KONSEP MOTIVASI DASAR<br />PERILAKU ORGANISASI<br />PROGRAM STUDI AKUNTANSI<br />andiiswoyo<br />download this slide on<br...
TIK<br />Menjelaskanprosesmotivasidasar<br />Menjabarkanteorihierarkikebutuhanmotivasi<br />MembandingkanTeori X danTeori ...
Dari sisiperilaku yang ditampilkanorang, orangyang termotivasiakanmelakukanusaha yang lebihbesardaripada yang tidak. Defin...
Doronganinimenghasilkansuatupencarianuntukmenemukantujuan-tujuantertentu yang jikatercapaiakanmemuaskankebutuhandanmenyeba...
Tigateorikhususdiformulasikandekadetahun 1950,mengenai motivasikaryawan, meskiakhir-akhiriniseringdikecamdanvaliditasnyadi...
Pendekatan Abraham Maslow terkaitdenganmotivasi yang diterimasecaraluas, Maslow membuathipotesisbahwadalamdirisetiapmanusi...
Maslow memisahkan lima kebutuhankedalamurutanlebihtinggidanlebihrendah. Kebutuhanfisikdan rasa amandigambarkansebagaiuruta...
Teoriinimemangbanyakdigunakanolehkalanganmanajerpraktisi, karenalogisdansederhanasehinggadapatdipahamisecaraintuitif, hany...
Douglas McGregor mengajukan dua pandangan mengenai manusia: seseorang pada dasarnya bersifat negatif, diberi nama Teori X,...
Terdapatempatasumsi yang diyakini:<br />Karyawantidaksukabekerjadanbilamanamungkin, akanberusahamenghindarinya.<br />Karen...
Terdapatempatasumsiberlawanan yang diyakiniolehmanajer:<br />Karyawanmenandangpekerjaansamaalami-yahnyadenganistirahatdanb...
Implikasimotivasionalmenerimaanalisis McGregor akansangatbaikjikakitamenggunakankerangka yang disajikan Maslow.<br />Teori...
Sayangnya, belumadabukti yang menegaskanbahwaasumsi - asumsitersebutbersifat valid, jugabelumterbuktibahwapenerimaanterhad...
TeoriinidiajukanolehFrederick Herzberg ahlipsikologi yang berkeyakinanbahwahubunganindividudenganpekerjaanadalahsuatu yang...
Dari jawaban-2 yang telahdikategorisasikan, disimpulkanoleh Herzberg, ketikaorangmerasabaiktentangpekerjaanmerekabenar-ben...
Menurut Herzberg, faktor-faktor yang memberikankepuasankerjaterpisahdanberbedadengan yang memberikanketidakpuasankerja. Ma...
Teori ini tidak konsisten dengan penelitian sebelumnya, karena teori ini mengabaikan variabel-variabel situasional.<br />H...
David McClellend dkk mengajukan tiga motif atau kebutuhan utama yang relevan ditempat kerja:<br />1. Kebutuhan akan presta...
Dari penelitian mengenai kebutuhan untuk berprestasi, ditemukan bahwa orang-orang yang berprestasi membedakan diri mereka ...
Kebutuhan akan kekuasaan adalah hasrat untuk mendapatkan pengaruhdan mengen-dalikan orang lain. Individu yang memiliki kek...
Kebutuhan ini paling sedikit mendapat perhatian peneliti. Afiliasi adalah hasrat untuk disukai dan diterima oleh orang lai...
Beberapaprediksi yang cukupmendapatdukungandapatdibuatpadahubunganantarakebutuhanakanprestasidenganprestasikerja, dansedik...
Penjelasan yang paling konprehensipmengenaimotivasiadalahteoriekspektasi yang menyatakanbahwakekuatandarikecenderunganuntu...
3. Kaitanupaya – kinerja: Probabilitas yang diper-kirakanolehindividubahwadenganmenggunakansejumlahupayatertentuakanmengha...
Pertama: Outcomeapa yang ditawarkanolehpe-kerjaanpadakaryawan? Bisa outcome positifataunegatif. Yang terpentingkenyataanti...
Outcometersebuttidakmungkinmempunyaiefekpadakinerjakaryawanindividukecualikalaukaryawantersebuttahudenganjelastanpakeragua...
Pertama : Teori ini memberi tekanan pada pembayaran, atau penghargaan yang sejalan dengan apa yang diinginkan karyawan. Te...
MOTIVASI: DARI KONSEP KEAPLIKASI<br />Management By Objectives<br />ModifikasiPerilaku<br />Program KeterlibatanKaryawan<b...
Upcoming SlideShare
Loading in …5
×

Chapter 4 konsep motivasi dasar

3,578 views

Published on

Menjelaskan proses motivasi dasar
Menjabarkan teori hierarki kebutuhan motivasi
Membandingkan Teori X dan Teori Y
Membedakan motivator-motivator dari faktor higienis
Membuat daftar karakter yang sangat disukai orang-orang yang berprestasi dalam sebuah pekerjaan
Merangkum jenis tujuan yang meningkatkan kinerja
Membandingkan teori goal-setting dan reinforcement
Menjalankan teori equity
Menjelaskan hubungan kunci dalam teori ekspektasi

1 Comment
2 Likes
Statistics
Notes
No Downloads
Views
Total views
3,578
On SlideShare
0
From Embeds
0
Number of Embeds
2
Actions
Shares
0
Downloads
134
Comments
1
Likes
2
Embeds 0
No embeds

No notes for slide

Chapter 4 konsep motivasi dasar

  1. 1. KONSEP MOTIVASI DASAR<br />PERILAKU ORGANISASI<br />PROGRAM STUDI AKUNTANSI<br />andiiswoyo<br />download this slide on<br />http://www.slideshare.net/andiazka<br />
  2. 2. TIK<br />Menjelaskanprosesmotivasidasar<br />Menjabarkanteorihierarkikebutuhanmotivasi<br />MembandingkanTeori X danTeori Y<br />Membedakan motivator-motivator darifaktorhigienis<br />Membuatdaftarkarakter yang sangatdisukaiorang-orang yang berprestasidalamsebuahpekerjaan<br />Merangkumjenistujuan yang meningkatkankinerja<br />Membandingkanteorigoal-setting dan reinforcement<br />Menjalankanteoriequity<br />Menjelaskanhubungankuncidalamteoriekspektasi<br />
  3. 3. Dari sisiperilaku yang ditampilkanorang, orangyang termotivasiakanmelakukanusaha yang lebihbesardaripada yang tidak. Definisiinirelatifdanhanyamemberikansedikitpenjelasankepadakita.<br />Definisiyang deskriptifnamunkurangsubstantifmangatakanbahwamotivasiadalahkeinginanuntukmelakukansesuatu yang menentukankemampuanbertindakuntukmemuaskankebutuhanindividu. <br />Suatukebutuhan (needs), dalamterminologikami, berartisesuatukekurangansecarafisikataupsikologis yang membuatkeluarantertentuterlihatmenarik. Suatukebutuhan yang tidakterpenuhimenciptakanketegangan, sehinggamerangsangdorongan pd diri. <br />APAKAH MOTIVASI ITU<br />
  4. 4. Doronganinimenghasilkansuatupencarianuntukmenemukantujuan-tujuantertentu yang jikatercapaiakanmemuaskankebutuhandanmenyebabkanpenurunanketegangan.<br />Karyawan yang termotivasiberadadalamsuatukondisitertekan. Untukmengurangiketeganganini, merekamelakukanaktifitas. Semakinbesartekanan, semakinbanyakaktifitas yang dibutuhkanuntukmengurangiketegangantersebut. Olehkarenaitu, ketikakitamelihatkaryawanbekerjakerasmelaksanakanaktifitasnya, kitadapatmenyimpulkanbahwamerekadidorongolehkeinginanuntukmencapaitujuan yang merekainginkan.<br />
  5. 5. Tigateorikhususdiformulasikandekadetahun 1950,mengenai motivasikaryawan, meskiakhir-akhiriniseringdikecamdanvaliditasnyadipertanyakan, ketigateoritersebutadalah: teoriheirarkikebutuhan, teori X danteori Y, danteorimotivasihigienis. <br />Sejakitudikembangkanpenjelasan-penjelasan yang lebih valid tentangmotivasi (dikenalsebagaiteorikontemporer) berlandaskanketigateoritersebut.<br />TEORI MOTIVASI AWAL<br />
  6. 6. Pendekatan Abraham Maslow terkaitdenganmotivasi yang diterimasecaraluas, Maslow membuathipotesisbahwadalamdirisetiapmanusiaterdapat lima tingkatankebutuhanyaitu:<br />Kebutuhanfisik: meliputilapar, haus, tempatbernaung, seks, dankebutuhan-kebutuhantubuhlainnya.<br />Kebutuhanrasa aman: meliputikeamanandanperlindungandaribahayafisikdanemosi.<br />Kebutuhansosial: Meliputikasihsayang, rasa memiliki, penerimaandanpersahabatan.<br />Kebutuhanpenghargaan: meliputi faktor-2 internal sepertihargadiri, otonomi, danprestasi,serta faktor-2 eksternalseperti status, pengakuan, danperhatian.<br />Kebutuhanaktualisasidiri: Doronganuntukmenjadiapa yang mampuialakukan; meliputipertumbuhan, pencapaianpotensidiri, danpemenuhankebutuhandirisendiri. <br />TEORI HIERARKI KEBUTUHAN<br />
  7. 7.
  8. 8. Maslow memisahkan lima kebutuhankedalamurutanlebihtinggidanlebihrendah. Kebutuhanfisikdan rasa amandigambarkansebagaiurutan yang lebihrendah; sosial, penghargaandanaktualisasidiri, dikategorikansebagaikebutuhan yang lebihtinggi. <br />Duaurutantersebutdibedakanatasdasarpemikiranbahwakebutuhantingkattinggiterpuaskansecara internal, sedangkankebutuhantingkatrendahterutamaterpuaskansecaraeksternal (denganhal-halsepertiupah, kontrakserikatkerjadanjabatan). <br />Dari sudutmotivasi, teoriiniinginmengatakanbahwameskitakadakebutuhan yang terpenuhiseutuhnya, namunjikasebagianbesarkebutuhanterpunuhi, tidakakanlagimemberikanmotivasi. <br />PENJELASAN TEORI MASLOW<br />
  9. 9. Teoriinimemangbanyakdigunakanolehkalanganmanajerpraktisi, karenalogisdansederhanasehinggadapatdipahamisecaraintuitif, hanyasajasedikitdukunganditemukanatasteoritersebut yang memprediksikanbahwastrukturkebutuhandiorganisasikansejalandengandimensi yang diajukanoleh Maslow.<br />Jadi, walaupunhierarkibetuhanba-nyakdigunakanolehmanajersebagai pan-duanuntukmemotivasikaryawanmereka, sesungguhnyahanyasedikitbukti yang menunjukkankeberhasilanpeningkatannya. <br />KRITIK TERHADAP TEORI MASLOW<br />
  10. 10. Douglas McGregor mengajukan dua pandangan mengenai manusia: seseorang pada dasarnya bersifat negatif, diberi nama Teori X, dan yang lainnya bersifat positif, diberi mana teori Y.<br />Melihat cara manajer menghadapi karyawan, McGregor menyimpulkan bahwa pandangan manajer tentang sifat manusia didasarkan pada pengelompokan asumsi tertentu dan manajer tersebut cenderung membentuk perilakunya terhadap bawahan sesuai dengan asumsi tersebut.<br />TEORI X DAN TEORI Y<br />
  11. 11. Terdapatempatasumsi yang diyakini:<br />Karyawantidaksukabekerjadanbilamanamungkin, akanberusahamenghindarinya.<br />Karenatidaksukabekerja, merekaharusdipaksa, dikendalikanataudiancamdenganhukumanuntukmencapaitujuan yang diinginkan.<br />Karyawanakanmengelaktanggungjawabdansedapatmungkinhanyamengikutiperintah formal.<br />Kebanyakanpekerjamengutamakan rasa aman (agar tidakadaalasanuntukdipecat) diatassemuafaktordanhanyamenunjukkansedikitambisi.<br />DALAM TEORI X<br />
  12. 12. Terdapatempatasumsiberlawanan yang diyakiniolehmanajer:<br />Karyawanmenandangpekerjaansamaalami-yahnyadenganistirahatdanbermain.<br />Seseorang yang memilikikomitmenpadatujuanakanmelakukanpengarahandanpengendaliandiri.<br />Seorang yang biasa-biasasajadapatbelajaruntukmenerima,bahkanmencaritanggungjawab.<br />Kreativitas, - yaitukemampuanuntukmembuatkeputusan yang baik – didelegasikankepadaparakaryawansecaraluasdantidakharusberasaldariorang yang beradadalam manajemen1.. <br />DALAM TEORI Y<br />
  13. 13. Implikasimotivasionalmenerimaanalisis McGregor akansangatbaikjikakitamenggunakankerangka yang disajikan Maslow.<br />Teori X mengasumsikanbahwakebutuhantingkatrendahmendominasiindividudanteori Y meng-asumsikanbahwakebutuhantingkattinggimendominasiindividu. McGregor sendiri, tetappercayabahwaasumsipadateori Y lebih valid daripadaasumsipadateori X. <br />Iamengajukangagasansepertipartisipasidalampengambilankeputusan, pekerjaan yang menantangdanbertangungjawab, danhubungan yang baikdalamkelompoksebagaipendekatan yang akanmemaksimalkanmotivasikerjakaryawan.<br />PENJELASAN TEORI MCGREGOR<br />
  14. 14. Sayangnya, belumadabukti yang menegaskanbahwaasumsi - asumsitersebutbersifat valid, jugabelumterbuktibahwapenerimaanterhadapasumsiteoriY, yang diikutiolehperubahantindakanseseorangakanmeningkatkanmotivasiparapekerja. Kelakakanterbukti, baikasumsi- asumsiteori X ataupunteori Y mungkintepatdalamsituasitertentu. <br />KRITIK TERHADAP TEORI X DAN Y<br />
  15. 15. TeoriinidiajukanolehFrederick Herzberg ahlipsikologi yang berkeyakinanbahwahubunganindividudenganpekerjaanadalahsuatu yang mendasardanbahwasikapseseorangterhadappekerjaanakansangatmenentukankesuksesanataukegagalannya. <br />Iamemulaipenelitiandenganpertanyaan “Apa yang diinginkanseseorangdaripekerjaannya?”. <br />Diamemintakaryawanuntukmenjelaskandenganrincisituasikerja yang membuatmerekamerasaluarbiasabaikatauburuk. Jawaban-jawabaninidibuatdalamtabeldandikelompokkan.<br />TEORI MOTIVASI HIGIENIS<br />
  16. 16. Dari jawaban-2 yang telahdikategorisasikan, disimpulkanoleh Herzberg, ketikaorangmerasabaiktentangpekerjaanmerekabenar-benarberbedadenganjawaban yang diberikanketikamerekamerasaburuk.<br />Faktor-faktorintrinsiksepertipencapaian, pengakuan, pekerjaannyasendiri, tanggungjawabdanpening-katankerjaterlihatberhubungandengankepuasankerja. Responden yang merasapuasdenganpeker-jaannyacenderunguntukmenghubungkanfaktor-faktorinidengandirisendiri,. Sebaliknya, responden yang tidakpuascenderungmenyebutkanfaktor-faktordariluar, seperti: admimindankebijakanperusahaan, kondisikerja, supervisi,danhubunganantarkaryawan.<br />
  17. 17. Menurut Herzberg, faktor-faktor yang memberikankepuasankerjaterpisahdanberbedadengan yang memberikanketidakpuasankerja. Manajer yang menghilangkanfaktor-faktor yang dapatmenciptakanketidakpuasankerjadapatmemberikankedamaiantapibelumtentumemberikanmotivasi. <br />Hasilnya, jika karakteristik-2 sepertiadministrasidankebijakanperusahaan, supervisi, hubunganantarkaryawan, dansituasikerjadangaji yang dicirikan Herzberg sebagaifaktor-faktorhigieniscukupmemadai, orangtidakakanmenjaditidakpuasataupuas. Jikainginmemotivasiorang, Herzberg menyarankanuntukmenekankanpadaprestasi, pengakuan, kerjaitusendiri, tanggungjawandanpertumbuhan. <br />
  18. 18. Teori ini tidak konsisten dengan penelitian sebelumnya, karena teori ini mengabaikan variabel-variabel situasional.<br />Herzberg mengasumsikan hubungan antara kepuasan dengan produktivitas, tetapi meto-dologi penelitian yang ia gunakan melihat hanya pada kepuasan bukan pada produk-tivitas. Untuk membuat riset yang seperti ini relevan, orang harus mengasumsikan suatu hubungan yang kuat antara kepuasan dan produktivitas.<br />KRITIK TEORI HERZBERG<br />
  19. 19. David McClellend dkk mengajukan tiga motif atau kebutuhan utama yang relevan ditempat kerja:<br />1. Kebutuhan akan prestasi: Dorongan untuk unggul, untuk mencapai sederetan standar guna meraih kesuksesan.<br />2. Kebutuhan akan kekuasaan: kebutuhan untuk membuat orang lain berperilaku dengan cara yang diinginkan.<br />3. Kebutuhan akan afiliasi: hasrat akan hubungan persahabatan dan kedekatan antar personal.<br />TEORI-TEORI MOTIVASI KONTEMPORERTEORI TIGA KEBUTUHAN<br />
  20. 20. Dari penelitian mengenai kebutuhan untuk berprestasi, ditemukan bahwa orang-orang yang berprestasi membedakan diri mereka dengan yang lainnya dari hasrat mereka untuk melakukan segala sesuatu dengan lebih baik. Mencari situasi yang dapat memenuhi tanggung jawab pribadi dalam menemukan solusi pemecahan masalah, menerima umpan balik yang cepat dan tidak ambigu tentang kinerja,dan menentukan tujuan yang menantang. <br />KEBUTUHAN AKAN PRESTASI<br />
  21. 21. Kebutuhan akan kekuasaan adalah hasrat untuk mendapatkan pengaruhdan mengen-dalikan orang lain. Individu yang memiliki kekuasaan (nPow) menikmati kewenangan yang dimilikinya, berjuang untuk mempe-ngaruhi orang lain, lebih menyukai situasi persaingan dan berorientasi pada status, serta cenderung untuk lebih manaruh perhatian yang besar terhadap prestise dan pengaruhnya terhadap orang lain daripada kinerja yang efektif. <br />KEBUTUHAN AKAN KEKUASAAN<br />
  22. 22. Kebutuhan ini paling sedikit mendapat perhatian peneliti. Afiliasi adalah hasrat untuk disukai dan diterima oleh orang lain. Individu dengan nAff yang tinggi berusaha keras untuk persahabatan, lebih menyukai situasi kooperatif dari-pada kompetitif, dan hubungan yang melibatkan tingkat saling pengertian yang tinggi.<br />KEBUTUHAN AKAN AFILIASI<br />
  23. 23. Beberapaprediksi yang cukupmendapatdukungandapatdibuatpadahubunganantarakebutuhanakanprestasidenganprestasikerja, dansedikitpenelitiandilakukantentangkebutuhanakankekuasaandanafiliasi, tapiterdapatpenemuan yang konsistendalam area tersebut. Pertama: IndividudengannAch yang tinggimenyukaisituasikerjadengantanggungjawabpribadi, umpanbalik, dantingkatrisiko yang sedang, ketikakarakteristiktersebutterpenuhiorangtersebutsangattermotivasi. Kedua: Orang yang memilikinAch yang tinggi, belumtentumenjaminseseorangmenjadimanajer yang baik.Ketiga: Kebutuhanakanafiliasidankekuasaancenderungsangatberhubungandengankesuksesanmanajerial. <br />SEJUMLAH BESAR PENELITIAN<br />
  24. 24. Penjelasan yang paling konprehensipmengenaimotivasiadalahteoriekspektasi yang menyatakanbahwakekuatandarikecenderunganuntukbertindakdengancaratertentutergantungpadakekuatandarisuatuharapanbahwatindakantersebutakandiikutidenganhasiltertentusertapadadayatarikhasiltersebutbagiindividu. Teoriinimengemukakantigavariabelsebagaiberikut:<br />1.Daya tarik: Pentingnyaindividumengharapkanoutcomedanpenghargaan yang mungkindapatdicapaidalambekerja. <br />2.Kaitan kinerja – penghargaan: Keyakinanindividubahwadenganmenunjukkankinerjapadatingkattertentuakanmencapaioutcome yang diinginkan.<br />TEORI EKSPEKTASI<br />
  25. 25. 3. Kaitanupaya – kinerja: Probabilitas yang diper-kirakanolehindividubahwadenganmenggunakansejumlahupayatertentuakanmenghasilkankinerja.<br />Asumsiutamateoriekspektasi: Kekuatandarimotivsiseseoranguntukmelakukan (upaya) tergantungpadaseberapakuatdiapercayabahwadiadapatmencapaiapa yang diusahakan. Jikadiamencapaitujuanini (kinerja), akankahdiadiberipenghargaansecaramemadai, danjikadiadiberipenghargaanolehorganisasi, akankahpenghargaantersebutmemuas-kantujuanpribadinya?<br />
  26. 26. Pertama: Outcomeapa yang ditawarkanolehpe-kerjaanpadakaryawan? Bisa outcome positifataunegatif. Yang terpentingkenyataantidakrelevendisini; isuutamanyaadalahpersepsikaryawanter-hadap outcome, terlepasdariapapersepsinyaakuratatautidak.<br />Kedua: Seberapabesardayatarik outcome tersebutbagikaryawan? Apakahoutcometersebutdinilaipositif, negatifataunetral? Hal inijelasmerupakanisu internal bagiindividu yang membentuksikap, kepri-badiandankebutuhanindividu.<br />Ketiga: Jenisperilakuapa yang harusditunjukkankaryawanuntukmencapaioutcometersebut? <br />EMPAT LANGKAH TEORI INI<br />
  27. 27. Outcometersebuttidakmungkinmempunyaiefekpadakinerjakaryawanindividukecualikalaukaryawantersebuttahudenganjelastanpakeraguan, apa yang harusdialakukanuntukmencapainya. Contoh; Apa yang dilakukandenganbaikberkaitandenganpenilaiankinerja ? Padakreteriaapakinerjakaryawanakandinilai?<br />Keempat: bagaimanakaryawanmemandangkesem-patan yang diberikankepadanya? Setelahkaryawanmempertimbangkankompetensidiridankemampuan-nyauntukmengendalikanvariabel-veriabel yang akanmenentukankesuksesannya, kemungkinanapa yang diharapkandarikesuksesannya?.<br />
  28. 28. Pertama : Teori ini memberi tekanan pada pembayaran, atau penghargaan yang sejalan dengan apa yang diinginkan karyawan. Teori ini berdasar pada kepentingan sendiri untuk memaksimalkan kepuasan individu dengan memberikan penghargaan yang dinilai positif.<br />Kedua: Teori ekspektasi menekankan pada perilaku-perilaku yang diharapkan. Apakah orang mengetahui apa yang diharapkan darinya dan bagaimana dia dinilai? Terakhir, teori tersebut menaruh perhatian besar pada harapan-harapan individu. <br />Beberapaisu yang dikemukakanteoriekspektasi<br />
  29. 29. MOTIVASI: DARI KONSEP KEAPLIKASI<br />Management By Objectives<br />ModifikasiPerilaku<br />Program KeterlibatanKaryawan<br />Program VariabelPembayaran<br />PerencanaanPembayaranBerbasisKeterampilan<br />ImplikasiBagiManajer<br />PERTEMUAN BERIKUT<br />

×