• Like
  • Save
GSM/UMTS network architecture tutorial (Indonesia)
Upcoming SlideShare
Loading in...5

GSM/UMTS network architecture tutorial (Indonesia)



Presentasi dalam Bahasa Indonesia

Presentasi dalam Bahasa Indonesia



Total Views
Views on SlideShare
Embed Views



2 Embeds 3

http://www.slashdocs.com 2
http://www.techgig.com 1



Upload Details

Uploaded via as Microsoft PowerPoint

Usage Rights

© All Rights Reserved

Report content

Flagged as inappropriate Flag as inappropriate
Flag as inappropriate

Select your reason for flagging this presentation as inappropriate.

  • Full Name Full Name Comment goes here.
    Are you sure you want to
    Your message goes here
Post Comment
Edit your comment

    GSM/UMTS network architecture tutorial (Indonesia) GSM/UMTS network architecture tutorial (Indonesia) Presentation Transcript

    • Tutorial DasarArsitekturJaringan GSM/UMTS
      ejlp12@gmail.com, 30 July 2009
    • 1G
      Generasipertama (1G) merupakansistemseluler analog.
      Jaringankomersialmulai 1998
      Nordic Mobile Telephone (NMT) di Scandinavia danbeberapanegaradiEropa
      Advanced Mobile Phone Service (AMPS) di US, Australia, Asia
      Total Access Communications System (TACS) di UK danbeberapanegaradiEropa
    • 2G
      Sistem wireless digital
      Kapasitas, utilitasspektrum, kualitassuarameningkat . Konsumsidayamenurun
      Standarisasi core network
      Mulaidikembanganlayanan data
    • 2G
      4 standarutama yang banyakdipakaiadalah:
      Global System for Mobile (GSM) communications danturunanannya. GSM sepertijuga AMPS, menggunakanteknologi TDMA
      Digital AMPS (disebutjuga D-AMPS, US-TDMA, IS-136, atau TDMA)
      Code-Division Multiple Access (CDMA) 2000 1x atau IS-95Jaringan IS-95 dikenaljugadengannamaCdmaOnedikembangkanoleh Qualcomm
      Personal Digital Cellular (PDC) atau PHSPertama kali bernamaJapanesse Digital Celullar (JDC) yang merupakanstandar 2G diJepang
    • GSM
      Padadasarnya GSM menggunakan band 900 MHz, tetapibeberapaturunan GSM menggunakan band 1800 dan 1900, yaitu:
      Digital Cellular/Communication(?) System 1800 (DCS-1800 atau GSM-1800)
      Personal Communication System-1900 (PCS-1900 atau GSM-1900)
      European Telecommunications Standards Institute (ETSI) jugamembuatspesifikasiuntuk GSM-400 dan GSM-800
    • Digital cordless systems
      System initidakmemilikikomponenjaringan (network component), biasanyahanyaterdiridarisebuah base station dansejumlah handset.
      Lingkupareanya pun terbatasbiasanyahanyasatu area gedung.
      Digital Enhanced Cordless Telecommunications (DECT),
      Personal Handyphone System (PHS).
    • 2.5G
      Peningkatan data rate per user (25kbps)
      Layanan Data (GPRS) denganpenambahan packet-switched core network
      CDMA IS-95B (64kbps)
    • 2.75G/GSM
      EDGE (Enhanced Data rates for GSM Evolution) or EGPRS (Enhanced GPRS)
      Perbaikanpadajaringanakses radio GERAN (GSM EDGE Radio Access Network)
      Perbaikanmodulasi 8-Phase Shift Keying (8PSK)
      kecepatanlebihtinggi 126-473,8 kbps
      kapasistastransmisi data lebihtinggi
      Kualitas audio streaming, video steraming, on line gaming. high speed download, hiqh speed network connection, push to talk, dll
    • 3G
      Universal global roaming
      Mendukungkomunikasi multimedia (voice, data & video)
      Peningkatan data rates
      384 kbps saatbergerak
      2 Mbps saat ‘diam’
      Increased capacity (more spectrally efficient)
      IP architecture
    • 3G Standard (IMT-2000)
      IMT-SC* Single Carrier (UWC-136): EDGE
      GSM evolution (TDMA); 200 KHz channels; sometimes called “2.75G”
      IMT-MC* Multi Carrier CDMA: CDMA2000
      Evolution of IS-95 CDMA, i.e. cdmaOne
      IMT-DS* Direct Spread CDMA: W-CDMA
      New from 3GPP; UTRAN FDD
      IMT-TC** Time Code CDMA
      New from 3GPP; UTRAN TDD
      New from China; TD-SCDMA
      IMT-FT** FDMA/TDMA (DECT legacy)
    • 3G/UMTS
      Universal Mobile Telecommunication System (UMTS) distandarisaioleh 3GPP
      Teknologi W-CDMA (Wideband Code-Division Multiple Access)
      Peningkatankecepatanaksessampai 384 kbps danterus
      1920- 1980 Mhzuntuk down link, 2120-2180 Mhzuntuk up link
      Using Wideband-AMR (Adaptive Multi-rate) for voice codec makes quality enchancement
    • 3G/CDMA 2000
      Distandarisasioleh 3GPP2
      CDMA2000 1x (IS-2000 and IS-856)
      menggunakan 1.25 MHz,
      data rates sampai 144 kbps (1X RTT)
    • CDMA Evolution
    • 3.5G
      3GPP Release 5
      CDMA 1xEV-DO Revision B atau CDMA2000 3x
    • 3.75G
      3GPP Release 6
      CDMA 2000 1X EV-DV (Evolution of Data Voice) atau CDMA Release C & D (EV-DV)
      Tahun 2005 Qualcomm menghentikanpemengembangan EV-DV.
    • GSM, UMTS, IMS and beyond
    • GSM Architecture – Phase 1
    • GSM Sub-System
      Arsitektur GSM terdiridari 3 Sub-System yaitu:
      Mobile Station (MS) atauteleponselular
      ME (IMEI) + SIM (IMSI)
      Base Station Sub-System (BSS)
      mengontrolhubungan radio (radio link) dengan MS
      Network Sub-System (NS) atau Network Switching Sub System (NSS)
      Operation Sub-System (OSS)
    • BTS
      tranceiver yang mendefinisikansebuahsel (cell)
      menanganihubungan radio link dengan MS (pemrosesansinyal, transimisinyal, encoding dan decoding suara)
      berkomunikasidengan BSC menggunakanAter interface
    • BSC
      mengatur radio resource yang ditanganiolehsatu BTS ataulebih (RRM)
      menangani radio-channel setup, frequency hopping, handover antar BSC
    • MSC
      perangkatdasar switching (call handling)
      mengelola logical radio-link channel yang dibutuhkansaat call terjadi
      mengelola signaling protocol antara MSC-BSS
      mengatur inter-BSS atau inter-MSC handovers
      mengumpulkan data untuk charging
      sebuah MSC biasanyamenaganibanyak BSC
    • AuC
      Menyimpan parameter-parameter untukotentikasipelangganketikamenggunakanjaringan GSM, yaitu:
      Authentication Keys (Ki),
      Algoritma A3
      Algoritma A8
      Menghasilkan 3 parameter otentikasi
      Signed Response (SRES),
      CipherKey (Kc)
      Parameter otentikasitersebutkemudiandisimpannyadi VLR
      RAND = 128-bit random yang di-generate olehAuC
      SRES = 32-bit one-way hash dari RAND danKi yang dikalkulasidenganAlgoritma A3
      Kc = 64-bit dari RAND danKi yang dikalkulasidenganAlgoritma A8
    • HLR
      Menyimpan data pelanggan, secarapermanendiantaranya
      supplementary service yang digunakan
      pembatasanlayanan (service restrictions)
      informasitentanglayananteleservicesdan bearer
      lokasiterkinidari MS untuk call routing
      Beberapa data diupdatesecaraberkalamisalnyalokasi subscriber (VLR, Cell ID)
    • VLR
      VLR menyimpansementaradari
      data pelangganlokalataupelanggan roaming (MSISDN, TMSI)
      location area dimana MS teregister
      copy data dari subscriber dari HLR
      data yang digunakanuntukproses encryption
      Men-generate MSRN
    • GSM Architecture – Phase 2/2+
    • Pembagian domain
      SC Domain
      PS Domain
    • SGSN (Serving GPRS Support Node)
      Penyimpansementara data subscriber (seperti VLR)
      Mobility management (attach/detach, location update)
      Otentifikasi, enkripsi
      Logical link management, Tunneling
      Routing packet (downlink)
    • GGSN
      Penghubungke external PS networks (internet ataujaringan X.25)
      GTP Tunneling (menambahkanataumenghilangkan GTP dan layer protokoldibawahnya)
    • Additional Elements
      DNS Servers
      WAP Gateway
      Boarder Gateway
      RBT Server
    • UMTS Release 99
      Difinalisasipadatahun 2000
      GSM RAN (Radio Access Network) digantikan UTRAN (UMTS Radio Access Network), yaitu
      Menggunakan WCDMA sebagai air interface, tapijugamendukung GSM/EDGE/GPRS radio-access network.
      Pita frekuensi (bandwidth) yang lebihlebar
      Macrodiversity, soft handover
      UL/DL konfigurasi RAB yang lebihfleksibel
      Dedicated and shared resource usage
      Handovers dari/ke GSM
    • UMTS Release 4
      Hampirtidakadaperubahanpada FDD
      Diperkenalkan Low ChipRate TDD
      Mendukung MMS
      Pemisahanantara user-plane (Transport) dan control-plane pada domain CS.
      Pemisahantersebutdilakukandenganmemperkenalkanarsitektur Mobile Switching Server yaitumenggunakan MGW (Media Gateway) sebagaielemen yang mengatur user-plane dan MSS (Mobile Switching Server) sebagaielemen yang pengotrol MGW.
      Domain CS dapatberbasis IP (tidaklagiharus TDM/ATM)
    • UMTS R4 Architecture
    • UMTS Release 5
      HSDPA menggunakan
      Hybrid Automatic Repeat Request (HARQ),
      link adaptation,
      ordemodulasi yang lebihtinggiuntukmeningkatkanefisiensispektralyaitumenggunakan 16QAM
      Hybrid ARQ
      Turbo Codes
      Core network mengalamiperubahanyaituadanyaarsitektur IMS (IP Multimedia Solution) denganmemperkenalkanjaringan yang berbasis IP danelemen-elemenfungsionalbaru yang mendukung VoIP (Voice overIP) yang menggunakanprotokol SIP (Session Initiation Protocol).
      IP UTRAN (Layer 2 antara RNC dan GGSN tidakharusberbasis ATM)
    • UMTS R5/IMS Architecture
    • UMTS Release 6
      HSUPA denganmenggunakan Enhanced Dedicated Channel (E-DCH)
      Multicast and broadcast service menggunakan Multimedia Broadcast/Multicast Service (MBMS)
      Extended location based services (LBS), with built in anonymization
      PS streaming service with adaptation to available network resources (GERAN/GPRS, UTMS, WLAN)
      Charging Management Framework (for extended payment system)
    • UMTS Release 7
      Disebutjuga HSPA+ atau HSPA Evolved
      Ordemodulasi yang lebihtinggi (HOMs)
      Multi-antenna techniques (MIMO)
      Arsitektur RAN: "one tunnels solution" (OTS), mulaimenuju Flat Architecture
      Optimasipada VoIP lewat HSPA
    • 4G
    • UMTS Release 8 danselanjutnya