• Like
Fields bosc2010 bio_perl
Upcoming SlideShare
Loading in...5

Thanks for flagging this SlideShare!

Oops! An error has occurred.

Fields bosc2010 bio_perl



Published in Technology
  • Full Name Full Name Comment goes here.
    Are you sure you want to
    Your message goes here
    Be the first to comment
No Downloads


Total Views
On SlideShare
From Embeds
Number of Embeds



Embeds 0

No embeds

Report content

Flagged as inappropriate Flag as inappropriate
Flag as inappropriate

Select your reason for flagging this presentation as inappropriate.

    No notes for slide


  • 1. BioPerl Update 2010: Towards a Modern BioPerl Chris Fields (UIUC) BOSC 7-10-10
  • 2. Present Day BioPerl ✤ Addressing new bioinformatics problems ✤ Collaborations in Open Bioinformatics Foundation ✤ Google Summer of Code
  • 3. Towards a Modern BioPerl ✤ Lowering the barrier for new users to become involved ✤ Using Modern Perl language features ✤ Dealing with the BioPerl monolith
  • 4. BioPerl 2.0? ✤ BioPerl and Modern Perl OOP (Moose) ✤ BioPerl and Perl 6
  • 5. Background ✤ Started in 1996, many contributors over the years ✤ Jason Stajich (UCR) ✤ Ian Korf (Wash U) ✤ Hilmar Lapp (NESCent) ✤ Chris Mungall (NCBO) ✤ Heikki Lehväslaiho (KAUST) ✤ Brian Osborne (BioTeam) ✤ Georg Fuellen (Bielefeld) ✤ Steve Trutane (Stanford) ✤ Ewan Birney (Sanger, EBI) ✤ Sendu Bala (Sanger) ✤ Aaron Mackey (Univ. Virginia) ✤ Dave Messina (Sonnhammer Lab) ✤ Chris Dagdigian (BioTeam) ✤ Mark Jensen (TCGA) ✤ Steven Brenner (UC-Berkeley) ✤ Rob Buels (SGN) ✤ Lincoln Stein (OICR, CSHL) ✤ Many, many more!
  • 6. Background ✤ Open source: ‘Released under the same license as Perl itself’ i.e. Artistic ✤ http://bioperl.org ✤ Core developers - make releases, drive the project, set vision ✤ Regular contributors - have direct commit access
  • 7. BioPerl Distributions ✤ BioPerl Core - the main distribution (aka ‘bioperl-live’ if using dev version) ✤ BioPerl-Run - Perl ‘wrappers’ for common bioinformatics tools ✤ BioPerl-DB - BioSQL ORM to BioPerl classes
  • 8. Biological Sequences ✤ Bio::Seq - sequence record class #!/bin/perl -w use Modern::Perl; use Bio::Seq; my $seq_obj = Bio::Seq->new(-seq => "aaaatgggggggggggccccgtt", -display_id => "ABC12345", -desc => "example 1", -alphabet => "dna"); say $seq_obj->display_id; # ABC12345 say $seq_obj->desc; # example 1 say $seq_obj->seq; # aaaatgggggggggggccccgtt my $revcom = $seq_obj->revcom; # new Bio::Seq, but revcom say $revcom->seq; # aacggggcccccccccccatttt
  • 9. Sequence I/O ✤ Bio::SeqIO - sequence I/O stream classes (pluggable) #!/usr/bin/perl -w use Modern::Perl; use Bio::SeqIO; my ($infile, $outfile) = @ARGV; my $in = Bio::SeqIO->new(-file => $infile, -format => 'genbank'); my $out = Bio::SeqIO->new(-file => ">$outfile", -format => 'fasta'); while (my $seq_obj = $in->next_seq) { say $seq_obj->display_id; $out->write_seq($seq_obj); }
  • 10. Sequence Features ✤ Bio::SeqFeature::Generic - generic SF implementation GenBank File use Modern::Perl; source 1..2629 use Bio::SeqIO; /organism="Enterococcus faecalis OG1RF" /mol_type="genomic DNA" my $in = Bio::SeqIO->new(-file => shift, /strain="OG1RF" -format => 'genbank'); /db_xref="taxon:474186" gene 25..>2629 while (my $seq_obj = $in->next_seq) { /gene="pyr operon" for my $feat_obj ($seq_obj->get_SeqFeatures) { /note="pyrimidine biosynthetic operon" say "Primary tag: ".$feat_obj->primary_tag; say "Location: ".$feat_obj->location->to_FTstring; Primary tag: source for my $tag ($feat_obj->get_all_tags) { Location: 1..2629 say " tag: $tag"; tag: db_xref for my $value ($feat_obj->get_tag_values($tag)) { value: taxon:474186 say " value: $value"; tag: mol_type } value: genomic DNA } tag: organism } value: Enterococcus faecalis OG1RF } tag: strain value: OG1RF
  • 11. Sequence Features ✤ Bio::SeqFeature::Generic - generic SF implementation GenBank File use Modern::Perl; source 1..2629 use Bio::SeqIO; /organism="Enterococcus faecalis OG1RF" /mol_type="genomic DNA" my $in = Bio::SeqIO->new(-file => shift, /strain="OG1RF" -format => 'genbank'); /db_xref="taxon:474186" gene 25..>2629 while (my $seq_obj = $in->next_seq) { /gene="pyr operon" for my $feat_obj ($seq_obj->get_SeqFeatures) { /note="pyrimidine biosynthetic operon" say "Primary tag: ".$feat_obj->primary_tag; say "Location: ".$feat_obj->location->to_FTstring; Primary tag: source for my $tag ($feat_obj->get_all_tags) { Location: 1..2629 say " tag: $tag"; tag: db_xref for my $value ($feat_obj->get_tag_values($tag)) { value: taxon:474186 say " value: $value"; tag: mol_type } value: genomic DNA } tag: organism } value: Enterococcus faecalis OG1RF } tag: strain value: OG1RF
  • 12. Sequence Features ✤ Bio::SeqFeature::Generic - generic SF implementation GenBank File use Modern::Perl; source 1..2629 use Bio::SeqIO; /organism="Enterococcus faecalis OG1RF" /mol_type="genomic DNA" my $in = Bio::SeqIO->new(-file => shift, /strain="OG1RF" -format => 'genbank'); /db_xref="taxon:474186" gene 25..>2629 while (my $seq_obj = $in->next_seq) { /gene="pyr operon" for my $feat_obj ($seq_obj->get_SeqFeatures) { /note="pyrimidine biosynthetic operon" say "Primary tag: ".$feat_obj->primary_tag; say "Location: ".$feat_obj->location->to_FTstring; Primary tag: source for my $tag ($feat_obj->get_all_tags) { Location: 1..2629 say " tag: $tag"; tag: db_xref for my $value ($feat_obj->get_tag_values($tag)) { value: taxon:474186 say " value: $value"; tag: mol_type } value: genomic DNA } tag: organism } value: Enterococcus faecalis OG1RF } tag: strain value: OG1RF
  • 13. Report Parsing Query= gi|1786183|gb|AAC73113.1| (AE000111) aspartokinase I, homoserine dehydrogenase I [Escherichia coli] (820 letters) Database: ecoli.aa 4289 sequences; 1,358,990 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAC73113.1| (AE000111) aspartokinase I, homoserine dehydrogen... 1567 0.0 gb|AAC76922.1| (AE000468) aspartokinase II and homoserine dehydr... 332 1e-91 gb|AAC76994.1| (AE000475) aspartokinase III, lysine sensitive [E... 184 3e-47 gb|AAC73282.1| (AE000126) uridylate kinase [Escherichia coli] 42 3e-04 >gb|AAC73113.1| (AE000111) aspartokinase I, homoserine dehydrogenase I [Escherichia coli] Length = 820 Score = 1567 bits (4058), Expect = 0.0 Identities = 806/820 (98%), Positives = 806/820 (98%) Query: 1 MRVLKFGGTSVANAERFLRVADILESNARQGQVATVLSAPAKITNHLVAMIEKTISGQDA 60 MRVLKFGGTSVANAERFLRVADILESNARQGQVATVLSAPAKITNHLVAMIEKTISGQDA Sbjct: 1 MRVLKFGGTSVANAERFLRVADILESNARQGQVATVLSAPAKITNHLVAMIEKTISGQDA 60
  • 14. Report Parsing Query=gi|1786183|gb|AAC73113.1| ✤ Bio::SearchIO Hit=gb|AAC73113.1| #!/usr/bin/perl -w Length=820 Percent_id=98.2926829268293 use Modern::Perl; use Bio::SearchIO; Query=gi|1786183|gb|AAC73113.1| my $in = Bio::SearchIO->new(-format => 'blast', -file => 'ecoli.bls'); Hit=gb|AAC76922.1| Length=821 while( my $result = $in->next_result ) { Percent_id=29.5980511571255 while( my $hit = $result->next_hit ) { while( my $hsp = $hit->next_hsp ) { Query=gi|1786183|gb|AAC73113.1| say "Query=".$result->query_name; Hit=gb|AAC76994.1| say " Hit=".$hit->name; Length=471 say " Length=".$hsp->length('total'); say " Percent_id=".$hsp->percent_identity."n"; Percent_id=30.1486199575372 } } Query=gi|1786183|gb|AAC73113.1| } Hit=gb|AAC73282.1| Length=97 Percent_id=28.8659793814433
  • 15. Local/Remote Database Interfaces ✤ Bio::DB::GenBank #!/bin/perl -w use Modern::Perl; use Bio::DB::GenBank; my $db_obj = Bio::DB::GenBank->new; # query NCBI nuc db my $seq_obj = $db_obj->get_Seq_by_acc('A00002'); say $seq_obj->display_id; # A00002 say $seq_obj->length(); # 194 ✤ Also EntrezGene, GenPept, RefSeq, UniProt, EBI, etc.
  • 16. And Lots More! ✤ Bio::Align/IO ✤ Bio::Map/IO ✤ Bio::Assembly/IO ✤ Bio::Restriction/IO ✤ Bio::Tree/IO ✤ Bio::Structure/IO ✤ Local flatfile databases ✤ Bio::Factory ✤ Bio::Graphics ✤ Bio::Tools::Run (catch-all namespace) ✤ SeqFeature databases ✤ Bio::Factory (create objects) ✤ Bio::Pedigree/IO ✤ Bio::Range/Location ✤ Bio::Coordinate/IO
  • 17. Current Development
  • 18. Next-Gen Sequence ✤ Second-generation/next-generation sequencing ✤ This is Lincoln Stein ✤ There is a reason he is smiling...
  • 19. Next-Gen Sequence ✤ Bio-SamTools - support for SAM and BAM data (via SamTools) ✤ Bio-BigFile - support for BigWig/BigBed (via Jim Kent’s UCSC tools) ✤ Separate CPAN distributions ✤ GBrowse (Lincoln’s talk this afternoon), BioPerl ✤ Via SeqFeatures (high-level API for both modules) ✤ Via Bio::Assembly and BioPerl-Run (using the above modules)
  • 20. Data Courtesy R. Khetani, M. Hudson, G. Robinson
  • 21. New Tools/Wrappers ✤ BowTie ✤ Infernal v.1.0 ✤ BWA ✤ NCBI eUtils (SOAP, CGI-based) ✤ MAQ ✤ TopHat/CuffLinks (upcoming) ✤ BEDTools (beta) ✤ The Cloud - bioperl-max ✤ SAMTools Mark Jensen, ✤ HMMER3 Thomas Sharpton, Dave Messina, ✤ BLAST+ Kai Blin, ✤ PAML Dan Kortschak
  • 22. Collaborations Published online 16 December 2009 Nucleic Acids Research, 2010, Vol. 38, No. 6 1767–1771 doi:10.1093/nar/gkp1137 SURVEY AND SUMMARY The Sanger FASTQ file format for sequences with quality scores, and the Solexa/Illumina FASTQ variants Peter J. A. Cock1,*, Christopher J. Fields2, Naohisa Goto3, Michael L. Heuer4 and Peter M. Rice5 1 Plant Pathology, SCRI, Invergowrie, Dundee DD2 5DA, UK, 2Institute for Genomic Biology, 1206 W. Gregory Drive, M/C 195, University of Illinois at Urbana-Champaign, IL 61801, USA, 3Genome Information Research Center, Research Institute for Microbial Diseases, Osaka University, 3-1 Yamadaoka, Suita, Osaka 565-0871, Japan, 4Harbinger Partners, Inc., 855 Village Center Drive, Suite 356, St. Paul, MN 55127, USA and 5EMBL Outstation - Hinxton, European Bioinformatics Institute, Wellcome Trust Genome Campus, Hinxton, Cambridge CB10 1SD, UK Received October 13, 2009; Revised November 13, 2009; Accepted November 17, 2009 ABSTRACT of an explicit standard some parsers will fail to cope with very long ‘>’ title lines or very long sequences without FASTQ has emerged as a common file format for line wrapping. There is also no standardization for
  • 23. The Google Summer of Code ✤ O|B|F was accepted this year for the first time ✤ Headed by Rob Buels (SGN), with some help from Hilmar Lapp and myself ✤ Six projects, covering BioPerl, BioJava, Biopython, BioRuby
  • 24. The Google Summer of Code ✤ BioPerl has actually been part of the Google Summer of Code for the last three years (as have many other Bio*): ✤ NESCent - admin: H. Lapp: ✤ 2008 - PhyloXML parsing (student: Mira Han) ✤ 2009 - NeXML parsing (student: Chase Miller) ✤ O|B|F - admin: R. Buels: ✤ 2010 - Alignment subsystem refactoring (student: Jun Yin)
  • 25. GSoC - Alignment Subsystem ✤ Clean up current code ✤ Include capability of dealing with large datasets ✤ Target next-gen data, very large alignments? ✤ Abstract the backend (DB, memory, etc.) ✤ SAM/BAM may work (via Bio::DB::SAM) ✤ ...but what about protein sequences?
  • 26. Towards a Modern BioPerl
  • 27. Towards a Modern BioPerl ✤ BioPerl will be turning 15 soon ✤ What can we improve? ✤ What can we do with the current code? ✤ Maybe some that we can use in a BioPerl 2.0? ✤ Or a BioPerl 6?
  • 28. What We Can Do Now ✤ Lower the barrier ✤ Use Modern Perl ✤ Deal with the monolith
  • 29. Lower the Barrier ✤ We have already started on this - May 2010 ✤ Migrate source code repository to git and GitHub ✤ Original BioPerl developers are added as collaborators on GitHub... ✤ ...but now anyone can now ‘fork’ BioPerl, make changes, submit ‘pull requests’, etc. ✤ Since May, have had many forks, pull requests with code reviews (so a decent success)
  • 30. Using Modern Perl ✤ Minimal version of Perl required for BioPerl is v5.6.1 ✤ Even v5.8.1 is considered quite old ✤ Both the 5.6.x and 5.8.x releases are EOL (as of Dec. 2008)
  • 31. Using Modern Perl ✤ Minimal version of Perl required for BioPerl is v5.6.1 ✤ Even v5.8.1 is considered quite old ✤ Both the 5.6.x and 5.8.x releases are EOL (as of Dec. 2008)
  • 32. Using Modern Perl say defined-or print "I like newlinesn"; # work only if false && defined $foo ||= 'default'; say "I like newlines"; if (!defined($foo)) { $foo = 'default' yada yada } $foo //= 'default'; sub implement_me { shift->throw_not_implemented } sub implement_me { ... } # yada yada
  • 33. Using Modern Perl Smart Match given/when if ($key ~~ %hash) { # like exists given ($foo) { # do something when (%lookup) { ... } } when (/^(d+)/) { ... } when (/^[A-Za-z]+/) { ... } if ($foo ~~ /d+/ ) { # like =~ default { ... } # do something } }
  • 34. Dealing with the Monolith ✤ Release manager nightmares: ✤ Remote databases disappear (XEMBL) ✤ Others change service or URLs (SeqHound) ✤ Services become obsolete (Pise) ✤ Developers move on, disappear, modules bit-rot (not saying :) ✤ How do we solve this problem?
  • 35. Dealing with the Monolith Classes Tests (Files) bioperl-live 874 23146 (341) (Core) bioperl-run 123* 2468 (80) bioperl-db 72 113 (16) bioperl-network 9 327 (9) * Had 285 more prior to Pise module removal!
  • 36. Dealing with the Monolith ✤ Maybe we shouldn’t be friendly to the monolith ✤ Maybe we should ‘blow it up’ ✤ (Of course, that means make the code modular) ✤ It was originally designed with that somewhat in mind (interfaces)
  • 37. Dealing with the Monolith ✤ Separate distributions make it easier to submit fixes as needed ✤ However, separate distributions make developing a little trickier ✤ Can we create a distribution that resembles BioPerl as users know it? ✤ Is this something we should worry about? ✤ YES ✤ Don’t alienate end-users!
  • 38. Towards BioPerl 2.0? ✤ Biome: BioPerl with Moose ✤ BioPerl6: self-explanatory
  • 39. Biome ✤ BioPerl classes implemented in Moose ✤ GitHub: http://github.com/cjfields/biome ✤ Implemented: Ranges, Locations, simple PrimarySeq, Annotation, SeqFeatures, prototype SeqIO ✤ Interfaces converted to Moose Roles ✤ ‘Type’-checking used for data types
  • 40. Role package Biome::Role::Range; Attributes use Biome::Role; use Biome::Types qw(SequenceStrand); requires 'to_string'; Class package Biome::Range; has strand => ( isa => SequenceStrand, use Biome; is => 'rw', default => 0, with 'Biome::Role::Range'; coerce => 1 ); sub to_string { my ($self) = @_; has start => ( return sprintf("(%s, %s) strand=%s", is => 'rw', $self->start, isa => 'Int', $self->end, ); $self->strand); } has end => ( is => 'rw', isa => 'Int' ); sub length { $_[0]->end - $_[0]->start + 1; }
  • 41. BioPerl 6 ✤ BioPerl6: http://github.com/cjfields/bioperl6 ✤ Little has been done beyond simple implementations ✤ Code is open to anyone for experimentation ✤ Ex: Philip Mabon donated a FASTA grammar:
  • 42. Grammar (FASTA) Actions (FASTA) grammar Bio::Grammar::Fasta { token TOP { ^<fasta>+ $ } token fasta { <description_line> <sequence> } token description_line { ^^> <id> <.ws> <description> n } token id { | <identifier> | <generic_id> } token identifier { S+ } token generic_id { S+ } token description { N+ } token sequence { <-[>]>+ } }
  • 43. Grammar (FASTA) Actions (FASTA) grammar Bio::Grammar::Fasta { class Bio::Grammar::Actions::Fasta { token TOP { method TOP($/){ ^<fasta>+ $ my @matches = gather for $/<fasta> -> $m { take $m.ast; } }; token fasta { <description_line> <sequence> make @matches; } } method fasta($/){ token description_line { my $id =$/<description_line>.ast<id>; ^^> <id> <.ws> <description> n my $desc = $/<description_line>.ast<description>; } my $obj = Bio::PrimarySeq.new( token id { display_id => $id, | <identifier> description => $desc, | <generic_id> seq => $/<sequence>.ast); } make $obj; token identifier { } S+ method description_line($/){ } make $/; token generic_id { } S+ method id($/) { } make $/; } token description { method description($/){ N+ make $/; } } token sequence { method sequence($/){ <-[>]>+ make (~$/).subst("n", '', :g); } } } }
  • 44. Grammar (FASTA) Actions (FASTA) grammar Bio::Grammar::Fasta { class Bio::Grammar::Actions::Fasta { token TOP { method TOP($/){ ^<fasta>+ $ my @matches = gather for $/<fasta> -> $m { take $m.ast; } }; token fasta { <description_line> <sequence> make @matches; } } method fasta($/){ token description_line { my $id =$/<description_line>.ast<id>; ^^> <id> <.ws> <description> n my $desc = $/<description_line>.ast<description>; } my $obj = Bio::PrimarySeq.new( token id { display_id => $id, | <identifier> description => $desc, | <generic_id> seq => $/<sequence>.ast); } make $obj; token identifier { } S+ method description_line($/){ } make $/; token generic_id { } S+ method id($/) { } make $/; } token description { method description($/){ N+ make $/; } } token sequence { method sequence($/){ <-[>]>+ make (~$/).subst("n", '', :g); } } } }
  • 45. Grammar (FASTA) Actions (FASTA) grammar Bio::Grammar::Fasta { class Bio::Grammar::Actions::Fasta { token TOP { method TOP($/){ ^<fasta>+ $ my @matches = gather for $/<fasta> -> $m { take $m.ast; } }; token fasta { <description_line> <sequence> make @matches; } } method fasta($/){ token description_line { my $id =$/<description_line>.ast<id>; ^^> <id> <.ws> <description> n my $desc = $/<description_line>.ast<description>; } my $obj = Bio::PrimarySeq.new( token id { display_id => $id, | <identifier> description => $desc, | <generic_id> seq => $/<sequence>.ast); } make $obj; token identifier { } S+ method description_line($/){ } make $/; token generic_id { } S+ method id($/) { } make $/; } token description { method description($/){ N+ make $/; } } token sequence { method sequence($/){ <-[>]>+ make (~$/).subst("n", '', :g); } } } }
  • 46. Grammar (FASTA) Actions (FASTA) grammar Bio::Grammar::Fasta { class Bio::Grammar::Actions::Fasta { token TOP { method TOP($/){ ^<fasta>+ $ my @matches = gather for $/<fasta> -> $m { take $m.ast; } }; token fasta { <description_line> <sequence> make @matches; } } method fasta($/){ token description_line { my $id =$/<description_line>.ast<id>; ^^> <id> <.ws> <description> n my $desc = $/<description_line>.ast<description>; } my $obj = Bio::PrimarySeq.new( token id { display_id => $id, | <identifier> description => $desc, | <generic_id> seq => $/<sequence>.ast); } make $obj; token identifier { } S+ method description_line($/){ } make $/; token generic_id { } S+ method id($/) { } make $/; } token description { method description($/){ N+ make $/; } } token sequence { method sequence($/){ <-[>]>+ make (~$/).subst("n", '', :g); } } } }
  • 47. Grammar (FASTA) Actions (FASTA) grammar Bio::Grammar::Fasta { class Bio::Grammar::Actions::Fasta { token TOP { method TOP($/){ ^<fasta>+ $ my @matches = gather for $/<fasta> -> $m { take $m.ast; } }; token fasta { <description_line> <sequence> make @matches; } } method fasta($/){ token description_line { my $id =$/<description_line>.ast<id>; ^^> <id> <.ws> <description> n my $desc = $/<description_line>.ast<description>; } my $obj = Bio::PrimarySeq.new( token id { display_id => $id, | <identifier> description => $desc, | <generic_id> seq => $/<sequence>.ast); } make $obj; token identifier { } S+ method description_line($/){ } make $/; token generic_id { } S+ method id($/) { } make $/; } token description { method description($/){ N+ make $/; } } token sequence { method sequence($/){ <-[>]>+ make (~$/).subst("n", '', :g); } } } }
  • 48. Grammar (FASTA) Actions (FASTA) grammar Bio::Grammar::Fasta { class Bio::Grammar::Actions::Fasta { token TOP { method TOP($/){ ^<fasta>+ $ my @matches = gather for $/<fasta> -> $m { take $m.ast; } }; token fasta { <description_line> <sequence> make @matches; } } method fasta($/){ token description_line { my $id =$/<description_line>.ast<id>; ^^> <id> <.ws> <description> n my $desc = $/<description_line>.ast<description>; } my $obj = Bio::PrimarySeq.new( token id { display_id => $id, | <identifier> description => $desc, | <generic_id> seq => $/<sequence>.ast); } make $obj; token identifier { } S+ method description_line($/){ } make $/; token generic_id { } S+ method id($/) { } make $/; } token description { method description($/){ N+ make $/; } } token sequence { method sequence($/){ <-[>]>+ make (~$/).subst("n", '', :g); } } } }
  • 49. Grammar (FASTA) Actions (FASTA) grammar Bio::Grammar::Fasta { class Bio::Grammar::Actions::Fasta { token TOP { method TOP($/){ ^<fasta>+ $ my @matches = gather for $/<fasta> -> $m { take $m.ast; } }; token fasta { <description_line> <sequence> make @matches; } } method fasta($/){ token description_line { my $id =$/<description_line>.ast<id>; ^^> <id> <.ws> <description> n my $desc = $/<description_line>.ast<description>; } my $obj = Bio::PrimarySeq.new( token id { display_id => $id, | <identifier> description => $desc, | <generic_id> seq => $/<sequence>.ast); } make $obj; token identifier { } S+ method description_line($/){ } make $/; token generic_id { } S+ method id($/) { } make $/; } token description { method description($/){ N+ make $/; } } token sequence { method sequence($/){ <-[>]>+ make (~$/).subst("n", '', :g); } } } }
  • 50. Acknowledgements ✤ All BioPerl developers ✤ Chris Dagdigian and Mauricio Herrera Cuadra (O|B|F gurus) ✤ Cross-Collaborative work: Peter Cock (Biopython), Pjotr Prins (BioLib, BioRuby), Naohisa Goto (BioRuby), Michael Heuer and Andreas Prlic (BioJava), Peter Rice (EMBOSS) ✤ Questions? Do we even have time?