PembahasanPadapraktikum                         kali                     ini                       kamimelakukanpengujianp...
Isolasimerupakantahappertamauntukmendapatkan           DNA      padaselsebelumdilakukan          prosesamplifikasiDNA deng...
karena yang diharapkanuntukdiamplifikasidisiniyaitu DNA babi.Probe merupakan primer yangdilabelolehpewarna (reporter) danp...
Padahasilanalisisujikeberadaan DNA babidengantekhnik PCR pada 10 jenissampel yangadatidakterdeteksiadanya DNA babipadasosi...
dicobadalamidentifikasiinisudahdapatdigunakandalampengujiancampuranprodukmakanandaging.Pendeteksiancemarandagingbabidengan...
Upcoming SlideShare
Loading in …5
×

pcr

248 views
208 views

Published on

Published in: Health & Medicine
0 Comments
0 Likes
Statistics
Notes
  • Be the first to comment

  • Be the first to like this

No Downloads
Views
Total views
248
On SlideShare
0
From Embeds
0
Number of Embeds
1
Actions
Shares
0
Downloads
3
Comments
0
Likes
0
Embeds 0
No embeds

No notes for slide

pcr

  1. 1. PembahasanPadapraktikum kali ini kamimelakukanpengujianpencemarandagingbabipadabeberapaprodukmakananolahan.Adapunsampelproduk yang kami ujiadalahsosisbabidanbeberapamereksosissapiantara lain sosis 222,sosisbesto, sosis champ, sosispedan, sosissozzis, sosissupertin, sosiskibit, sosisharmoni,sosisessen, dansosis basis. Pengujianinidilakukandenganmenggunakansuatualat Real Time PCR (Polimerase Chain Reaction).Polymerase Chain Reaction (PCR) merupakanreaksipenggandaan DNA menggunakanmesinthermal cycler (mesinPCR).Prinsipkerjaalatiniadalahdenganmenaikandanmenurunkantemperaturdalamperiodewaktutertentuuntukmendenaturasi DNA, menempelkan primer pada DNA (annealing)danmenggandakannya (elongasiatauekstensi). PCR sepertiinidisebut PCR konvensionalkarenaproses deteksidilakukan di akhir proses (end point) danhanyadapatmendeteksisecarakualitatif.PCR konvensionalmembutuhkan proses post-PCR berupaelektroforesismenggunakan agar rosedengankonsentrasitertentudandokumentasimenggunakan gel doc yang disambungkanke PCkomputer.Tetapidalampraktikum kali ini yang digunakanbukanlahsekedar PCR, melainkanReal-Time PCR.Real-Time PCR jumlah DNA yangdiamplifikasidapatlangsungdiamatisekeikasehinggatidakmemerlukananalisisdenganelektroforesis gel untukmengetahuihasil PCR. Real time PCR adalah PCR kuantitatifdengancaramendeteksifluorescence reporter yang dihasilkanselamareaksi PCR. Peningkatan signal fluorescencemerupakanindikatoramplifikasiproduk PCR disetiapsiklus PCR (real time), semakinbanyak DNAyang terbentuksemakintinggi pula intensitas fluorescent yang dihasilkan. Secarasederhana, RealTime PCR terdiridarimesin thermal cycler dandihubungkandengan software dan systemdetector optik.Bahan yang digunakandalam real time PCR samadenganbahan PCRkonvensionaltetapiditambahkandenganpewarna fluorescence yang biasadisebut probe ataureporter.Isolasi DNAdengan DNA Purification
  2. 2. Isolasimerupakantahappertamauntukmendapatkan DNA padaselsebelumdilakukan prosesamplifikasiDNA denganmenggunakanalat PCR.Prinsipisolasi DNA adalahmemisahkan DNAdarikomponenkomponensel lain. Isolasi DNA dariorganismeeukariotdilakukanmelaluiprosespenghancuranmembransel (lisis), pemusnahan protein dan RNA, danpemanenan DNA Prosesisolasiinidenganmenggunakan Maxwell Instrument,alatinihanyadapatdigunakanuntukisolasisampel yang mampudilisisoleh buffer danuntuk sampledarahdanjaringanhewan. Pertama – tama sampelsosismasing – masingditimbangsebanyak 50mg dandipotongkecil – kecil.Penyiapansampel kali inidilakukandenganmenggunakan disposablecartridge yang didalamnyaterdapatsumur – sumur yang mengandunglisis buffer, magneticgenomic, dan wash buffer dandilengkapidengan plunger.Sampeldiletakkanpada well #1Proses ekstraksiterdiridari 4 tahapanyaitu: Proses pemecahansel (lisis),Pengikatan DNA atauRNA (binding), Pencucian (washing), Pelarutan (elution). Prosesekstraksiinidilakukandenganmenggunakansuatualat Maxwell Purifikasi DNA. Pertama – tamaseldilisisdenganmenggunakanlisis buffer, lalu DNA diikatoleh magnetic genomic yangberadadalambentuksuspensidandicucioleh wash buffer yang terdiridari isopropanol,guanidintiosianatdanetanol, laluhasilakhirdilarutkandenganmenggunakan elution buffer (TrisEDTA/TrisAsetat EDTA).Amplifikasi DNASebelum proses amplifikasimenggunakan Real- Time PCR,terlebihdahuludilakukanpencampuranreaksimastermixuntukamplifikasi. Yang terdiridari primerforward dan primer reverse, probe yang digunakansebagaipenanda, tag polymeraseyagberupaenzim, ddH2O, dan DNA template. Primer SpesifikBabi, primer adalahsepasang DNAuntaitunggalatauoligonukleotidapendek yangmenginisiasisekaligusmembatasireaksipemanjanganrantaiataupolimerisasi DNA. PCRhanyamampumenggandakan DNA padadaerahtertentusepanjangmaksimum 1000bpsaja.Primer dirancang agar menempelmengapitdaerahtertentu yang diinginkan.Primerterdirisepasang, yaitu reverse dan forward.Kali ini primer yang dipakaiyaitu primer spesifikbabi,
  3. 3. karena yang diharapkanuntukdiamplifikasidisiniyaitu DNA babi.Probe merupakan primer yangdilabelolehpewarna (reporter) danperedampewarna (quencher).Probe padareal-time PCRdigunakansebagaipewarnapendeteksiadanyasinarfluoresen yang ditangkap.Enzim DNApolimerase (Tag DNA polimerase), yang merupakanenzim yang berasaldari Thermos aquitusyang stabilterhadappanas. Enzim yang digunakandisiniadalahenzim LC 480, dNTP(DeoxynucleotideTriphosphat), yang merupakanbahanbakupenyusun DNA baru, terdiridari 4macamsesuaidenganbasapenyusun DNA, Buffer yang merupakanbahankimiatertentu yangberfungsiuntukmengkondisikanreaksi agar berjalan optimum danmenstabilkanenzim DNApolymerase. Dan volume pencampuranmengacupadapenelitiansebelumnya.Selama mixingharustetapberadapada ice box karenaharusbekerja di suhu yang rendah agarenzimtidakrusakatautidakterdenaturasi.Prose amplifikasi DNA dilakukandenganmenggunakan Real-Time PCR. Sehingga prosesamplifikasidapatterlihat, adapuntahapan – tahapandalamamplifikasi DNA iniadalah: Pre-incubation, yaitu proses penyiapanalatuntukmencapaisuhudenaturasi 95oC; amplifikasi yangterdiridariDenaturasi, yaitu proses dimanakeduauntai DNA terbukamenjadiuntaitunggal,dandisini yang digunakanadalahsuhu 95oC; Annealing, padasaatiniterjadipenempelan primerpada DNA yang rantainyatelahterbukadanterjadipadasuhu yanglebihrendahdarisuhudenaturasi, yaitu 60oC; Elongasipadasuhu 720C; dan Cooling dengansuhu40oC.
  4. 4. Padahasilanalisisujikeberadaan DNA babidengantekhnik PCR pada 10 jenissampel yangadatidakterdeteksiadanya DNA babipadasosis– sosistersebutdantentusajaterdeteksiadanyaDNA babi primer spesifikbabi.Spesifikasi primer gen babi yangdigunakandalampraktikuminidibuktikandengandigunakannyadagingsapisegarsebagaikontrolnegatifdandagingbabisegarsebagaikontrolpositif.Hasilidentifikasiinidivisualisasisecarasimultanselama proses amplifikasi, karena yangdigunakanadalah Real time PCR danmenggunakan probe,sehinggamemberikanpewarnaanflourencensejikaterjadiamplifikasi.Kenaikankurvapadareal-timePCR menandakanterjadinyaamplifikasi DNA.Amplifikasiterjadiketikaterjadinyapenempelanprimer dan probe pada DNA template. Saatterjadipenempelan primer, DNApolimeraseakanmemperpanjangpenempelandNTPpada DNA templatehinggabertemudenganprobe. Aktifitasnukleaseakanmemecah probe dan probe yangterpisahakanmenyebabkansinyalfluoresenreporter tidaklagidiredam, sehinggareporterakanmemancarkansinyalfluoresensaattereksitasilalumengemisikanfluoresendanmasukkedetektoruntukmemberikankurva.Dimanapadavisualisasiterlihatbahwasanyadagingsapisegartidakteramplifikasi, sedangkandagingbabisegarteramplifikasidenganadanyakenaikan pita pada kitdagingbabisegar. Pada primerbabimenunjukkanterjadinyaamplifikasidenganditunjukkandenganmulaiadanyakenaikanpada CPsekitar 14.Sedangakanpadakesepuluhsosis yang diujitidakterjadikenaikan pita.Halinimenunjukkanhasil yang negative DNAbabi.Padahasilnegatifpadasampelsosisinikemungkinandikarenakansampel yangmemangmurniterdiridaridagingsapi,jugadapatdikarenakansampelprodukolahanadalahprodukdalamnegeri, bukanprodukimport.Selainitujugatidakbanyaksampel yang digunakandalampraktikumini,danjugakemungkinankarenatahapanpreparasaisampel (isolasi DNA) yang kurangcermat,ataupunjugakarenaterlalusedikitnyakandungan DNA yangdiinginkanuntukdiamplifikasidalamsampelsosissehinggatidakteramplifikasidalamPCR.Namundemikianprosedur yang
  5. 5. dicobadalamidentifikasiinisudahdapatdigunakandalampengujiancampuranprodukmakanandaging.Pendeteksiancemarandagingbabidenganamplifikasi DNAmemanglebihefisiendibandingkandenganteknikimunologidankromatografi yang menggunakanprotein ataulemak.Karena proteindanaktifitasbiologilainnyaakanberhentisetelahorganismetersebutmatikecualikarakteristiknyayang masihtersimpandidalam sel. ProteinjugamemilikisifattermolabilsehinggauntukanalisisidentifikasiorganismelebihdisarankandenganpengujianDNAOlehkarenaitu, padapraktikuminidigunakantekhik PCRuntukidentifikasiadanyakandungandagingdalamprodukolahan.Kesimpulan 1. Real Time PCR dapatdigunakanuntukidentifikasikemungkinanadanyapencampurandaginglain (babi) padaprodukdagingsapiatauayam. 2. Pada Real Time PCR proses amplifikasidapatterlihatdenganditunjukkannyaintensitas fluorescent. 3. Berdasarkankurvaamplifikasi DNA menggunakan real-time PCR, terbuktibahwaproduksosissapi yang diujimasihsesuaidenganbahanasal yang digunakantanpakontaminasidagingbabi

×