Wyklad habilitacyjny biologia systemowa
Upcoming SlideShare
Loading in...5
×

Like this? Share it with your network

Share
  • Full Name Full Name Comment goes here.
    Are you sure you want to
    Your message goes here
    Be the first to comment
    Be the first to like this
No Downloads

Views

Total Views
1,354
On Slideshare
1,351
From Embeds
3
Number of Embeds
2

Actions

Shares
Downloads
7
Comments
0
Likes
0

Embeds 3

https://www.linkedin.com 2
http://www.linkedin.com 1

Report content

Flagged as inappropriate Flag as inappropriate
Flag as inappropriate

Select your reason for flagging this presentation as inappropriate.

Cancel
    No notes for slide
  • \n
  • \n
  • \n
  • \n
  • \n
  • \n
  • \n
  • \n
  • \n
  • \n
  • \n
  • \n
  • \n
  • \n
  • \n
  • \n
  • \n
  • \n
  • \n
  • \n
  • \n
  • \n
  • \n
  • \n
  • \n
  • \n
  • \n
  • \n
  • \n
  • \n
  • \n
  • \n
  • \n
  • \n
  • \n
  • \n
  • \n
  • \n
  • \n
  • \n
  • \n
  • \n
  • \n
  • \n
  • \n
  • \n
  • \n
  • \n
  • \n
  • \n
  • \n
  • \n
  • \n
  • \n
  • \n
  • \n
  • \n
  • What is the goal of the DARPA SyNAPSE project?\nThe goal of the DARPA SyNAPSE program is to create new electronics hardware and architecture that can understand, adapt and respond to an informative environment in ways that extend traditional computation to include fundamentally different capabilities found in biological brains. \nWho is on your SyNAPSE team?\nStanford University: Brian A. Wandell, H.-S. Philip Wong\nCornell University: Rajit Manohar\nColumbia University Medical Center: Stefano Fusi\nUniversity of Wisconsin-Madison: Giulio Tononi\nUniversity of California-Merced: Christopher Kello\nIBM Research: Rajagopal Ananthanarayanan, Leland Chang, Daniel Friedman, Christoph Hagleitner, Bulent Kurdi, Chung Lam, Paul Maglio, Stuart Parkin, Bipin Rajendran, Raghavendra Singh \n
  • \n
  • \n

Transcript

  • 1. BIOLOGIA SYSTEMOWA I SYNTETYCZNAOD WIEDZY SZCZEGÓŁOWEJ DO MODELU WIELO-SKALOWEGO DARIUSZ PLEWCZYŃSKI D.PLEWCZYNSKI@ICM.EDU.PL CENTRUM MODELOWANIA MATEMATYCZNEGO I KOMPUTEROWEGO UNIWERSYTET WARSZAWSKI
  • 2. Celem jest zrozumienie biologii Jak? Przez analizę komponentów, modułów, elementów z których zbudowany jest żywy organizm Biologia Organizm Genom Geny BiałkaInformacja rośnie bardzo szybko!
  • 3. Jest to interdyscyplinarne podejście, które traktuje system jako zestaw oddziałujących elementów, stosowany często do biologi, cybernetyki i innych dziedzin wiedzy. Głównym celem jest badanie ogólnych zasad rządzących ALLGEMEINE SYSTEMTHEORIE funkcjonowaniem dowolnego systemu, tak żeby móc zastosować je w przypadku różnych typów układów złożonych. Początki: General Systems Theory (GST) zaproponowana w książce "General System theory: Foundations, Development, Applications" by Bertalanffy, 1968“...there exist models, principles,and laws that apply to generalizedsystems or their subclasses,irrespective of their particular kind,the nature of their componentelements, and the relationships or"forces" between them. It seemslegitimate to ask for a theory, not ofsystems of a more or less specialkind, but of universal principlesapplying to systems in general”. Bertalanffy, 1968
  • 4. CO ZNAJDZIEMY W KOMÓRCE?Neidhardt and Umbarger chapter 3 in Neidhardt F.C. Escherichia coli andSalmonella: Cellular and Molecular Biology. Vol 1. ASM Press 1996. table 1
  • 5. TROCHĘ STATYSTYKI: E. COLINumber of cell walls/cell 1Number of membranes/cell 2Number of chromosomes/cell 2.3 (at mid log phase) Number of genes 4606Number of mRNA/cell 4000Number of rRNA/cell 18,000 RNA polymerase molecules per cellNumber of tRNA/cell 200,000 1500-11400Number of all RNA/cell 222,000Number of polysaccharides/cell 39,000 Number of proteins/mRNA ~540 proteins/Number of murein molecules/cell 240,000-700,000 mRNANumber of lipopolysaccharide/cell 600,000Number of lipids/cell 25,000,000 Number of all proteins in average cell ofNumber of all lipids/cell 25,000,000 E. coli B/r at 37° celsius in aerobic glucoseNumber of phosphatidylethanolamine 18,500,000Number of phosphatidylglycerol 5,000,000 with a 40 minute mass doubling time 2.35eNumber of cardiolipin 1,200,000Number of phosphatidylserine 500,000 +6Number of LPS (MW = 10kD) 600,000 Number of metabolites per cell ~3e+8Average SA of lipid molecule 25 Ang2Fraction of lipid bilayer=lipid 40% Copies/cellFraction of lipid bilayer=protein 60%Number of outer membrane proteins 300,000 Number of water molecules per cell 2e+10Number of porins (subset of OM) 60,000 Number of cells in human body (HumanNumber of lipoproteins (OM) 240,000Number of inner membrane proteins 200,000 Homo sapiens) ~1e+13Number of nuclear proteins 100,000Number of cytoplasmic proteins 1,000,000 (excluding ribo proteins)Number of ribosomal proteins 900,000Number of periplasmic proteins 80,000Number of all proteins in cell 2,600,000Number of external proteins (flag/pili) 1,000,000Number of all proteins 3,600,000 http://redpoll.pharmacy.ualberta.ca/CCDB
  • 6. CZYM JEST BIOLOGIA SYSTEMÓW?Dziedzina interdyscyplinarna która bada złożoneoddziaływania w systemach żywych.Nowa perspektywa: holizm zamiast redukcjonizmuCelem: studiowanie oddziaływań międzybiomolekułami, oraz tego jak oddziaływania teprowadzą do zjawisk emergentnych, takich jakfunkcja i zachowanie systemu biologicznego.
  • 7. DENIS NOBLE Oxford Press
  • 8. DENIS NOBLE“Systems Biology is an idea in search of a definition.(...) It is an approach rather than a subject. DenisNobles work is one of the clearest examples of thesystems approach in practice since it reveals thenature of some of the forms of downwardcausation in multilevel analysis. The story willdelight readers who like to see how scientificcontroversy is resolved, since many of thedevelopments described in each chapter were highlycontroversial when they occurred.” Oxford Press
  • 9. CZYM JEST BIOLOGIA SYSTEMÓW?“Integrate data from multiple levels of thebiological information hierarchy in anenvironmental and evolutionary contextand pay particular attention to dynamicprocesses that vary in time and space” NIGMS, 2007
  • 10. INTEGRACJA DANYCH Biologia systemowa jest związana z możliwością zebrania i analizy złożonych danych masowych z wielu źródeł danych jednocześnie, przy użyciu narzędzi interdyscyplinarnych. Dodatkowo związana jest z identyfikacją i oceną każdego z typu biomolekuł, ich dynamiką i oddziaływaniami w komórce żywej. Genomics TranscriptomicsInteractomics Epigenetics Interferomics Translatomics Metabolomics Glycomics Proteomics perturbation methods Biomics Lipidomics Phenomics Fluxomics high-throughput techniques wikipedia
  • 11. ZBLIŻAJĄC SIĘ DO PEŁNEGO OBRAZU“A quantitative data set of RNA, proteins,and metabolites provides an unprecedentedstarting point to understand, at a systemslevel, the effects of perturbations on a cell.” Sauer U. et al., Science, 2007
  • 12. AGENCI (AKTORZY)Metabolities Proteins Genes Sauer U. et al., Science, 2007
  • 13. ORAZ ICH ODDZIAŁYWANIADo niektórych oddziaływań molekularnychistotnych dla funkcjonowania komórki: białko-DNA, białko-białko, białko-kompleksy,metaboliczne i funkcjonalne interakcje międzygenami. Wszystkie razem, oddziaływania tetworzą Interaktom, analogicznie do genomu,transktyptomu, proteomu oraz metabolomu. BioZoom nr. 2, 2007
  • 14. ZATEM: OD SUMY PUNKTÓW DO SIECIReprezentacja sieciowa jednej z części ludzkiegosystemu metabolicznego. Metabolity sąpokazane jako żółte węzły, enzymy oznaczone sąna czerwono/zielono w zależności od tego czywzmacniają czy wyciszają odpowiednie geny. BioZoom nr. 2, 2007
  • 15. Zaburzenia genetyczne skutkują małymi zmianami koncentracji mRNA oraz białek. Poziom metabolitów jest stabilny, co pokazuje możliwość przekierowywania procesów w sieci metabolicznej. ANALIZA WIELSKO-SKALOWA E. coli aktywnie reguluje poziomy enzymów w celu podtrzymania stabilności stanu metabolicznego w odpowiedzi na zmiany szybkości wzrostu. Pałeczka okrężnicy wykorzystuje komplementarne strategie regulacyjne, dzięki którym jej sieć metaboliczna jest odporna na dowolny typ zaburzeń. Pomiar części składowychkomórki jednocześnie wwielu skalach przetwarzaniaumożliwia wyciaganieciekawych wnioskówbiologicznych. Wi e l o k r o t n e m a s o w epomiar y reakcji komórekEscherichia coli nazaburzenia genetyczne iśrodowiskowe. Ishii et al., Science, 2007
  • 16. Piramida złożoności życia jest zbudowana z wielu komponentów molekularnych, takich jak geny, RNA, białka i metabolity. Te podstawowe elementy budujące organizują się w małe, powtarzalne połączenia, nazywane ścieżkami w metaboliźmie, czy też motywami w sieciach regulacji genetycznej. Następnie, ścieżki i motywy są łączone w funkcjonalne moduły, tj. grupy węzłów (np. białka i metabolity), PIRAMIDA ZŁOŻONOŚCI ŻYCIA które są odpowiedzialne za dyskretne funkcje biologiczne. Moduły te są połączone hierarchicznie i definiują wielko-skalową funkcjonalną organizację komórki żywej.W POSZUKIWANIU METAFORY DLA BIOLOGI SYSTEMÓW Oltvai and Barabási, 2002
  • 17. SYSTEMOWA ANALIZA UKŁADÓW ŻYWYCH Struktura systemu: obejmuje sieci oddziaływań między genami,ścieżki biochemiczne, oraz mechanizmy które wykorzystują takiesieci do zmiany fizycznych własności wewnątrz- i zewnątrz-komórkowych struktur. Dynamika systemu: opisuje jak system zachowuje się w czasie ,może być zrozumiana przez analizę metabolizmu, wrażliwości nazaburzenia, analizy dynamiczne, przez wykorzystanie metod fizyki(przestrzeń stanów, bifurkacje), oraz przez identyfikacjęmechanizmów odpowiedziałnych za zaobserwowane zachowanie. Metody kontroli: systematycznie kontrolują stan komórki, takżeby zminimalizować nieprawidłowości, typowo wykorzystywanew projektowaniu leków jako cele terapeutyczne. Metody projektowania: sposoby modyfikacji i budowysystemów biologicznych o zadanych cechach, w celu opracowaniametodologii i zasad tworzenia syntetycznych procesów zamiastmetody prób i błędów. Kitano, 2002
  • 18. JĘZYK JAKO METAFORA BIOLOGII SYSTEMOWEJ
  • 19. POZDRÓŻ OD POJEDYNCZYCH LITER DO CAŁYCH ZDAŃ A WIĘC OD SZCZEGÓŁU DO WIEDZY OGÓLNEJ!
  • 20. LITERY: AMINOKWASYC e c h y f i z y ko - c h e m i c z n e p o j e d y n c z y c haminokwasów wpływają na własności całego białka.
  • 21. STRUKTURA DRUGORZĘDOWA Conf:>1A02_PANTR, Eukaryota, signal Pred:peptides: 1-24 Pred: CCCCCHHHHHHHHHHHHHCCCCCCCEEEEEEEEEEECCCC AA: MQVTAPRTVLLLLSAALALTETWAGSHSMKYFYTAVSRPGMQVTAPRTVLLLLSAALALTETWAGSHSMKYFYTA 10 20 30 40VSRPGRGEPRFISVGYVDDTQFVWFDSDAASPREE Conf:PRAPWIEQEGPEYWDRETQISKTNAQTYRESLRNL Pred:RGYYNQSEAGSHIIQRMYGCDMGPDGRLLRGYEQY Pred: CCCCEEEEEEEECCEEEEEECCCCCCCCCCCCCCCCCCCCAYDGKDYIALNQDLSSWTAADTAAQITQRKWEA AA: RGEPRFISVGYVDDTQFVWFDSDAASPREEPRAPWIEQEG 50 60 70 80ARWAEQLRAYLEGTCVEWLRRYLENGKETLQRADPPKTHVTHHPISDHEATLRCWALGFYPAEITLTWQR Conf:DGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEE Pred: Pred: CCHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCEEEEQRYTCHVQHEGLPKPLTLRWEPSSQSTIPIVGIVA AA: PEYWDRETQISKTNAQTYRESLRNLRGYYNQSEAGSHIIQGLAVLAVVVIGAVVAAVMCRRKSSGGKGGSYSQ 90 100 110 120AASSDSAQGSDVSLTA Conf: Pred: Pred: EEECEEECCCCCEEEEEEEEEECCCCCEECCCCCCCCCCC AA: RMYGCDMGPDGRLLRGYEQYAYDGKDYIALNQDLSSWTAA 130 140 150 160 Conf: Pred: Pred: HHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHCCC Przewidywanie struktury drugorzędowej jest kluczowe w AA: DTAAQITQRKWEAARWAEQLRAYLEGTCVEWLRRYLENGK 170 180 190 200 zrozumieniu repertuaru struktur białek, oraz pełnionych przez Conf: Pred: nich funkcji biologicznych. Pred: CCCCCCCCCCCEEECCCCCCCCEEEEEEECCCCCCCCEEE AA: ETLQRADPPKTHVTHHPISDHEATLRCWALGFYPAEITLT 210 220 230 240 Przewidywanie struktury drugorzędowej dla nowych białek przy Conf: użyciu ich sekwencji aminokwasowej ma fundamentalne Pred: Pred: EEECCCCCCCCCCCCCCCCCCCCCCEEEEEEEECCCCCCC znaczenie w bioinformatyce. AA: WQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQR 250 260 270 280 Lokalna regularność strukturalna okazała się być bardzo owocnym paradygmatem opisu całego białka. wikipedia
  • 22. KRÓTKIE CIĄGI LITER: LINIOWE MOTYWY FUNKCJONALNEBiałka nabywają pewnych cechmolekularnych aby wykonywać procesybiologiczne w komórce:nieodwracalne modyfikacje(eg. proteolityczne rozdzielanie)odwracalne modyfikacje(eg. fosforylacja, metylacja, acetylacja,...)Fosforylacja: kluczowa dla regulacjiprocesów biologicznych, takich jakmetabolizm, apoptoza, różnicowanie,podziałTypowo modyfikowane są 3 aminokwasy wkinazach białkowych: seryna, treonina,tyrozynaMechanizm rozpoznania substratu dlaróżnych kinaz może być podobny:podobne domeny katalityczne,7-12 fragmenty białek w miejscuaktywnym kinazy stressgen.com, 2005
  • 23. #PP: posterior probability. The degree of confidence in each individual aligned res HMM. Columns are coloured according to the posterior probability 0% 100% means 0-5%, 1 means 5-15% and so on; 9 means 85-95% and a * mean You can bookmark this page and return to it later, but please use the URL that you can find in the "Search options" section below. Please note that old results may be removed after one week. posterior probability We found 4 Pfam-A matches to your search sequence (3 significant and 1 insignificant) but we did not find any Pfam-B matches. #SEQ: query sequence. A - indicate deletions in the query sequence with respect Show the search options and sequence that you submitted. BIAŁKA WIELODOMENOWE:according to the posterior probability HMM. Columns are coloured SŁOWA SĄ ZŁOŻONE Return to the search form to look for Pfam domains on a new sequence. Significant Pfam-A Matches 0% 100% Show or hide all alignments. Envelope Alignment HMM Predicted Entry Bit E- Show/hide Family Description Clan active You can bookmark this page and return to it later, but please use the URL that you can type Start End Start End From To score value alignment sites Class I>1A02_PANTR, Eukaryota, signalpeptides: 1-24"Search options" section below. Please1 and 2 note that old203 25 203 1 may be removed after one w results 179 322.9 97 n/a Histocompatibility 2.9e- MHC_I Domain CL0343 25 antigen, domains alphaMQVTAPRTVLLLLSAALALTETWAGSHSMKYFYTA Immunoglobulin 2.3e- We found 4 Pfam-A matches to C1-set C1-set domain Domain CL0011 210 295 219 294 significant and 1 insignificant)VSRPGRGEPRFISVGYVDDTQFVWFDSDAASPREE your search sequence (3 7 82 72.0 3.6e- n/a MHC_I C- 20PRAPWIEQEGPEYWDRETQISKTNAQTYRESLRNL MHC_I_C Family n/a 336 362 337 362 2 27 45.2 n/a not find any Pfam-B matches. Insignificant Pfam-A MatchesRGYYNQSEAGSHIIQRMYGCDMGPDGRLLRGYEQY terminus 12 Show or hide all alignments.AYDGKDYIALNQDLSSWTAADTAAQITQRKWEA Envelope Alignment HMM PredictedARWAEQLRAYLEGTCVEWLRRYLENGKETLQRADP Entry Bit E- Show/hide Family Description Clan active type Start End Start End From To score value alignment sitesPKTHVTHHPISDHEATLRCWALGFYPAEITLTWQR Neogenin C- Neogenin_C Family n/a 286 359 300 356 19 70 11.9 0.066 n/aDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWEPSSQSTIPIVGIVA options and sequenceComments or questions on the site? Send a mail to pfam-help@sanger.ac.uk Show the search that you submitted. terminus The Wellcome TrustGLAVLAVVVIGAVVAAVMCRRKSSGGKGGSYSQ Return to the search form to look for Pfam domains on a new sequence.AASSDSAQGSDVSLTA Anotacja biologiczna foldów białkowych dla sekwencjonowanych genomów http://pfam.sanger.ac.uk/search/sequence Page 1 of 1 Significant Pfam-A Matches jest celem quasi-automatycznych wielko-skalowych metod in silico przewidywania struktury. Show or hide all alignments. Envelope Alignment Jednak metody te w większości wypadków umożliwiają przewidywanie HMM Entry Bit Family struktury trójwymiarowej dla białek jednodomenowych. Description Clan type Start End Start End From To score Metody te nie potrafią analizować bardziej złożonych struktur białkowych, Class I dlatego białka (np. ludzkie) powinny być najpierw podzielone na pojedyczne Histocompatibility domeny. Każda z tych domen jest następnie poddawana analizie MHC_I Domain CL0343 25 203 25 203 1 179 322.9 antigen, domains podobieństwa sekwencyjnego, jak również przewidywaniu struktury trójwymiarowej. 2 alpha 1 and Immunoglobulin C1-set Dopiero później możliwa jest analiza strukturalna całości biomolekuły i 82 Domain CL0011 210 295 219 294 7 72.0 C1-set domain przyporządkowanie jej funkcji biologicznej. MHC_I C- MHC_I_C Family n/a 336 362 337 362 2 27 45.2 terminus
  • 24. A ZATEM PROBLEM Z KONTEKSTEM SŁÓW: STRUKTURA TRÓJWYMIAROWAStruktura trójwymiarowa białek jest bardzokonserwowana w trakcie ewolucji.Analiza podobieństwa struktur pozwala na znalezienieokoło dwa razy więcej odległych podobieństw niż wprzy padku wykorzystania wyłącznie informacjisekwencyjnej.Dalekie podobieństwo pozwala łączyć białka bardzozróżnicowane sekwencyjnie.Dlatego też uliniowienie strukturalne pozwoliło nalepsze zrozumienie relacji ewolucyjnych międzybiałkami. Dzięki wykorzystaniu str ukturalnejklasyfikacji białek, pojęciu rodzin białkowych, możemylepiej zrozumieć funkcję biologiczną foldów, całychbiałek.
  • 25. ZNACZENIE SŁÓW: OD SEKWENCJI/STRUKTURY DO FUNKCJI BIOLOGICZNEJSequence Structure Function>1PKN:A|PDBID|CHAIN|SEQUENCESKSHSEAGSAFIQTQQLHAAMADTFLEHMCRLDIDSAPITARNTGIICTIGPASRSVETLKEMIKSGMNVARMNFSHGTHEYHAETIKNVRTATESFASDPILYRPVAVALDTKGPEIRTGLIKGSGTAEVELKKGATLKITLDNAYMAACDENILWLDY RABBIT MUSCLEKNICKVVEVGSKVYVDDGLISLQVKQKGPDFLVTEVENGGFLGSKKGVNLPG PYRUVATE KINASEAAVDLPAVSEKDIQDLKFGVDEDVDMVFASFIRKAADVHEVRKILGEKGKNIKIISKIENHEGVRRFDEILEASDGIMVARGDLGIEIPAEKVFLAQKMIIGRCNRAGKPVICATQMLESMIKKPRPTRAEGSDVANAVLDGADCIMLSGETAKGDYPLEAVRMQHLIAREAEAAMFHRKLFEELARSSSHSTDLMEAMAMGSVEASYKCLAAALIVLTESGRSAHQVARYRPRAPIIAVTRNHQTARQAHLYRGIFPVVCKDPVQEAWAEDVDLRVNLAMNVGKAAGFFKKGDVVIVLTGWRPGSGFTNTMRVVPVP
  • 26. CAŁE ZDANIA? KOMPLEKSYRozwój technik przewidywania struktury trójwymiarowej z sekwencjiaminokwasowej białek.Użycie informacji strukturalnej do przewidywania: Funkcji biochemicznej Partnerów oddziaływania Ścieżek
  • 27. OD POJEDYNCZYCH ZDAŃ DO CAŁEGO TEKSTU: BIOLOGIA SYSTEMOWA I SYNTETYCZNA
  • 28. CENTRALNY DOGMAT BIOLOGII MOLEKULARNEJ EGF pathway, 2008
  • 29. CENTRALNY DOGMAT BIOLOGII MOLEKULARNEJ EGF pathway, 2008
  • 30. ZDANIA BUDUJĄ CAŁY INTERAKTOM Ścieżki ŚcieżkiSygnałowe MetaboliczneOddziaływania molekularne między białkami imałymi cząsteczkami chemicznymi pełniąkluczową rolę w wielu procesach biologicznych.
  • 31. INTERAKTOM STATYCZNY Wyzwanie zbudowania kompletnego zestawu oddziaływań obecnych w żywej komórceInterakcje między białkami t worzą tylko jedną część interaktomu,druga związana jest z oddziaływaniami z innymi biopolimerami(DNA/RNA), dużymi cząsteczkami tłuszczów, oraz małymimetabolitami - dopiero razem t worzą pełny, funkcjonalny model. INTERAKTOM DYNAMICZNY Drugim wyzwaniem jest charakteryzacja efektów dynamicznych dla interaktomuInteraktom jest statyczną, dwu-wymiarową reprezentacjąponieważ oddziaływania nigdy nie dzieją się równocześnie w tymsamym miejscu i w tym samym momencie.Przestrzenne i czasowe dane doświadczalne są więc niezbędne tozrozumienia GDZIE i KIEDY oddziaływania się realizują w żywejkomórce. Lars Jensen and Peer Bork; Science 322, 56-57 (2008)
  • 32. BIOLOGIA SYSTEMOWA W PRAKTYCE1. Zdefiniuj wszystkie elementy budującesystem.2 . S y s te m a t y c z n i e z a b u r z a j k a ż d y zelementów i obserwuj reakcję systemu.3 . S t a r a j s i ę p o g o d z i ć o b s e r wo w a n edoświadczalnie zjawiska z tymiprzewidywanymi przez Twój model.4. Zaprojektuj i przeprowadź nowe typydoświadczeń analizy zaburzeń w celuodróżnienia wielu wykluczających sięmodeli i hipotez. Ideker et al., 2001
  • 33. WERYFIKACJA DOŚWIADCZALNA Kitano, 2002
  • 34. JEZYK JAKO NOŚNIK INFORMACJI
  • 35. CENTRALNOŚĆ STEROWANIA?“Systems biology is about putting togetherrather than taking apart, integration ratherthan reduction. It starts witch what we havelearned from the reductionist approach; andthen it goes further”Wymagana jest inna droga myślenia ointegracji, podobnie rygorystyczna jakpodejście redukcjonistyczne, ale inna.Oznacza to zmianę podejścia, filozofi opisusystemu biologicznego. Noble D., 2006
  • 36. WSZYSTKO TO JEST O NASZYCH BIO-AGENTACH KTÓRE NIE SĄ STEROWANE CENTRALNIE“There are no privileged components tellingthe rest what to do”Ni e i s t n i e j e p r o g r a m , k t ó r y k i e r u j esystemem biologicznym, zarówno jegorozwojem jak i funkcjonowaniem.Genom, nie jest programem, ale raczejpasywną bazą danych, jednym z wieluczynników określających rozwój i dynamikężywego organizmu. Dopiero oddziaływaniawielu czynników opisują zachowanie całości. Noble D., 2006
  • 37. STRATEGIE ROZWOJUGenomy funkcjonują raczej jak strategie,które ukierunkowują działanie agentówbiologicznych (biomolekuł) w miarę jaksystem się rozwija.Takie strategie, lub programy mogą równieżwchodzić w interakcje z otoczeniem,środowiskiem zewnętrznym (np. z agentamiinnych komórek) na każdym etapie rozwoju. Werner, E., 2007
  • 38. ROZPROSZONE PRZETWARZANIE DANYCHKo n c e p c j a v o n Ne u m a n n a s a m o -reprodukujących się automatów, któreposiadają możliwość samo-konstrukcjiwłasnej kopii, przy użyciu zestawu instrukcji(które także są kopiowane do potomka).Inaczej jest w komórkach żywych, gdziegenomy zachowują się raczej jakrozproszeni agenci przetwarzający impulsyinformacyjne, nie zaś samo-reprodukującesię automaty implementujące architekturęvon Neumanna. Werner, E., 2007
  • 39. BIOLOGIA JAKO NAUKA O PRZETWARZANIU INFORMACJI W UKŁADACH ŻYWYCHSystemy biologiczne są zbudowane z dwóchty pów informacji: genów kodującychbiomolekuły, które wykonują procesybiologiczne, oraz sieci regulacyjne, któreokreślają jak i które geny są aktywne. Ideker at al., 2001
  • 40. Informacja biologiczna jest hierarchiczna:DNA → mRNA → protein → proteininteractions → informational pathways →informational networks → cells → tissues ornetworks of cel ls → an organism →populations → ecologies
  • 41. Informacja biologiczna jest hierarchiczna:DNA → mRNA → protein → proteininteractions → informational pathways →informational networks → cells → tissues ornetworks of cel ls → an organism →populations → ecologies... i zmienia się w czasie.DNA → mRNA → protein → proteininteractions → informational pathways →informational networks → cells → tissues ornetworks of cel ls → an organism →populations → ecologies
  • 42. INFORMACJA BIOLOGICZNAInformacja w biologii ma kilka ważnychcech:■ Oper uje na wielu hierarchicznychpoziomach organizacji.■ Jest przetwarzana w złożonych sieciach.■ Sieci informacyjne są stabilne, odporne nazaburzenia, wiele pojedynczych zaburzeńnie wpływa na nie znacząco.■ W tych sieciach są wyróżnione węzły,których zaburzenie ma duży wpływ nacałość organizmu, właśnie te węzły stanowiąnajciekawsze cele do zrozumienia i kontrolicałego systemu. Ideker at al., 2001
  • 43. INFORMACJA ANALOGOWAKomórka zawiera informację analogową,podczas gdy genom zawiera informacjędyskretną.Ponieważ analogowa informacja jest ciągła,ż y w a ko m ó r k a z a w i e r a p o te n c j a l n i enieskończenie wiele informacji, znaczniewięcej niż skończona ilość informacjidyskretnej zapisane w genomie.Jednak należy rozważyć ważność, istotnośćtakiej informacji! Noble D., 2006
  • 44. BIOLOGIA SYSTEMOWA BIOLOGIA SYNTETYCZNA
  • 45. BIOLOGIA SYNTETYCZNA
  • 46. BIOLOGIA SYNTETYCZNA Nowa dziedzina łącząca badaniabiologiczne oraz nauki inżynieryjne. Łączy ona wiele różnych podejść,metodologii oraz dyscy plinnaukowych. C e l e m j e s t p r o j e k to w a n i e itworzenie nowych biologicznychfunkcji i systemów nie istniejących wnaturze.
  • 47. ZASADA: SZYBKO, TANIO I MNIEJ-WIĘCEJ KONTROLOWALNIE Arkin & Fletcher, 2006
  • 48. ZASADA: SZYBKO, TANIO I MNIEJ-WIĘCEJ KONTROLOWALNIEZasady inżynieri: hierarchia abstrakcja projektCel:kontrola organizmu żywegoPotrzebne: modularność standarty skalowanie Arkin & Fletcher, 2006
  • 49. PODSUMOWANIE
  • 50. REDUKCJONIZMSystem może być zrozumiany tylko przez jegoredukcję do najmniejszych elementów.Najmniejsze elementy zachowują się indywidualniew sposób zgodny z przewidywaniami.
  • 51. OSTRZEŻENIEale - samo wyliczenie tych elementów i ichwłasności nie wystarcza do opisania procesu ichwspółpracy i komunikacji niezbędnych do budowyoraz funkcjonowania całej komórki.
  • 52. WŁASNOŚCI EMERGENTNEPodejście redukcjonistyczne z sukcesem pozwoliłona identyfikację większości elementów składowychi ich oddziaływań, jednak nie ofer uje onoprzekonującej koncepcji metodologicznej lubmetody umożliwiającej pokazanie w jaki sposóbpojawiają się własności emergentne całego systemu. Sauer U. et al., Science, 2007
  • 53. INTEGRACJAAby zrozumieć jak i dlaczego komórki funkcjonująw ten a nie inny sposób, potrzebujemy dokładnychdanych o koncentracjach biomolekuł, tak żebymożna było odpisać ich wzajemne oddziaływania.Pluralizm przyczyny i skutku w sieciachbiologicznych jest lepiej opisywany przezobser wacje ilościowe i równoczesne, wieluczynników odpowiadających za funkcjonowaniekomórki, jak również ich rygorystyczna integracjaz modelami matematycznymi. Sauer U. et al., Science, 2007
  • 54. MODELOWANIE/SYMULACJENiezbędne jest ponowne połączenie części wcałość, oraz budowa poszczególnych modułówoprogramowania symulacyjnego, które same będąsię zachowywały jak dynamiczne częsci organizmużywego.
  • 55. 10 ZASAD BIOLOGII SYSTEMOWEJ Noble D., 2006
  • 56. 10 ZASAD BIOLOGII SYSTEMOWEJ Funkcja biologiczna jest wielo-skalowa; Przekazywanie informacji nie zachodzi tylkow jednym kierunku; DNA nie jest wyłącznym przekaźnikiemdziedziczenia; Teoria biologicznej względności: nie mawyróżnionego poziomu kauzalnego; Ontologia genów nie powiedzie się bez opisuwysoko-poziomowego (integrującego); Nie ma programu genetycznego; Nie ma programów na innych poziomach; Nie ma programów w mózgu; Istota nie jest obiektem; Jest wiele innych zasad, które zostanąodkryte. Nie istnieje ostateczna “teoria biologii”Noble D., 2006
  • 57. DZIĘKUJĘ ZA UWAGĘ
  • 58. CZY ZOSTAŁO JESZCZE TROCHE CZASU?
  • 59. JEŚLI TAK: CZY BIOLOG MOŻE NAPRAWIĆ RADIO?Testowanie podejścia biologii systemowej wprzypadku kiedy znamy rozwiązanie Lazebnik, Cancer Cell, 2002
  • 60. ŚCIEŻKA SYGNAŁOWAOba przekształcają sygnał z jednej formy do drugiej,Oba mają porównywalną ilość elementów/węzłów. Molecular ce! biology Lodish H. et al.
  • 61. Lazebnik, Cancer Cell, 2002
  • 62. CO ODRÓŻNIA TE DWA SWIATY?formalny język ilościowy jest niezbędnyanaliza perturbacji i stanów stacjonarnych Lazebnik, Cancer Cell, 2002
  • 63. Niels Bohr Predicting is very difficult especially about the future…
  • 64. Przykład pierwszy: T. MARITIMA • Analiza strukturalna pełnej sieci metabolicznej • 478 białek (358 modeli 3D) • 503 metabolitów • 182 foldów • 562 wewnatrz-komórkowych & 83 zewnątrz-komórkowych reakcji • lepsze zrozumienie ewolucji i mechanizmów działania ścieżek metabolicznych • zastosowania w biotech LBiBS Godzik, Ginalski et al. Science 325, 1544-1549 (2009)
  • 65. Przykład drugi: M.GENITALIUMA External environment RNA modification Figure 1. M. genitalium Whole-Cell Model Integrates 28 Submodels of Diverse Cellular Processes RNA Ribosome Terminal organelle decay assembly (A) Diagram schematically depicts the 28 sub- Metabolism assemblyA Figure 1. M. genitalium Whole-Cell Model as colored words—grouped by category tRNA Protein models • Modeł pełnej komórki z aminoacylation translocation External RNA processing Integrates 28 Protein Submodels of Diverse Host Cellularmetabolic (orange), RNA (green), protein as environment RNA processing interaction (blue), and DNA (red)—in the context of a single modification Processes (A) Diagram schematically depicts uwzględnieniem jej Host epithelium M. genitalium cell with its characteristic flask- RNA Ribosome Terminal organelle Transcription decay assembly the 28 sub- shape. Submodels are connected through like Metabolism assembly Translation tRNA aminoacylation Protein DNA translocation supercoiling Transcriptional Macromolecular regulation complexation Host Protein modification charakterystycznego as and the chromosome, which are depicted kształtu common metabolites, RNA, protein, models as colored words—grouped by category as metabolic (orange), RNA (green), protein orange, RNA processing Protein Protein Protein green, blue, and red arrows, respectively. processing interaction activation folding (blue), and DNA (red)—in the context of a single (B) The model integrates cellular function sub- DNA DNA Host epithelium • Zróżnicowane procesy repair M. genitalium cell with its characteristic flask- through 16 cell variables. First, simulations models damage Transcription like shape. Submodels areMetabolites Protein decay are randomly initialized to the beginning of the cell connected through DNA Transcriptional Macromolecular regulation complexation Protein Translation RNA Protein komórkowe: metaboliczne common metabolites, RNA, protein, and cycle (left gray arrow). Next, for each 1 s time step the (dark black arrows), the submodels retrieve the supercoiling modification chromosome, which are depicted as orange, values of the cellular variables, calculate Protein activation Protein folding Chromosome condensation DNA green, blue, and red arrows, respectively. Replication (pomarańczowy), RNA current their contributions to the temporal evolution of the DNA repair DNA DNA replication initiation model integrates cellular function sub- (B) The FtsZ models through 16 cell variables. First, simulations (zielony), białkowe (niebieski), cell variables, and update the values of the cellular variables. This is repeated thousands of times damage polymerization Protein decay Metabolites Chromosome segregation Cytokinesis cell oraz DNA (czerwony) during the course of each simulation. For clarity, are randomly initialized to the beginning of the cell functions and variables are grouped into five RNA cycle (left gray arrow). Next, for each 1 s time stepphysiologic categories: DNA (red), RNA (green), Protein (dark black arrows), the submodels retrieve protein (blue), metabolite (orange), and other the Chromosome condensation DNA • Integracja 28 podmodeli current values of the cellular variables, calculate Colored lines between the variables and (black). submodels indicate the cell variables predicted by B Update time & contributions to the temporal evolution of each submodel. The number of genes associated their the Replication cell variables DNA initiation cell variables, and update the values of the cellular each submodel is indicated in parentheses. with replication Chromosome variables. This(3) repeated thousands of times simulations are terminated upon cell divi- Condensation RNA DNA FtsZ polymerization Transcript Segregation (7) during the (0) is Damage course of each simulation. For clarity, • Podmodele są połączone Finally, sion when the septum diameter equals zero (right The model integrates cellular function Chromosome Cytokinesis sub- models through 16 cell cellRepair (18) and variables are grouped into five functions przez wspólne metabolity, gray arrow). DNA segregation RNA variables. First, simulations are randomly initialized to the beginning Supercoiling (5) physiologic categories: DNA (red), RNA (green), of the cell cycle (left gray arrow). Next, for each 1 s time Polypeptide step (dark Replication (10) protein (blue), metabolite (orange), and other Replication initiation (1) RNA, białka, oraz chromosom, black arrows), the submodels retrieve the current values of the cellular Protein mon. Transcriptional reg. (5) (black). Colored lines between the variables and Transcription (8) co jest pokazane w submodels indicate the cell variables predicted by and protein degradation were variables, calculate their contributions to the temporal evolution of Complex Processing (6) RNA odpowiadających im kolorach ProteinB Update time & RNA each submodel. The number of genes associated Modification (14) the cell variables, and updatecell variables of the cellular variables. This is the values RNA pol Aminoacylation (25) modeled as Poisson processes. with each submodel is indicated in parentheses. key challenge of the project was to No: A repeated Chromosome of times during the course of (3) simulation. ForSend cell Finally, simulations are terminated upon cell divi- thousands Condensation each Decay (2) RNA DNA repeat Ribosome integrate the 28 submodels into a unified Initialize variables Translation (103) clarity, cell Transcript and variables are grouped (7) five physiologic functions Segregation into FtsZ ring sion when the(2) Cell Yes: Processing I septum diameter equals zero (right divided? terminate model. Although we and others had Damage (0) categories: DNA (red), RNA (green), protein (blue), metabolite (orange), gray arrow). (9) Translocation previously developed methods to inte- Metabolite Repair (18) Metabolic rxn Processing II (2) DNA RNA grate ODEs with Boolean, probabilistic, and other (black). Colored lines bet ween the variables andMetabolite Supercoiling (5) submodels Folding (6) Protein Modification (3) and constraint-based submodels (Covert indicate the cell variables predicted by each submodel. The number of Polypeptide Replication (10) Complexation (0) et al., 2001, 2004, 2008; Chandrasekaran Replication initiation (1) Geometry Ribosome assembly (6) genes associated with each submodel isTranscriptionalin parentheses. Finally, indicated reg. (5) Term. org. assembly (8) and Price, 2010), the current effort Protein mon. Host simulations are terminated upon cell divi- sion when the septum Transcription (8) Activation (0) involved so many different cellular func- tions and mathematical representations Decay (9) Other Complex Processing (6) Mass RNA polymerization (1) FtsZ and protein degradation were a more general approach was Protein that RNA Modification (14) Stimulus Metabolism (140) modeled as Poisson processes. RNA pol needed. We began with the assumption Other Aminoacylation (25) Cytokinesis (1) Decay (2) No: Time A key challenge of the project wasthat the submodels are approximately Host interaction (16) to Ribosome Send cell repeat Karr, Covertindependent 150, 389-401 (2012) et al. Cell on short timescales (less Cell variables Cell process submodels integrate the 28 submodels into a unifiedInitialize variables Translation (103) Yes: Cell than 1 s). Simulations are then performed FtsZ ring Processing I (2) divided? terminate model. Although we and others hadrunning through a loop in which the by