Tutorial DasarArsitekturJaringan GSM/UMTS <br />ejlp12@gmail.com, 30 July 2009<br />
1G<br />Generasipertama (1G) merupakansistemseluler analog.<br />Jaringankomersialmulai 1998<br />Nordic Mobile Telephone ...
2G<br />Sistem wireless digital<br />Kapasitas, utilitasspektrum, kualitassuarameningkat . Konsumsidayamenurun<br />Standa...
2G<br />4 standarutama yang banyakdipakaiadalah:<br />Global System for Mobile (GSM) communications danturunanannya.  GSM ...
GSM<br />Padadasarnya GSM menggunakan band 900 MHz, tetapibeberapaturunan GSM menggunakan band 1800 dan 1900, yaitu:<br />...
Digital cordless systems<br />System initidakmemilikikomponenjaringan (network component), biasanyahanyaterdiridarisebuah ...
2.5G<br />GSM<br />Peningkatan data rate per user (25kbps)<br />Layanan Data (GPRS) denganpenambahan packet-switched core ...
2.75G/GSM<br />EDGE (Enhanced Data rates for GSM Evolution) or EGPRS (Enhanced GPRS)<br />Perbaikanpadajaringanakses radio...
3G<br />Visi<br />Universal global roaming<br />Mendukungkomunikasi multimedia (voice, data & video)<br />Peningkatan data...
3G Standard (IMT-2000)<br />IMT-SC*  Single Carrier (UWC-136):  EDGE<br />GSM evolution (TDMA);  200 KHz channels; sometim...
3G/UMTS<br />Universal Mobile Telecommunication System (UMTS) distandarisaioleh 3GPP<br />Teknologi W-CDMA (Wideband Code-...
3G/CDMA 2000 <br />Distandarisasioleh 3GPP2<br />CDMA2000 1x (IS-2000 and IS-856)<br />menggunakan 1.25 MHz, <br />data ra...
CDMA Evolution<br />
3.5G<br />UMTS/HSDPA<br />3GPP Release 5<br />CDMA 1xEV-DO Revision B atau CDMA2000 3x<br />
3.75G<br />UMTS/HSUPA/HSPA<br />3GPP Release 6<br />CDMA 2000 1X EV-DV (Evolution of Data Voice) atau CDMA Release C & D (...
GSM, UMTS, IMS and beyond<br />
GSM Architecture – Phase 1<br />
GSM Sub-System<br />Arsitektur GSM terdiridari 3 Sub-System yaitu:<br /> Mobile Station (MS) atauteleponselular<br />ME (I...
BTS<br />tranceiver yang mendefinisikansebuahsel (cell) <br />menanganihubungan radio link dengan MS (pemrosesansinyal, tr...
BSC<br />mengatur radio resource yang ditanganiolehsatu BTS ataulebih (RRM)<br />menangani radio-channel setup, frequency ...
MSC<br />perangkatdasar switching (call handling)<br />mengelola logical radio-link channel yang dibutuhkansaat call terja...
AuC<br />Menyimpan parameter-parameter untukotentikasipelangganketikamenggunakanjaringan GSM, yaitu:<br />Authentication K...
HLR<br />Menyimpan data pelanggan, secarapermanendiantaranya<br />IMSI, MSISDN<br />supplementary service yang digunakan<b...
VLR<br />VLR menyimpansementaradari<br />data pelangganlokalataupelanggan roaming (MSISDN, TMSI)<br />location area dimana...
GSM Architecture – Phase 2/2+<br />
Pembagian domain<br />SC Domain<br />PS Domain<br />
SGSN (Serving GPRS Support Node)<br />Penyimpansementara data subscriber (seperti VLR)<br />Mobility management (attach/de...
GGSN<br />Penghubungke external PS networks (internet ataujaringan X.25)<br />GTP Tunneling (menambahkanataumenghilangkan ...
Additional Elements<br />DNS Servers<br />WAP Gateway<br />Boarder Gateway<br />SMSC<br />MMSC<br />RBT Server<br />
UMTS Release 99<br />Difinalisasipadatahun 2000<br />GSM RAN (Radio Access Network) digantikan UTRAN (UMTS Radio Access Ne...
UMTS Release 4<br />Hampirtidakadaperubahanpada FDD<br />Diperkenalkan Low ChipRate TDD<br />Mendukung MMS<br />Pemisahana...
UMTS R4 Architecture<br />
UMTS Release 5<br /> HSDPA menggunakan<br />  Hybrid Automatic Repeat Request (HARQ), <br />  link adaptation, <br />ordem...
UMTS R5/IMS Architecture<br />
UMTS Release 6<br />HSUPA denganmenggunakan Enhanced Dedicated Channel (E-DCH) <br />Multicast and broadcast service mengg...
UMTS Release 7<br />Disebutjuga HSPA+ atau HSPA Evolved<br />Ordemodulasi yang lebihtinggi (HOMs) <br />Multi-antenna tech...
4G<br />IMT-Advanced<br />
UMTS Release 8 danselanjutnya<br />LTE<br />LTE-Advanced<br />
Upcoming SlideShare
Loading in...5

GSM/UMTS network architecture tutorial (Indonesia)


Published on

Presentasi dalam Bahasa Indonesia

Published in: Technology, Business
  • Be the first to comment

No Downloads
Total Views
On Slideshare
From Embeds
Number of Embeds
Embeds 0
No embeds

No notes for slide

GSM/UMTS network architecture tutorial (Indonesia)

  1. 1. Tutorial DasarArsitekturJaringan GSM/UMTS <br />ejlp12@gmail.com, 30 July 2009<br />
  2. 2. 1G<br />Generasipertama (1G) merupakansistemseluler analog.<br />Jaringankomersialmulai 1998<br />Nordic Mobile Telephone (NMT) di Scandinavia danbeberapanegaradiEropa<br />Advanced Mobile Phone Service (AMPS) di US, Australia, Asia<br />Total Access Communications System (TACS) di UK danbeberapanegaradiEropa<br />
  3. 3. 2G<br />Sistem wireless digital<br />Kapasitas, utilitasspektrum, kualitassuarameningkat . Konsumsidayamenurun<br />Standarisasi core network<br />Mulaidikembanganlayanan data<br />
  4. 4. 2G<br />4 standarutama yang banyakdipakaiadalah:<br />Global System for Mobile (GSM) communications danturunanannya. GSM sepertijuga AMPS, menggunakanteknologi TDMA <br />Digital AMPS (disebutjuga D-AMPS, US-TDMA, IS-136, atau TDMA)<br />Code-Division Multiple Access (CDMA) 2000 1x atau IS-95Jaringan IS-95 dikenaljugadengannamaCdmaOnedikembangkanoleh Qualcomm<br />Personal Digital Cellular (PDC) atau PHSPertama kali bernamaJapanesse Digital Celullar (JDC) yang merupakanstandar 2G diJepang<br />
  5. 5. GSM<br />Padadasarnya GSM menggunakan band 900 MHz, tetapibeberapaturunan GSM menggunakan band 1800 dan 1900, yaitu:<br /> Digital Cellular/Communication(?) System 1800 (DCS-1800 atau GSM-1800)<br /> Personal Communication System-1900 (PCS-1900 atau GSM-1900)<br /> European Telecommunications Standards Institute (ETSI) jugamembuatspesifikasiuntuk GSM-400 dan GSM-800 <br />
  6. 6. Digital cordless systems<br />System initidakmemilikikomponenjaringan (network component), biasanyahanyaterdiridarisebuah base station dansejumlah handset.<br />Lingkupareanya pun terbatasbiasanyahanyasatu area gedung.<br />CT2, <br />Digital Enhanced Cordless Telecommunications (DECT),<br />Personal Handyphone System (PHS).<br />
  7. 7. 2.5G<br />GSM<br />Peningkatan data rate per user (25kbps)<br />Layanan Data (GPRS) denganpenambahan packet-switched core network<br />CDMA IS-95B (64kbps)<br />
  8. 8. 2.75G/GSM<br />EDGE (Enhanced Data rates for GSM Evolution) or EGPRS (Enhanced GPRS)<br />Perbaikanpadajaringanakses radio GERAN (GSM EDGE Radio Access Network) <br />Perbaikanmodulasi 8-Phase Shift Keying (8PSK)<br />kecepatanlebihtinggi 126-473,8 kbps<br />kapasistastransmisi data lebihtinggi<br />Kualitas audio streaming, video steraming, on line gaming. high speed download, hiqh speed network connection, push to talk, dll<br />
  9. 9. 3G<br />Visi<br />Universal global roaming<br />Mendukungkomunikasi multimedia (voice, data & video)<br />Peningkatan data rates<br />384 kbps saatbergerak<br />2 Mbps saat ‘diam’<br />Increased capacity (more spectrally efficient)<br />IP architecture<br />
  10. 10. 3G Standard (IMT-2000)<br />IMT-SC* Single Carrier (UWC-136): EDGE<br />GSM evolution (TDMA); 200 KHz channels; sometimes called “2.75G”<br />IMT-MC* Multi Carrier CDMA: CDMA2000<br />Evolution of IS-95 CDMA, i.e. cdmaOne<br />IMT-DS* Direct Spread CDMA: W-CDMA<br />New from 3GPP; UTRAN FDD<br />IMT-TC** Time Code CDMA<br />New from 3GPP; UTRAN TDD<br />New from China; TD-SCDMA<br />IMT-FT** FDMA/TDMA (DECT legacy)<br />
  11. 11. 3G/UMTS<br />Universal Mobile Telecommunication System (UMTS) distandarisaioleh 3GPP<br />Teknologi W-CDMA (Wideband Code-Division Multiple Access)<br />Peningkatankecepatanaksessampai 384 kbps danterus<br />1920- 1980 Mhzuntuk down link, 2120-2180 Mhzuntuk up link<br />Using Wideband-AMR (Adaptive Multi-rate) for voice codec makes quality enchancement<br />
  12. 12. 3G/CDMA 2000 <br />Distandarisasioleh 3GPP2<br />CDMA2000 1x (IS-2000 and IS-856)<br />menggunakan 1.25 MHz, <br />data rates sampai 144 kbps (1X RTT)<br />
  13. 13. CDMA Evolution<br />
  14. 14. 3.5G<br />UMTS/HSDPA<br />3GPP Release 5<br />CDMA 1xEV-DO Revision B atau CDMA2000 3x<br />
  15. 15. 3.75G<br />UMTS/HSUPA/HSPA<br />3GPP Release 6<br />CDMA 2000 1X EV-DV (Evolution of Data Voice) atau CDMA Release C & D (EV-DV)<br />Tahun 2005 Qualcomm menghentikanpemengembangan EV-DV.<br />
  16. 16. GSM, UMTS, IMS and beyond<br />
  17. 17. GSM Architecture – Phase 1<br />
  18. 18. GSM Sub-System<br />Arsitektur GSM terdiridari 3 Sub-System yaitu:<br /> Mobile Station (MS) atauteleponselular<br />ME (IMEI) + SIM (IMSI)<br /> Base Station Sub-System (BSS) <br />mengontrolhubungan radio (radio link) dengan MS<br /> Network Sub-System (NS) atau Network Switching Sub System (NSS)<br /> Operation Sub-System (OSS)<br />
  19. 19. BTS<br />tranceiver yang mendefinisikansebuahsel (cell) <br />menanganihubungan radio link dengan MS (pemrosesansinyal, transimisinyal, encoding dan decoding suara)<br />berkomunikasidengan BSC menggunakanAter interface<br />
  20. 20. BSC<br />mengatur radio resource yang ditanganiolehsatu BTS ataulebih (RRM)<br />menangani radio-channel setup, frequency hopping, handover antar BSC<br />
  21. 21. MSC<br />perangkatdasar switching (call handling)<br />mengelola logical radio-link channel yang dibutuhkansaat call terjadi<br />mengelola signaling protocol antara MSC-BSS<br />mengatur inter-BSS atau inter-MSC handovers<br />mengumpulkan data untuk charging<br />sebuah MSC biasanyamenaganibanyak BSC<br />
  22. 22. AuC<br />Menyimpan parameter-parameter untukotentikasipelangganketikamenggunakanjaringan GSM, yaitu:<br />Authentication Keys (Ki), <br />Algoritma A3 <br />Algoritma A8<br />Menghasilkan 3 parameter otentikasi<br />Signed Response (SRES), <br />RAND, <br />CipherKey (Kc) <br />Parameter otentikasitersebutkemudiandisimpannyadi VLR<br />RAND = 128-bit random yang di-generate olehAuC<br />SRES = 32-bit one-way hash dari RAND danKi yang dikalkulasidenganAlgoritma A3<br />Kc = 64-bit dari RAND danKi yang dikalkulasidenganAlgoritma A8<br />
  23. 23. HLR<br />Menyimpan data pelanggan, secarapermanendiantaranya<br />IMSI, MSISDN<br />supplementary service yang digunakan<br />pembatasanlayanan (service restrictions)<br />informasitentanglayananteleservicesdan bearer <br />lokasiterkinidari MS untuk call routing<br />Beberapa data diupdatesecaraberkalamisalnyalokasi subscriber (VLR, Cell ID)<br />
  24. 24. VLR<br />VLR menyimpansementaradari<br />data pelangganlokalataupelanggan roaming (MSISDN, TMSI)<br />location area dimana MS teregister<br />copy data dari subscriber dari HLR<br />data yang digunakanuntukproses encryption <br />Men-generate MSRN <br />
  25. 25. GSM Architecture – Phase 2/2+<br />
  26. 26. Pembagian domain<br />SC Domain<br />PS Domain<br />
  27. 27. SGSN (Serving GPRS Support Node)<br />Penyimpansementara data subscriber (seperti VLR)<br />Mobility management (attach/detach, location update)<br />Otentifikasi, enkripsi<br />Logical link management, Tunneling<br />Routing packet (downlink)<br />Charging/Billing<br />
  28. 28. GGSN<br />Penghubungke external PS networks (internet ataujaringan X.25)<br />GTP Tunneling (menambahkanataumenghilangkan GTP dan layer protokoldibawahnya)<br />
  29. 29. Additional Elements<br />DNS Servers<br />WAP Gateway<br />Boarder Gateway<br />SMSC<br />MMSC<br />RBT Server<br />
  30. 30. UMTS Release 99<br />Difinalisasipadatahun 2000<br />GSM RAN (Radio Access Network) digantikan UTRAN (UMTS Radio Access Network), yaitu<br />Menggunakan WCDMA sebagai air interface, tapijugamendukung GSM/EDGE/GPRS radio-access network.<br />Pita frekuensi (bandwidth) yang lebihlebar<br />Macrodiversity, soft handover<br />UL/DL konfigurasi RAB yang lebihfleksibel<br />Dedicated and shared resource usage<br />Handovers dari/ke GSM<br />
  31. 31. UMTS Release 4<br />Hampirtidakadaperubahanpada FDD<br />Diperkenalkan Low ChipRate TDD<br />Mendukung MMS<br />Pemisahanantara user-plane (Transport) dan control-plane pada domain CS. <br />Pemisahantersebutdilakukandenganmemperkenalkanarsitektur Mobile Switching Server yaitumenggunakan MGW (Media Gateway) sebagaielemen yang mengatur user-plane dan MSS (Mobile Switching Server) sebagaielemen yang pengotrol MGW.<br />Domain CS dapatberbasis IP (tidaklagiharus TDM/ATM)<br />
  32. 32. UMTS R4 Architecture<br />
  33. 33. UMTS Release 5<br /> HSDPA menggunakan<br /> Hybrid Automatic Repeat Request (HARQ), <br /> link adaptation, <br />ordemodulasi yang lebihtinggiuntukmeningkatkanefisiensispektralyaitumenggunakan 16QAM<br /> Hybrid ARQ<br /> Turbo Codes<br /> Core network mengalamiperubahanyaituadanyaarsitektur IMS (IP Multimedia Solution) denganmemperkenalkanjaringan yang berbasis IP danelemen-elemenfungsionalbaru yang mendukung VoIP (Voice overIP) yang menggunakanprotokol SIP (Session Initiation Protocol).<br /> IP UTRAN (Layer 2 antara RNC dan GGSN tidakharusberbasis ATM)<br />
  34. 34. UMTS R5/IMS Architecture<br />
  35. 35. UMTS Release 6<br />HSUPA denganmenggunakan Enhanced Dedicated Channel (E-DCH) <br />Multicast and broadcast service menggunakan Multimedia Broadcast/Multicast Service (MBMS)<br />Extended location based services (LBS), with built in anonymization<br />PS streaming service with adaptation to available network resources (GERAN/GPRS, UTMS, WLAN)<br />DRM<br />Charging Management Framework (for extended payment system)<br />
  36. 36. UMTS Release 7<br />Disebutjuga HSPA+ atau HSPA Evolved<br />Ordemodulasi yang lebihtinggi (HOMs) <br />Multi-antenna techniques (MIMO)<br />Arsitektur RAN: "one tunnels solution" (OTS), mulaimenuju Flat Architecture<br />Optimasipada VoIP lewat HSPA<br />
  37. 37. 4G<br />IMT-Advanced<br />
  38. 38. UMTS Release 8 danselanjutnya<br />LTE<br />LTE-Advanced<br />
  1. A particular slide catching your eye?

    Clipping is a handy way to collect important slides you want to go back to later.
