2