Peningkatan Hasil Belajar Menerapkan Dasar – Dasar Elektronika  Melalui Pembelajaran Cooperative Learning Tipe STAD (Stude...
Belajar      merupakan       kegiatan   kompetensi           pada          silabuspenting bagi setiap orang. Belajar adala...
pendidikan mengatakan bahwa ada tiga               jauh seseorang menguasai bahan yangdomain pengelompokan tujuan belajar ...
yang berisi tentang komponen-komponen,        tentu tidak baik maka seyogyanyasalah satunya materi elektronikabaik        ...
Dengan     demikian,     setiap    anggota        sehingga setiap individu akan memilikikelompok         akan           me...
a.PERENCANAAN                d. REFLEKSI                                           b. TINDAKAN                            ...
Dengan kata lain penggunaan                         dan    pendapat,     mendiskusikanpembelajaran        kooperatif      ...
memacu     meningkatkan     prestasi   a)  untuk siswa yang memiliki kelebihan,       mereka.                             ...
ditempatkan        dalam      tim     belajar      Aunurrahman.   2009.    Belajar    danberanggotakan 4-5 orang yang meru...
Menyenangkan.     Jakarta:   Duha        Khasanah.Made Wena.2009.Strategi Pembelajaran     Inovatif    Kontemporer   Suatu...
Upcoming SlideShare
Loading in …5
×

Jurnal metlitadeng2011baru

1,116 views
1,069 views

Published on

Published in: Education, Technology
0 Comments
0 Likes
Statistics
Notes
  • Be the first to comment

  • Be the first to like this

No Downloads
Views
Total views
1,116
On SlideShare
0
From Embeds
0
Number of Embeds
0
Actions
Shares
0
Downloads
48
Comments
0
Likes
0
Embeds 0
No embeds

No notes for slide

Jurnal metlitadeng2011baru

  1. 1. Peningkatan Hasil Belajar Menerapkan Dasar – Dasar Elektronika Melalui Pembelajaran Cooperative Learning Tipe STAD (Student Team Achievement Division) Di SMKN 5 Jakarta Wulandari (Peneliti) Alumni Program Studi Pendidikan Teknik Elektronika Universitas Negeri Jakarta Tahun 2011 Dr. Yuliatri Sastrawijaya (Pembimbing) Dosen Fakultas Teknik Jurusan Teknik Elektro Universitas Negeri Jakarta AbstractThis study used a qualitative approach to obtain data and analysis through studies, participatory, andcollaborative. The development program is based on classes through four phases of classroom action researchcycle. To improve learning outcomes and student activities carried Classroom Action Research(CAR) usingCooperative Learning Type STAD (Student Team Achievement Division) In SMKN 5 Jakarta. The study istargeted students XAV2 (Audio Video 2) SMKN 5 East Jakarta on odd smester academic year 2010/2011. Withthe aim of this research is to improve the thoroughness of learning and especially in the subject learningoutcomes in basic competencies describe the electronic properties of passiveKatakunci:Pembelajaran Kooperatif, STAD, Pembelajaran Dasar-dasar Elektronika, Konsep HasilBelajar, Standar Kompetensi, Konsep Strategi Pembelajaran Kooperatif, TujuanPembelajaran kooperatif, Prosedur Pembelajaran Kooperatif, Keunggulan dan Kelemahan.Peningkatan Hasil Belajar Menerapkan Dasar – Dasar Elektronika Melalui Pembelajaran CooperativeLearning Tipe STAD (Student Team Achievement Division) Di SMKN 5 Jakarta (Wulandari, Dr.Yuliatri Sastrawijaya)
  2. 2. Belajar merupakan kegiatan kompetensi pada silabuspenting bagi setiap orang. Belajar adalah sekolah.Menerapkan Dasar-dasarsebuah proses yang kompleks yang di elektronika adalah salah satu matadalamnya terkandung beberapa aspek. pelajaran dasar yang harus dikuasai siswaAspek-aspek tersebut adalah (1) agar siswa dapat menguasai teoribertambahnya jumlah pengetahuan, (2) elektronika yang lebih tinggi.adanya kemampuan mengingat danmemproduksi, (3) ada penerapan Konsep Hasil Belajarpengetahuan, (4) menyimpulkan makna, (5) Hasilbelajarsiswapadahakekatnyaamenafsirkan makna dan mengaitkannya dalahperubahantingkahdengan realitas, dan (6) adanya perubahan laku. Perubahan sebagaihasilproses dapasebagai pribadi. tditunjukkandalamberbagaibentuksepertipe Dalam proses belajar, terdapat rubahanpelaku dan ada sesuatu yang dipelajari pengetahuan, ketrampilan, kecakapan, seatau yang akan di mengerti. Belajar rta perubahan aspek-mengandung perubahan tingkah laku pada aspek lainyangadapadaindividuyangbelajadiri individu berkat adanya interaksi antara r. Menurut Gagne, Hasil belajar adalahindividu dengan individu dan individu terbentuknya konsep, yaitu kategori yangdengan lingkungan. Perubahan tersebut kita berikan pada stimulus yang ada didapat dinyatakan sebagai suatu kecakapan, lingkungan, yang menyediakan skemasuatu sikap, suatu kebiasaan, suatu yang terorganisasi untuk mengasimilasipengertian, sebagai pengetahuan, atau stimulus-stimulus baru dan menentukanapresiasi. Menurut Soedijarto, Hasil hubungan di dalam dan di antara kategori-belajar adalah sebagai tingkat penguasaan kategori (Dahar, 1998: 95).yang dapat dicapai oleh siswa dalam Hasil belajar merupakan indikatormengikuti proses belajar mengajar sesuai dari keberhasilan pencapaian tujuandengan tujuan pendidikan yang telah pengajaran yang ditetapkan dalam sistemditetapkan. Hasil belajar tersebut dapat pendidikan nasional. Pengungkapan hasilberupa penambahan pengetahuan yang belajar idealnya melalui segenapdiperoleh setelah siswa menempuh psikologis yang berubah akibat dariaktivitas belajar. pengalaman dan proses belajar mengajar. SMK (Sekolah Menengah Proses belajar mengajar dapat melibatkanKejuruan) kelompok teknologi industri aspek kognitif, afektif dan psikomotor.sebagai suatu lembaga formal yang Pada belajar kognitif, prosesnyamemiliki tugas dan tanggung jawab dalam mengakibatkan perubahan aspekmenyelenggarakan sistem pendidikan yang kemampuan berpikir (cognitive), padamengacu pada perkembangan teknologi di belajar afektif mengakibatkan perubahandunia industri. Salah satu sekolah teknik dalam aspek kemampuan merasakankejuruan yang berkompeten dibidangnya (afective), sedangkan pada belajaradalah SMK Negeri 5 Jakarta Timur. psikomotor memberikan hasil belajarJurusan audio video di SMKN 5 Jakarta berupa keterampilan (Psychomotoric).Timur menekankan pada kemampuan Mengutip dari pernyataansiswanya dalam menguasai dasar-dasar Benyamin S Bloom (1956) ahlielektronika dan tercantum dalam standar PEVOTE. Volume 6 No.11
  3. 3. pendidikan mengatakan bahwa ada tiga jauh seseorang menguasai bahan yangdomain pengelompokan tujuan belajar sudah diajarkan. Agar hasil belajar dapatberdasarkan domain atau kawasan belajar , optimal, maka kegiatan pembelajaranyaitu: a) Kawasan kognitif, tujuannya harus direncanakan oleh guru dengan baikyaitu untuk perilaku yang merupakan dan benar sehingga proses belajarproses berfikir atau perilaku yang mengajar dapat berjalan sesuai rencanatermasuk hasil kerja otak, b) kawasan dan tujuan yang telah ditetapkan.afektif, tujuannya yaitu untuk perilaku Tipe hasil belajar yang diharapkanyang dimunculkan seseorang sebagai dalam proses pembelajaran di kelaspertanda kecenderungannya untuk penting untuk diketahui guru, agar gurumembuat pilihan atau keputusan untuk pada tahap selanjutnya dapat mendesainberaksi di dalam lingkungan tertentu, c) pembelajaran secara tepat dan penuhkawasan psikomotor, tujuannya yaitu makna. penilaian hasil belajar merupakanuntuk prilaku yang dimunculkan oleh hasil alat untuk mengukur tingkat keberhasilankerja fungsi tubuh. siswa atau seberapa jauh siswa dapat Ketiga ranah Bloom tidak dapat mencapai tujuan-tujuan pembelajaran yangberdiri sendiri, melainkan merupakan satu telah ditetapkan. Penilaian hasil belajarkesatuan yang sangat erat hungannya, dapat dibedakan menjadi tes dan bukn tesbahkan membentuk tujuan hirarki. Sebagai (nontes).tujuan yang akan dicapai melalui prosespembelajaran, ketiganya harus nampak Standar Kompetensi Menerapkansebagai hasil belajar siswa di sekolah, baik Dasar-dasar Elektronikadalam perubahan perilaku, keterampilan, Standar Kompetensiperkembangan intelektual serta dalam MenerapkanDasar-Dasar Elektronikabesikap mempertahankan nilai-nilai. merupakan langkah awal .dalamSesuai dengan pelaksanaan Spektrum menentukan hasil belajar dasar-dasarbahwa penilaian harus terfokus pada elektronika. Berdasarkan kompetensi yangpencapaian kompetensi (rangkaian telah ditentukan, standar kompetensi dapatkemampuan) bukan hanya pada dibagi menjadi tiga kompetensi dasar yaitu:penguasaan materi (pengetahuan). 1. Mengidentifikasi Hasil belajar seringkali digunakan komponen elektronika aktif, pasif, dansebagai ukuran untuk mengetahui seberapa komponen optik.jauh seseorang menguasai bahan yang 2. Menjelaskan sifat-sifat komponensudah diajarkan. Agar hasil belajar dapat elektronik pasif dan aktif.optimal, maka kegiatan pembelajaran 3. Menjelaskan konsep rangkaianharus direncanakan oleh guru dengan baik elektronika.dan benar sehingga proses belajar Dilihat dari tiga kompetensi dasarmengajar dapat berjalan sesuai rencana tersebut peneliti akan menerapkandan tujuan yang telah ditetapkan. kompetensi dasar ke dua. Dalam Hasil belajar seringkali digunakan meningkatkan hasil belajar dasar-dasarsebagai ukuran untuk mengetahui seberapa elektronika dibutuhkan modul praktikumPeningkatan Hasil Belajar Menerapkan Dasar – Dasar Elektronika Melalui Pembelajaran CooperativeLearning Tipe STAD (Student Team Achievement Division) Di SMKN 5 Jakarta (Wulandari, Dr.Yuliatri Sastrawijaya)
  4. 4. yang berisi tentang komponen-komponen, tentu tidak baik maka seyogyanyasalah satunya materi elektronikabaik penggunaan strategi juga memperhatikanyangpasifmaupunyangaktif.Komponenpasi tingkat kemampuan siswa disampingfyangakandipelajariseperti kesesuaiannya dengan materi pelajaranresistor,kapasitor, induktordantransformat dan tujuan pembelajarn yang inginor.Sedangkankomponenaktif dicapai.Jadi strategi pada intinya adalahyang akan dipelajari seperti dioda, Strategi adalah suatu rencana yangTransistor,FET dan Thyristor yang digunakan untuk memperoleh kesuksesandigunakan untuk mendasari dasar teori atau keberhasilan dalam mencapai tujuan.pada program keahlian teknik audio video. Menurut pendapat Slavin,Arbani,Khususnya untuk peralatan yang dan Chambers (1996), bahwa belajarmenggunakan sistem melalui pembelajaran kooperatif dapateleketronik.Menerapkan Dasar-Dasar dilihat dari beberapa prespektif, antara lain:Elektronika adalah salah satu mata a) Prespektif motivasi, dengan tujuanpelajaran dasar yang harus dikuasai siswa penghargaan yang diberikan kepadaagar siswa dapat menguasai teori kelompok memungkinkan setiap anggotaelektronika yang lebih tinggi.Dalam kelompok akan saling membantu.pembelajaran Menerapkan Dasar-dasar b) Prespektif sosial, dengan tujuanElektronika siswa dituntut untuk lebih melalui kooperatif setiap siswa akan salingpaham, karena menerapkan dasar-dasar membantu dalam belajar karena merekaelektronika adalah langkah awal yang menginginkan semua anggota kelompokharus diketahui sebelum melakukan memperoleh keberhasilan.praktek yang berkenaan dengan alat-alat c) Prespektif perkembangan kognitif,elektronik. Salah satu materi dengan tujuan interaksi antar anggota kelompok dapat mengembangkan prestasiStrategi Cooperative siswa untuk berpikir mengolah berbagaiLearning( Pembelajaran kooperatif ) informasi. Dalam penggunaan strategi d) Prepektif eleborasi kognitif, denganpembelajaran sebelumnya terlebih dahulu tujuan setiap siswa akan berusaha untukkita menentukan konsep strategi memahami dan menimba informasi untukpembelajaran yang akan digunakan yang menambah pengetahuan kognitifnya.terdiri dari beberapa pertimbangan, antara Yang dimaksud denganlain; 1) pertimbangan yang berhubungan pembelajaran kooperatif merupakandengan tujuan yang ingin dicapai, metode pembelajaran dengan2) pertimbangan yang berhubungan menggunakan sistem pengelompokan/timdengan bahan atau materi pembelajaran, 3) kecil, yaitu antara empat sampai enampertimbangan dari sudut siswa, 4) orang yang mempunyai latar belakangpertimbangan-pertimbangan lainnya. kemampuan akademik, jenis kelamin, ras, Penggunaan strategi pengajaran atau suku yang berbedabertujuan sebagai wahana untuk (heterogen).Biasanya sistem penilaianmerangsang siswa semakin bersemangat dilakukan terhadap kelompok. Setiapdalam belajar serta mampu mengajak kelompok akan memperoleh penghargaansiswa untuk belajar.Strategi apapun bila (reward), jika kelompok mampumengurangi minat siswa dalam belajar menunjukkan prestasi yang dipersyaratkan. PEVOTE. Volume 6 No.11
  5. 5. Dengan demikian, setiap anggota sehingga setiap individu akan memilikikelompok akan mempunyai kesempatan yang sama untuk memberikanketergantungan positif. Ketergantungan kontribusi demi keberhasilan kelompok.semacam itulah yang selanjutnya akan Dalam pembelajaran kooperatifmemunculkan tanggung jawab individu terdiri empat pendekatan yang merupakanterhadap kelompok dan keterampilan bagian dari kumpulan strategi guru dalaminterpersonal dari setiap amggota menerapkan model pembelajarankelompok. kooperatif, salah satunya yaitu STAD, Dengan pengertian lain strategi JIGSAW, Investigasi Kelompok (Teamspembelajaran kooperatif jauh lebih baik, Games Tournaments atau TGT), dankarena setiap individu akan saling Pendekatan Struktural yang meliputi Thinkmembantu, mereka akan mempunyai Pair Share (TPS) dan Number Headmotivasi untuk keberhasilan kelompok, Together (NHT).Sebagai salah satu cara untuk mencegah adanya hambatan dalam pembelajaran kooperatiftipe STAD diperlukan langkah-langkah pembelajaran kooperatif, salah satunya yang terdiriatas enam langkah atau fase1.fase-fase pembelajaran ini seperti yang tersajikan dalam table: Fase Kegiatan Guru Fase 1 Menyampaikan semua tujuan pelajaran yang Menyampaikan tujuan ingin dicapai pada pelajaran tersebut dan dan memotivasi siswa memotivasi siswa belajar Fase 2 Menyampaikan informasi kepada siswa Menyajikan/menyampaik dengan jalan mendemonstrsikan atau an informasi lewat bahan bacaan Fase 3 Menjelaskan kepada siswa bagaimana Mengorganisasikan siswa caranya membentuk kelompok belajar dalam kelompok- dan membantu setiap kelompok agar kelompok belajar melakukan transisi secara efisien. Fase 4 Membimbing kelompok-kelompok Membimbing kelompok belajar pada saat mereka mengerjakan bekerja dan belajar tugas mereka. Fase 5 Mengevaluasi hasil belajar tentang materi Evaluasi yang telah diajarkan atau masing-masing kelompok mempresentasikan hasil kerjanya. Untuk lebih jelasnya dalam proses siklus kegiatan dengan desain PTK model Kurt Lewin, adalah sebagai berikut:Peningkatan Hasil Belajar Menerapkan Dasar – Dasar Elektronika Melalui Pembelajaran CooperativeLearning Tipe STAD (Student Team Achievement Division) Di SMKN 5 Jakarta (Wulandari, Dr.Yuliatri Sastrawijaya)
  6. 6. a.PERENCANAAN d. REFLEKSI b. TINDAKAN c. OBSERVASI Gambar Siklus PTK Model Kurt Lewin Konsep Strategi Pembelajaran Tujuan Pembelajaran kooperatif Kooperatif Menurut Johnson & Johnson (1994) Konsep utamadari Pembelajaran menyatakan bahwa tujuan pokok belajar Kooperatif menurut Slavin (1995), adalah kooperatif adalah memaksimalkan belajar sebagai berikut. siswa untuk peningkatan prestasi1. Penghargaan kelompok, yang akan akademik dan pemahaman baik secara diberikan jika kelompok mencapai Kriteria individu maupun secara kelompok. dalam yang ditentukan. pembelajaran kooperatif siswa bekerja2. Tanggung jawab individu, bermakna dalam satu tim, maka dengan sendirinya bahwa bahwa suksesnya kelompok dapat memperbaiki hubungan di antara tergantung pada belajar individu semua para siswa dari berbagai latar belakang anggota kelompok. Tanggung jawab ini etnis dan kemampuan, mengembangkan terfokus dalam usaha untuk membantu keterampilan-keterampilan proses yang lain dan memastikan setiap anggota kelompok dan pemecahan masalah. kelompok telah siap menghadapi evaluasi Sedangkan Menurut (Eggen and tanpa bantuan yang lain. Kauchak, 1996: 297) pembelajaran3. Kesempatan yang sama untuk sukses, kooperatif merupakan sebuah kelompok bermakna bahwa siswa telah membantu strategi pengajaran yang melibatkan siswa kelompok dengan cara meningkatkan bekerja secara berkolaborasi untuk belajar mereka sendiri. mencapai tujuan bersama.pembelajaran Berdasarkan konsep tersebut dapat kooperatif disusun untuk meningkatkan disimpulkan bahwa Konsep Pembelajaran partisipasi siswa, memfasilitasi siswa Kooperatif merupakan sebuah motivasi dengan pengalaman sikap kepemimpinan untuk setiap siswa dalam mencapai tujuan dan membuat keputusan dalam kelompok, pembelajaran, salah satunya dengan serta memberikan kesempatan pada siswa memberikan pengharagaan kelompok, untuk berinteraksi dan belajar bersama- tanggung jawab individu dan kesempatan sama siswa yang berbeda latar yang sama untuk sukses. belakangnya. PEVOTE. Volume 6 No.11
  7. 7. Dengan kata lain penggunaan dan pendapat, mendiskusikanpembelajaran kooperatif dapat permasalahan secara bersama,memaksimalkan belajar siswa untuk membandingkan jawaban mereka,peningkatan prestasi akademik dan dan mengoreksi hal-hal yangpemahaman baik secara individu maupun kurang tepat.secara kelompok, dengan tujuan mencapai 3. Penilaianpeningkatan hasil belajar setiap siswa. Penilaian dalam PembelajaranProsedur Pembelajaran Kooperatif. Kooperatif bias dilakukan dengan Prosedur Pembelajarn Kooperatif tes atau kuis. Tes atau kuispada prinsipnya terdiri atas empat tahap, dilakukan baik secara individualyaitu: 1) penjelasan materi; 2) belajar maupun kelompok. Tes individualdalam kelompok; 3) penilaian; dan 4) nantinya akan memberikanPengakuan tim. informasi kemampuan setiap siswa; 1. Penjelasan Materi dan tes kelompok memberikan Tahap penjelasan diartikan sebagai informasi kemampuan setiap proses penyampaian pokok-pokok kelompok. Hasil akhir siswa adalah materi pelajaran sebelum siswa penggabungan keduanya dan belajar dalam kelompok. Dengan dibagi dua. Nilai setiap kelompok tujuan pemahaman siswa terhadap memiliki nilai sama dalam pokok materi pelajaran yang harus kelompoknya. Hal ini disebabkan sikuasai selanjutnya.Pada tahap ini nilai kelompok adalah nilai guru dapat menggunakan metode bersama dalam kelompoknya yang ceramah, curhat pendapat, dan merupakan hasil kerja sama setiap Tanya jawab, bahkan kalau perlu anggota kelompok. menggunakan demonstrasi. 2. belajar dalam kelompok 4. Pengakuan Tim Setelah guru menjelaskan Pengakuan Tim adalah penetapan gambaran umum tentang pokok tim yang dianggap paling menonjol materi pelajaran, selanjutnya siswa atau tim paling berprestasi untuk diminta untuk belajar pada pokok kemudian diberikan penghargaan masing-masing yang telah dibentuk atau hadiah. Pengakuan dan sebelumnya.Pengelompokannya pemberian penghargaan bersifat heterogen, artinya membangkitkan motivasi tim lain kelompok dibentuk berdasarkan untuk lebih mampu meningkatkan perbedaan-perbedaan setiap prestasi mereka. anggotanya, baik perbedaan gender, Berdasarkan prosedur tersebut, latar belakang agama, social setiap siswa dituntut untuk ekonomi, dan etnik. Melalui berperan aktif dalam mengikuti pembelajaran dalam tim siswa pembelajaran. Dengan tujuan setiap didorong untuk melakukan tukar- siswa dapat termotivasi dalam menukar atau (sharing) informasi mengikuti pelajaran dan dapatPeningkatan Hasil Belajar Menerapkan Dasar – Dasar Elektronika Melalui Pembelajaran CooperativeLearning Tipe STAD (Student Team Achievement Division) Di SMKN 5 Jakarta (Wulandari, Dr.Yuliatri Sastrawijaya)
  8. 8. memacu meningkatkan prestasi a) untuk siswa yang memiliki kelebihan, mereka. merka akan merasa terhambat oleh siswa yang dianggap kurang memilikiKeunggulan dan Kelemahan kemampuan.Pembelajaran Kooperatif b) Ciri utama pembelajaran dari Adapun kelebihan dan kekurangan pembelajaran kooperatif adalah bahwapembelajaran kooperatif, yaitu: siswa saling membelajarkan, maka bila Kelebihan: dibandingkan dengan pengajaran langsunga) pembelajaran kooperatif tidak terlalu dari guru, bias terjadi cara belajar yang menggantungkan pada guru, akan demikian apa yang seharusnya dipelajari tetapi dapat menambah kepercayaan dan dipahami tidak pernah dicapai oleh kemampuan berpikir sendiri, siswa. menemuka informasi dari berbagai c) pembelajaran kooperatif didasarkan sumber, dan belajar dari siswa yang kepada hasil kerja kelompok. lain. d) Keberhasilan pembelajaran kooperatifb) Pembelajaran kooperatif dapat dalam upaya mengembangkan kesadaran mengembangkan kemampuan berkelompok memerlukan periode waktu mengungkapkan ide atau gagasan dan yang cukup panjang. membandingkan dengan ide-ide orang e) Walaupun kemampuan kerja sama lain. merupakan kemampuan yang sangtc) Pembelajaran kooperatif dapat penting untuk siswa, akan tetapi banyak membantu anak untuk respek pada aktivitas dalam kehidupan yang hanya orang lain dan menyadari akan segala didasarkan kepada kemampuan secara keterbatasannya serta menerima segala individual. Oleh karena itu, siswa juga perbedaan. harus belajar bagaimana membangund) Pembelajaran kooperatif dapat kepercayaan diri. membantu setiap siswa untuk lebih bertanggung jawab dalam belajar. Hakikat Tipe Pembelajaran STADe) Merupakan suatu strategi yang cukup ( Student Teams Achievement Division) ampuh untuk meningkatkan prestasi Setelah jenis materi dan strategi akademik sekaligus kemampuan pembelajaran ditentukan langkah sosial, termasuk mengembangkan rasa berikutnya adalah menentukan tipe harga diri, hubungan interpersonal pembelajaran. Salah satu tipe yang yang positif dengan yang lain, digunakan adalah dengan menggunakan mengembangkan keterampilan me- tipeSTAD ( Student Teams Achievement manage waktu dan sikap positif Division). Pembelajaran kooperatif tipe terhadap sekolah. STAD merupakan salah satu tipe darif) Dapat maningkatkan kemampuan pembelajaran kooperatif dengan siswa menggunakan informasi dan menggunakn kelompok-kelompok kecil kemampuan belajar abstrak menjadi dengan anggota tiap kelompoknya 4-5 nyata. orang siswa yang penempatannya secara heterogen. Adapun kelemahan pembelajaran Menurut slavin (dalam Nur, 2000:26)kooperatif, yaitu: menyatakan bahwa pada STAD siswa PEVOTE. Volume 6 No.11
  9. 9. ditempatkan dalam tim belajar Aunurrahman. 2009. Belajar danberanggotakan 4-5 orang yang merupakan Pembelajaran. Bandung: Alfabeta.campuran menurut tingkat prestasi, jeniskelamin, dan suku.biasanya dalam proses Bell Gredler, Margaret E. 1991.Belajarpembelajaran dengan menggunakan tipe dan Membelajarkan. Jakarta:STAD, guru menyajikan pelajaran Rajawali.terlebih dahulu, dan kemudian siswabekerja dalam tim mereka memastikan Depdikbud. 2005. Modul Menguasai Teoribahwa seluruh anggota tim telah Dasar Elektronika.Jakarta:menguasai pelajaran tersebut. kemudian, Direktorat Jenderal Pendidikanseluruh siswa diberikan tes tentang materi Dasar dan Menengah. Direktorattersebut, pada saat tes ini mereka tidak Pendidikan Menengah Umum.diperbolehkan saling membantu dangantujuan hasil pembelajaran dapat dicapai. Depdiknas.2006.Kurikulum Sekolah Salah satu strategi pembelajaran Menengah Kejuruan Garis-Garisyang dapat digunakan pada proses Besar Program Pendidikan danpembelajaran adalah pemebelajaran Keahlian. Depdiknas: Jakarta.dengan menggunakan tipe STAD, denganmenggunakan pembelajaran tipe STAD Depdikbud. 1999. Penelitian Tindakandiharapkan siswa dapat mengembangkan Kelas (Classroom Action Research).kemampuannya dan dapat menambah Jakarta: Direktorat Jenderal Pendidikankemampuan berfikir sendiri, menemukan Dasar dan Menengah. Direktoratinformasi dari berbagai sumber, dan Pendidikan Menengah Umum.belajar dari siswa yang lain.Tipe pembelajaran STAD bisa jadi sebagai Purwanto. 2008. Evaluasi Pengajaran.alternatife yang cukup efektif dan Surabaya : PT. Remajaefisien.Sampai sekarang, yang umumnya Rosdakarya.dikenal sebagai “teacher centered” Purwanto, M.Ngalim. 2008. Prinsip-(berpusat pada guru).Padahal , semakin Prinsip Dan Teknik Evaluasilama tipe pembelajaran semakin Pengajaran. Bandung: PT.Remajaberkembang, baik jumlah maupun Rosdakarya.distribusi. Dalam penggunaannya tipepembelajaran STAD bisa jadi subtitusi Istiany, ari dkk. 2009. Buku Pedomanyang sifatnya lebih untuk melengkapi, Skripsi. Jakarta: FT UNJ Pressbukan menggantikan peran guru secarakeseluruhan. Secara khusus, tipe Kusumah, Wijaya. 2010. Mengenalpembelajaran STAD bertujuan untuk Penelitian Tindakan Kelas. Jakarta:mengembangkan keterampilan berpikir PT. Indekskritis dan kerja sama kelompok. Maliki, Imam. 2006. Fun Teaching KiatDAFTAR PUSTAKA sukses Belajar dan Mengajar yangPeningkatan Hasil Belajar Menerapkan Dasar – Dasar Elektronika Melalui Pembelajaran CooperativeLearning Tipe STAD (Student Team Achievement Division) Di SMKN 5 Jakarta (Wulandari, Dr.Yuliatri Sastrawijaya)
  10. 10. Menyenangkan. Jakarta: Duha Khasanah.Made Wena.2009.Strategi Pembelajaran Inovatif Kontemporer Suatu Tinjauan Konseptual Operasional. Jakarta: Bumi Aksara.Muhadjito, 2005.Model-model PTK, Diklat Penelitian Tindakan Kelas, Bogor.Malvino. 1996. Prinsip-prinsip Elektronika Edisi Ketiga. Jakarta: ErlanggaOemar Hamalik. 2002. Perencanaan Pengajaran. Jakarta: Bumi Aksara.Siregar, Evelin dan Nara.2007. Teori Belajar dan Pembelajaran.Jakarta :Erlangga.Sanjaya, Wina. 2006. Strategi Pembelajaran.Jakarta : Kencana.Sanjaya, Wina. 2008. Strategi Pembelajaran Berorientasi Standar Proses Pendidikan. Jakarta: Kencana.Suharsimi Arikunto, Suhardjono dan Supardi. 2008.Penelitian Tindakan Kelas. Jakarta: Bumi Aksara.Sukama, Nana Syaodih. 2005. Metode Penelitian Pendidikan. Bandung: Remaja Rosdakarya.Trianto.2010. Mendesain Model Pembelajaran Inovatif- Progresif.Jakarta : PT. Kencana.Tim Redaksi. 1995. Kamus Besar Bahasa Indonesia. Jakarta: Balai Pustaka.Undang Gunawan. 2008. Teknik Penelitian Tindakan Kelas. Bandung: Sayatagama. PEVOTE. Volume 6 No.11

×