Your SlideShare is downloading. ×
GSM/UMTS network architecture tutorial (Indonesia)
Upcoming SlideShare
Loading in...5

Thanks for flagging this SlideShare!

Oops! An error has occurred.

Saving this for later? Get the SlideShare app to save on your phone or tablet. Read anywhere, anytime – even offline.
Text the download link to your phone
Standard text messaging rates apply

GSM/UMTS network architecture tutorial (Indonesia)


Published on

Presentasi dalam Bahasa Indonesia

Presentasi dalam Bahasa Indonesia

Published in: Technology, Business
  • Be the first to comment

No Downloads
Total Views
On Slideshare
From Embeds
Number of Embeds
Embeds 0
No embeds

Report content
Flagged as inappropriate Flag as inappropriate
Flag as inappropriate

Select your reason for flagging this presentation as inappropriate.

No notes for slide


  • 1. Tutorial DasarArsitekturJaringan GSM/UMTS, 30 July 2009
  • 2. 1G
    Generasipertama (1G) merupakansistemseluler analog.
    Jaringankomersialmulai 1998
    Nordic Mobile Telephone (NMT) di Scandinavia danbeberapanegaradiEropa
    Advanced Mobile Phone Service (AMPS) di US, Australia, Asia
    Total Access Communications System (TACS) di UK danbeberapanegaradiEropa
  • 3. 2G
    Sistem wireless digital
    Kapasitas, utilitasspektrum, kualitassuarameningkat . Konsumsidayamenurun
    Standarisasi core network
    Mulaidikembanganlayanan data
  • 4. 2G
    4 standarutama yang banyakdipakaiadalah:
    Global System for Mobile (GSM) communications danturunanannya. GSM sepertijuga AMPS, menggunakanteknologi TDMA
    Digital AMPS (disebutjuga D-AMPS, US-TDMA, IS-136, atau TDMA)
    Code-Division Multiple Access (CDMA) 2000 1x atau IS-95Jaringan IS-95 dikenaljugadengannamaCdmaOnedikembangkanoleh Qualcomm
    Personal Digital Cellular (PDC) atau PHSPertama kali bernamaJapanesse Digital Celullar (JDC) yang merupakanstandar 2G diJepang
  • 5. GSM
    Padadasarnya GSM menggunakan band 900 MHz, tetapibeberapaturunan GSM menggunakan band 1800 dan 1900, yaitu:
    Digital Cellular/Communication(?) System 1800 (DCS-1800 atau GSM-1800)
    Personal Communication System-1900 (PCS-1900 atau GSM-1900)
    European Telecommunications Standards Institute (ETSI) jugamembuatspesifikasiuntuk GSM-400 dan GSM-800
  • 6. Digital cordless systems
    System initidakmemilikikomponenjaringan (network component), biasanyahanyaterdiridarisebuah base station dansejumlah handset.
    Lingkupareanya pun terbatasbiasanyahanyasatu area gedung.
    Digital Enhanced Cordless Telecommunications (DECT),
    Personal Handyphone System (PHS).
  • 7. 2.5G
    Peningkatan data rate per user (25kbps)
    Layanan Data (GPRS) denganpenambahan packet-switched core network
    CDMA IS-95B (64kbps)
  • 8. 2.75G/GSM
    EDGE (Enhanced Data rates for GSM Evolution) or EGPRS (Enhanced GPRS)
    Perbaikanpadajaringanakses radio GERAN (GSM EDGE Radio Access Network)
    Perbaikanmodulasi 8-Phase Shift Keying (8PSK)
    kecepatanlebihtinggi 126-473,8 kbps
    kapasistastransmisi data lebihtinggi
    Kualitas audio streaming, video steraming, on line gaming. high speed download, hiqh speed network connection, push to talk, dll
  • 9. 3G
    Universal global roaming
    Mendukungkomunikasi multimedia (voice, data & video)
    Peningkatan data rates
    384 kbps saatbergerak
    2 Mbps saat ‘diam’
    Increased capacity (more spectrally efficient)
    IP architecture
  • 10. 3G Standard (IMT-2000)
    IMT-SC* Single Carrier (UWC-136): EDGE
    GSM evolution (TDMA); 200 KHz channels; sometimes called “2.75G”
    IMT-MC* Multi Carrier CDMA: CDMA2000
    Evolution of IS-95 CDMA, i.e. cdmaOne
    IMT-DS* Direct Spread CDMA: W-CDMA
    New from 3GPP; UTRAN FDD
    IMT-TC** Time Code CDMA
    New from 3GPP; UTRAN TDD
    New from China; TD-SCDMA
    IMT-FT** FDMA/TDMA (DECT legacy)
  • 11. 3G/UMTS
    Universal Mobile Telecommunication System (UMTS) distandarisaioleh 3GPP
    Teknologi W-CDMA (Wideband Code-Division Multiple Access)
    Peningkatankecepatanaksessampai 384 kbps danterus
    1920- 1980 Mhzuntuk down link, 2120-2180 Mhzuntuk up link
    Using Wideband-AMR (Adaptive Multi-rate) for voice codec makes quality enchancement
  • 12. 3G/CDMA 2000
    Distandarisasioleh 3GPP2
    CDMA2000 1x (IS-2000 and IS-856)
    menggunakan 1.25 MHz,
    data rates sampai 144 kbps (1X RTT)
  • 13. CDMA Evolution
  • 14. 3.5G
    3GPP Release 5
    CDMA 1xEV-DO Revision B atau CDMA2000 3x
  • 15. 3.75G
    3GPP Release 6
    CDMA 2000 1X EV-DV (Evolution of Data Voice) atau CDMA Release C & D (EV-DV)
    Tahun 2005 Qualcomm menghentikanpemengembangan EV-DV.
  • 16. GSM, UMTS, IMS and beyond
  • 17. GSM Architecture – Phase 1
  • 18. GSM Sub-System
    Arsitektur GSM terdiridari 3 Sub-System yaitu:
    Mobile Station (MS) atauteleponselular
    ME (IMEI) + SIM (IMSI)
    Base Station Sub-System (BSS)
    mengontrolhubungan radio (radio link) dengan MS
    Network Sub-System (NS) atau Network Switching Sub System (NSS)
    Operation Sub-System (OSS)
  • 19. BTS
    tranceiver yang mendefinisikansebuahsel (cell)
    menanganihubungan radio link dengan MS (pemrosesansinyal, transimisinyal, encoding dan decoding suara)
    berkomunikasidengan BSC menggunakanAter interface
  • 20. BSC
    mengatur radio resource yang ditanganiolehsatu BTS ataulebih (RRM)
    menangani radio-channel setup, frequency hopping, handover antar BSC
  • 21. MSC
    perangkatdasar switching (call handling)
    mengelola logical radio-link channel yang dibutuhkansaat call terjadi
    mengelola signaling protocol antara MSC-BSS
    mengatur inter-BSS atau inter-MSC handovers
    mengumpulkan data untuk charging
    sebuah MSC biasanyamenaganibanyak BSC
  • 22. AuC
    Menyimpan parameter-parameter untukotentikasipelangganketikamenggunakanjaringan GSM, yaitu:
    Authentication Keys (Ki),
    Algoritma A3
    Algoritma A8
    Menghasilkan 3 parameter otentikasi
    Signed Response (SRES),
    CipherKey (Kc)
    Parameter otentikasitersebutkemudiandisimpannyadi VLR
    RAND = 128-bit random yang di-generate olehAuC
    SRES = 32-bit one-way hash dari RAND danKi yang dikalkulasidenganAlgoritma A3
    Kc = 64-bit dari RAND danKi yang dikalkulasidenganAlgoritma A8
  • 23. HLR
    Menyimpan data pelanggan, secarapermanendiantaranya
    supplementary service yang digunakan
    pembatasanlayanan (service restrictions)
    informasitentanglayananteleservicesdan bearer
    lokasiterkinidari MS untuk call routing
    Beberapa data diupdatesecaraberkalamisalnyalokasi subscriber (VLR, Cell ID)
  • 24. VLR
    VLR menyimpansementaradari
    data pelangganlokalataupelanggan roaming (MSISDN, TMSI)
    location area dimana MS teregister
    copy data dari subscriber dari HLR
    data yang digunakanuntukproses encryption
    Men-generate MSRN
  • 25. GSM Architecture – Phase 2/2+
  • 26. Pembagian domain
    SC Domain
    PS Domain
  • 27. SGSN (Serving GPRS Support Node)
    Penyimpansementara data subscriber (seperti VLR)
    Mobility management (attach/detach, location update)
    Otentifikasi, enkripsi
    Logical link management, Tunneling
    Routing packet (downlink)
  • 28. GGSN
    Penghubungke external PS networks (internet ataujaringan X.25)
    GTP Tunneling (menambahkanataumenghilangkan GTP dan layer protokoldibawahnya)
  • 29. Additional Elements
    DNS Servers
    WAP Gateway
    Boarder Gateway
    RBT Server
  • 30. UMTS Release 99
    Difinalisasipadatahun 2000
    GSM RAN (Radio Access Network) digantikan UTRAN (UMTS Radio Access Network), yaitu
    Menggunakan WCDMA sebagai air interface, tapijugamendukung GSM/EDGE/GPRS radio-access network.
    Pita frekuensi (bandwidth) yang lebihlebar
    Macrodiversity, soft handover
    UL/DL konfigurasi RAB yang lebihfleksibel
    Dedicated and shared resource usage
    Handovers dari/ke GSM
  • 31. UMTS Release 4
    Hampirtidakadaperubahanpada FDD
    Diperkenalkan Low ChipRate TDD
    Mendukung MMS
    Pemisahanantara user-plane (Transport) dan control-plane pada domain CS.
    Pemisahantersebutdilakukandenganmemperkenalkanarsitektur Mobile Switching Server yaitumenggunakan MGW (Media Gateway) sebagaielemen yang mengatur user-plane dan MSS (Mobile Switching Server) sebagaielemen yang pengotrol MGW.
    Domain CS dapatberbasis IP (tidaklagiharus TDM/ATM)
  • 32. UMTS R4 Architecture
  • 33. UMTS Release 5
    HSDPA menggunakan
    Hybrid Automatic Repeat Request (HARQ),
    link adaptation,
    ordemodulasi yang lebihtinggiuntukmeningkatkanefisiensispektralyaitumenggunakan 16QAM
    Hybrid ARQ
    Turbo Codes
    Core network mengalamiperubahanyaituadanyaarsitektur IMS (IP Multimedia Solution) denganmemperkenalkanjaringan yang berbasis IP danelemen-elemenfungsionalbaru yang mendukung VoIP (Voice overIP) yang menggunakanprotokol SIP (Session Initiation Protocol).
    IP UTRAN (Layer 2 antara RNC dan GGSN tidakharusberbasis ATM)
  • 34. UMTS R5/IMS Architecture
  • 35. UMTS Release 6
    HSUPA denganmenggunakan Enhanced Dedicated Channel (E-DCH)
    Multicast and broadcast service menggunakan Multimedia Broadcast/Multicast Service (MBMS)
    Extended location based services (LBS), with built in anonymization
    PS streaming service with adaptation to available network resources (GERAN/GPRS, UTMS, WLAN)
    Charging Management Framework (for extended payment system)
  • 36. UMTS Release 7
    Disebutjuga HSPA+ atau HSPA Evolved
    Ordemodulasi yang lebihtinggi (HOMs)
    Multi-antenna techniques (MIMO)
    Arsitektur RAN: "one tunnels solution" (OTS), mulaimenuju Flat Architecture
    Optimasipada VoIP lewat HSPA
  • 37. 4G
  • 38. UMTS Release 8 danselanjutnya
