COT 6930 HPC and Bioinformatics Bioinformatics Resources and Databases sree
DNA RNA cDNA ESTs UniGene phenotype Genomic DNA Databases  Protein  sequence  databases protein Protein  structure  databa...
Gene
Different transcripts can be related to the same gene !
EST <ul><li>Expressed Sequence Tags </li></ul><ul><li>Partial copies of mRNA found within a particular cell </li></ul><ul>...
Outline <ul><li>Bioinformatics Databases  </li></ul><ul><ul><li>Primary databases </li></ul></ul><ul><ul><li>Derived datab...
Bioinformatics Databases <ul><li>Information </li></ul><ul><ul><li>DNA sequences </li></ul></ul><ul><ul><li>Conserved DNA ...
Primary public domain bioinformatics servers Public Domain Bioinformatics Facilities European Bioinformatics Institute (EB...
Major Databases <ul><li>DNA sequences </li></ul><ul><ul><li>GenBank, RefSeq, UniGene </li></ul></ul><ul><li>Protein sequen...
Bioinformatics Data Sources <ul><li>Primary databases </li></ul><ul><ul><li>Original submissions by researchers </li></ul>...
Bioinformatics Data Sources <ul><li>Derived databases </li></ul><ul><ul><li>Compiled from data in primary databases </li><...
Outline <ul><li>Bioinformatics Databases  </li></ul><ul><ul><li>Primary databases </li></ul></ul><ul><ul><li>Derived datab...
Bioinformatic Databases – GenBank <ul><li>“ GenBank is the NIH genetic sequence database, an annotated collection of all p...
Bioinformatic Databases – GenBank <ul><li>Types of submissions to database </li></ul><ul><ul><li>Genomic DNA </li></ul></u...
Bioinformatic Databases – EMBL-Bank <ul><li>Europe's primary nucleotide sequence resource  </li></ul><ul><li>Primary datab...
Outline <ul><li>Bioinformatics Databases  </li></ul><ul><ul><li>Primary databases </li></ul></ul><ul><ul><li>Derived datab...
Bioinformatic Databases – Proteins <ul><li>Protein sequence databases </li></ul><ul><ul><li>Once derived from laboratory e...
Bioinformatic Databases – Swiss-Prot, PIR-PSD <ul><li>Database type </li></ul><ul><ul><li>Protein sequences </li></ul></ul...
Bioinformatic Databases – GenPept, TrEMBL <ul><li>Database type </li></ul><ul><ul><li>Protein sequences </li></ul></ul><ul...
Structure Databases <ul><li>3-dimensional structures of proteins, nucleic acids, molecular complexes etc </li></ul><ul><ul...
Protein Data Bank: PDB
 
Bioinformatic Databases – Connections
Outline <ul><li>Bioinformatics Databases  </li></ul><ul><ul><li>Primary databases </li></ul></ul><ul><ul><li>Derived datab...
Bioinformatic Databases – RefSeq <ul><li>The Reference Sequence (RefSeq) collection aims to provide a comprehensive, integ...
Bioinformatic Databases – UniGene <ul><li>UniGene is an experimental system for automatically partitioning GenBank sequenc...
<ul><li>Database type </li></ul><ul><ul><li>Biomedical papers </li></ul></ul><ul><ul><li>Manually curated database </li></...
Bioinformatic Databases – Others <ul><li>Gene expression </li></ul><ul><ul><li>ArrayExpress, Gene Expression Omnibus (GEO)...
Bioinformatic Databases: SNP Database <ul><li>Single Nucleotide Polymorphisms (SNPs) </li></ul><ul><li>Single base differe...
Sickle Cell Anemia <ul><li>Due to 1 swapping an A for a T, causing inserted amino acid to be valine instead of glutamine i...
Healthy Individual <ul><li>>gi|28302128|ref|NM_000518.4| Homo sapiens hemoglobin, beta (HBB), mRNA </li></ul><ul><li>ACATT...
Diseased Individual <ul><li>>gi|28302128|ref|NM_000518.4| Homo sapiens hemoglobin, beta (HBB), mRNA </li></ul><ul><li>ACAT...
Disease Databases <ul><li>Genes are involved in disease </li></ul><ul><li>Many diseases are well studied </li></ul><ul><li...
 
Putting it All Together <ul><li>Each Database contains specific information </li></ul><ul><li>Like other biological system...
GENOMIC DATA GenBank DDBJ EMBL ASSEMBLED GENOMES GoldenPath WormBase TIGR PROTEIN PIR SWISS-PROT STRUCTURE PDB MMDB SCOP L...
Where to get started? NCBI ENTREZ <ul><li>A search engine that provides access and links between various databases </li></...
Outline <ul><li>Bioinformatics Databases  </li></ul><ul><ul><li>Primary databases </li></ul></ul><ul><ul><li>Derived datab...
Upcoming SlideShare
Loading in …5
×

Biodatabases 101220022654-phpapp02

1,610 views
1,512 views

Published on

Published in: Education
0 Comments
0 Likes
Statistics
Notes
  • Be the first to comment

  • Be the first to like this

No Downloads
Views
Total views
1,610
On SlideShare
0
From Embeds
0
Number of Embeds
4
Actions
Shares
0
Downloads
60
Comments
0
Likes
0
Embeds 0
No embeds

No notes for slide

Biodatabases 101220022654-phpapp02

  1. 1. COT 6930 HPC and Bioinformatics Bioinformatics Resources and Databases sree
  2. 2. DNA RNA cDNA ESTs UniGene phenotype Genomic DNA Databases Protein sequence databases protein Protein structure databases transcription translation Gene expression database
  3. 3. Gene
  4. 4. Different transcripts can be related to the same gene !
  5. 5. EST <ul><li>Expressed Sequence Tags </li></ul><ul><li>Partial copies of mRNA found within a particular cell </li></ul><ul><li>Can be used to identify genitc regions; splicing patterns of genes; etc </li></ul>
  6. 6. Outline <ul><li>Bioinformatics Databases </li></ul><ul><ul><li>Primary databases </li></ul></ul><ul><ul><li>Derived databases </li></ul></ul><ul><li>Nucleotide databases </li></ul><ul><ul><li>GenBank (P), EMBL-Bank (P) </li></ul></ul><ul><li>Protein databases </li></ul><ul><ul><li>Swiss-Prot (D), PIR-PSD (D) </li></ul></ul><ul><ul><li>GenPept (D), TrEMBL (D) </li></ul></ul><ul><ul><li>Protein Data Bank (P) </li></ul></ul><ul><li>Other Examples </li></ul><ul><ul><li>RefSeq </li></ul></ul><ul><ul><li>UniGene </li></ul></ul><ul><ul><li>PubMed </li></ul></ul><ul><ul><li>SNP </li></ul></ul><ul><ul><li>OMIM </li></ul></ul>
  7. 7. Bioinformatics Databases <ul><li>Information </li></ul><ul><ul><li>DNA sequences </li></ul></ul><ul><ul><li>Conserved DNA domains </li></ul></ul><ul><ul><li>Genomes </li></ul></ul><ul><ul><li>Gene expression (ESTs, microarrays) </li></ul></ul><ul><ul><li>Protein sequences </li></ul></ul><ul><ul><li>Protein 3D structure </li></ul></ul><ul><ul><li>Protein families </li></ul></ul><ul><ul><li>Mutations / polymorphisms / SNPs </li></ul></ul><ul><ul><li>Metabolic pathways </li></ul></ul><ul><ul><li>Chemical compounds (ligands) </li></ul></ul><ul><ul><li>Biomedical literature (journal papers, online books…) </li></ul></ul>
  8. 8. Primary public domain bioinformatics servers Public Domain Bioinformatics Facilities European Bioinformatics Institute (EBI) United Kingdom National Center For Biotechnology Information (NCBI) United States Genome Net (KEGG & DDBJ) Japan Databases Analysis Tools Databases Analysis Tools Databases Analysis Tools
  9. 9. Major Databases <ul><li>DNA sequences </li></ul><ul><ul><li>GenBank, RefSeq, UniGene </li></ul></ul><ul><li>Protein sequences </li></ul><ul><ul><li>Swiss-Prot, PIR-PSD, GenPept, TrEMBL, RefSeq </li></ul></ul><ul><li>Protein structure </li></ul><ul><ul><li>Protein Data Bank (PDB) </li></ul></ul><ul><li>Gene expression </li></ul><ul><ul><li>Gene Expression Omnibus (GEO) </li></ul></ul><ul><li>Biomedical publications </li></ul><ul><ul><li>PubMed / MedLine </li></ul></ul>
  10. 10. Bioinformatics Data Sources <ul><li>Primary databases </li></ul><ul><ul><li>Original submissions by researchers </li></ul></ul><ul><ul><li>Staff organizes information only </li></ul></ul><ul><ul><li>Generally sequence oriented </li></ul></ul><ul><ul><li>Examples </li></ul></ul><ul><ul><ul><li>GenBank, PDB (Protein Data Bank) </li></ul></ul></ul>
  11. 11. Bioinformatics Data Sources <ul><li>Derived databases </li></ul><ul><ul><li>Compiled from data in primary databases </li></ul></ul><ul><ul><li>Manually curated (human selection & correction) </li></ul></ul><ul><ul><ul><li>Advantages – high quality </li></ul></ul></ul><ul><ul><ul><li>Disadvantages – high expense, low volume </li></ul></ul></ul><ul><ul><ul><li>Examples </li></ul></ul></ul><ul><ul><ul><ul><li>Swiss-Prot, PIR-PSD, RefSeq </li></ul></ul></ul></ul><ul><ul><li>Computational derivation (automatically generated) </li></ul></ul><ul><ul><ul><li>Advantages – inexpensive, up-to-date </li></ul></ul></ul><ul><ul><ul><li>Disadvantages – lower quality </li></ul></ul></ul><ul><ul><ul><li>Examples </li></ul></ul></ul><ul><ul><ul><ul><li>GenPept, TrEMBL, UniGene </li></ul></ul></ul></ul>
  12. 12. Outline <ul><li>Bioinformatics Databases </li></ul><ul><ul><li>Primary databases </li></ul></ul><ul><ul><li>Derived databases </li></ul></ul><ul><li>Nucleotide databases </li></ul><ul><ul><li>GenBank (P), EMBL-Bank (P) </li></ul></ul><ul><li>Protein databases </li></ul><ul><ul><li>Swiss-Prot (D), PIR-PSD (D) </li></ul></ul><ul><ul><li>GenPept (D), TrEMBL (D) </li></ul></ul><ul><ul><li>Protein Data Bank (P) </li></ul></ul><ul><li>Other Examples </li></ul><ul><ul><li>RefSeq </li></ul></ul><ul><ul><li>UniGene </li></ul></ul><ul><ul><li>PubMed </li></ul></ul><ul><ul><li>SNP </li></ul></ul><ul><ul><li>OMIM </li></ul></ul>
  13. 13. Bioinformatic Databases – GenBank <ul><li>“ GenBank is the NIH genetic sequence database, an annotated collection of all publicly available DNA sequences” </li></ul><ul><li>Database type </li></ul><ul><ul><li>Nucleotide sequences </li></ul></ul><ul><ul><li>Primary database </li></ul></ul><ul><li>Current Size (As of Aug. 2006): </li></ul><ul><ul><li>65,369,091,950 (bps) </li></ul></ul><ul><ul><li>61,132,599 (sequences) </li></ul></ul><ul><li>Access to GenBank </li></ul><ul><ul><li>Available for searching at NCBI via several methods </li></ul></ul><ul><ul><ul><li>Such as BLAST search </li></ul></ul></ul><ul><ul><li>http:// www.ncbi.nlm.nih.gov/Genbank / </li></ul></ul>
  14. 14. Bioinformatic Databases – GenBank <ul><li>Types of submissions to database </li></ul><ul><ul><li>Genomic DNA </li></ul></ul><ul><ul><ul><li>High quality complete DNA sequence </li></ul></ul></ul><ul><ul><li>mRNA / cDNA </li></ul></ul><ul><ul><ul><li>Partial or complete mRNA (or cDNA) </li></ul></ul></ul><ul><ul><li>Expressed sequence tag (EST) </li></ul></ul><ul><ul><ul><li>A short sub-sequence of a transcribed spliced nucleotide sequence (mRNA) (500-800bps) </li></ul></ul></ul><ul><ul><ul><ul><li>May represent portions of expressed genes </li></ul></ul></ul></ul><ul><ul><ul><ul><li>Either protein-coding or not </li></ul></ul></ul></ul><ul><ul><ul><ul><li>About 43 million ESTs are now available </li></ul></ul></ul></ul><ul><ul><li>Sequence tagged sites (STS) </li></ul></ul><ul><ul><ul><li>Short DNA sequences unique in genome </li></ul></ul></ul><ul><ul><li>Genomic survey sequence (GSS) </li></ul></ul><ul><ul><ul><li>Single-pass genomic DNA </li></ul></ul></ul><ul><ul><li>Third-party annotations of GenBank sequences </li></ul></ul>
  15. 15. Bioinformatic Databases – EMBL-Bank <ul><li>Europe's primary nucleotide sequence resource </li></ul><ul><li>Primary databases </li></ul><ul><li>Database type </li></ul><ul><ul><li>Nucleotide sequences </li></ul></ul><ul><ul><li>Primary database </li></ul></ul><ul><li>http://www.ebi.ac.uk/embl/ </li></ul>
  16. 16. Outline <ul><li>Bioinformatics Databases </li></ul><ul><ul><li>Primary databases </li></ul></ul><ul><ul><li>Derived databases </li></ul></ul><ul><li>Nucleotide databases </li></ul><ul><ul><li>GenBank (P), EMBL-Bank (P) </li></ul></ul><ul><li>Protein databases </li></ul><ul><ul><li>Swiss-Prot (D), PIR-PSD (D) </li></ul></ul><ul><ul><li>GenPept (D), TrEMBL (D) </li></ul></ul><ul><ul><li>Protein Data Bank (P) </li></ul></ul><ul><li>Other Examples </li></ul><ul><ul><li>RefSeq </li></ul></ul><ul><ul><li>UniGene </li></ul></ul><ul><ul><li>PubMed </li></ul></ul><ul><ul><li>SNP </li></ul></ul><ul><ul><li>OMIM </li></ul></ul>
  17. 17. Bioinformatic Databases – Proteins <ul><li>Protein sequence databases </li></ul><ul><ul><li>Once derived from laboratory experiments </li></ul></ul><ul><ul><li>Now mostly based on predicted ORFs from DNA </li></ul></ul><ul><ul><ul><li>Manual curation </li></ul></ul></ul><ul><ul><ul><ul><li>Swiss-Prot </li></ul></ul></ul></ul><ul><ul><ul><ul><li>PIR-PSD </li></ul></ul></ul></ul><ul><ul><ul><li>Computational derivation </li></ul></ul></ul><ul><ul><ul><ul><li>GenPept </li></ul></ul></ul></ul><ul><ul><ul><ul><li>TrEMBL </li></ul></ul></ul></ul>
  18. 18. Bioinformatic Databases – Swiss-Prot, PIR-PSD <ul><li>Database type </li></ul><ul><ul><li>Protein sequences </li></ul></ul><ul><ul><li>Derived database </li></ul></ul><ul><ul><ul><li>Manually curated (non-redundant, annotated) </li></ul></ul></ul><ul><li>Many annotations </li></ul><ul><ul><li>Functions of the protein </li></ul></ul><ul><ul><li>Domains and sites </li></ul></ul><ul><ul><li>Secondary & quaternary structure </li></ul></ul><ul><ul><li>Similarities to other proteins </li></ul></ul><ul><ul><li>Variants </li></ul></ul><ul><li>Swiss-Prot </li></ul><ul><ul><li>http://ca.expasy.org/sprot/ </li></ul></ul><ul><li>PIR-PSD </li></ul><ul><ul><li>http:// pir.georgetown.edu/pirwww/dbinfo/pir_psd.shtml </li></ul></ul>
  19. 19. Bioinformatic Databases – GenPept, TrEMBL <ul><li>Database type </li></ul><ul><ul><li>Protein sequences </li></ul></ul><ul><ul><li>Computationally derived database </li></ul></ul><ul><ul><li>Predicted (translating) coding sequences (CDS) from GenBank, EMBL (i.e., gene product) </li></ul></ul><ul><li>GenPept </li></ul><ul><ul><li>Download: ftp://ftp.ncifcrf.gov/pub/genpept/ </li></ul></ul><ul><ul><li>Release 163 (as of 12/26/2007) </li></ul></ul><ul><ul><ul><li>4,970,178 loci containing 1,517,599,916 residues </li></ul></ul></ul><ul><li>TrEMBL </li></ul><ul><ul><li>http:// www.ebi.ac.uk/trembl/index.html </li></ul></ul>
  20. 20. Structure Databases <ul><li>3-dimensional structures of proteins, nucleic acids, molecular complexes etc </li></ul><ul><ul><li>3-d data is available due to techniques such as NMR and X-Ray crystallography </li></ul></ul><ul><ul><li>Protein Data Bank </li></ul></ul><ul><ul><ul><li>Protein 3D structures </li></ul></ul></ul><ul><ul><ul><li>Primary database </li></ul></ul></ul><ul><ul><ul><li>( http://www.rcsb.org/pdb/home/home.do ) </li></ul></ul></ul>
  21. 21. Protein Data Bank: PDB
  22. 23. Bioinformatic Databases – Connections
  23. 24. Outline <ul><li>Bioinformatics Databases </li></ul><ul><ul><li>Primary databases </li></ul></ul><ul><ul><li>Derived databases </li></ul></ul><ul><li>Nucleotide databases </li></ul><ul><ul><li>GenBank (P), EMBL-Bank (P) </li></ul></ul><ul><li>Protein databases </li></ul><ul><ul><li>Swiss-Prot (D), PIR-PSD (D) </li></ul></ul><ul><ul><li>GenPept (D), TrEMBL (D) </li></ul></ul><ul><ul><li>Protein Data Bank (P) </li></ul></ul><ul><li>Other Examples </li></ul><ul><ul><li>RefSeq </li></ul></ul><ul><ul><li>UniGene </li></ul></ul><ul><ul><li>PubMed </li></ul></ul><ul><ul><li>SNP </li></ul></ul><ul><ul><li>OMIM </li></ul></ul>
  24. 25. Bioinformatic Databases – RefSeq <ul><li>The Reference Sequence (RefSeq) collection aims to provide a comprehensive, integrated, non-redundant set of sequences , including genomic DNA, transcript (RNA), and protein products. </li></ul><ul><ul><li>Information derived from GenBank records </li></ul></ul><ul><li>Database type </li></ul><ul><ul><li>Nucleotide & protein sequences </li></ul></ul><ul><ul><li>Derived database </li></ul></ul><ul><ul><ul><li>Human curated (non-redundant, cross-linked) </li></ul></ul></ul><ul><li>Data in RefSeq </li></ul><ul><ul><li>Genomic DNA </li></ul></ul><ul><ul><li>mRNAs & proteins for known genes, gene models </li></ul></ul><ul><ul><li>Entire chromosomes </li></ul></ul><ul><ul><li>Multiple organisms </li></ul></ul><ul><li>http://www.ncbi.nlm.nih.gov/projects/RefSeq/ </li></ul><ul><li>Example </li></ul><ul><ul><li>http://www.ncbi.nlm.nih.gov/entrez/viewer.fcgi?val=NP_015325 </li></ul></ul>
  25. 26. Bioinformatic Databases – UniGene <ul><li>UniGene is an experimental system for automatically partitioning GenBank sequences into a non-redundant set of gene-oriented clusters </li></ul><ul><li>Each UniGene cluster contains sequences that represent a unique gene, as well as related information such as the tissue types in which the gene has been expressed and map location </li></ul><ul><li>Database type </li></ul><ul><ul><li>Nucleotide sequences </li></ul></ul><ul><ul><li>Computationally derived database </li></ul></ul><ul><ul><ul><li>Partitioned into non-redundant gene-oriented clusters </li></ul></ul></ul><ul><ul><li>Gene-oriented view </li></ul></ul><ul><li>Data in UniGene </li></ul><ul><ul><li>Clusters of genomic DNA & ESTs </li></ul></ul><ul><ul><li>Multiple organisms </li></ul></ul><ul><li>http://www.ncbi.nlm.nih.gov/sites/entrez?db=unigene </li></ul>
  26. 27. <ul><li>Database type </li></ul><ul><ul><li>Biomedical papers </li></ul></ul><ul><ul><li>Manually curated database </li></ul></ul><ul><li>Service of the National Library of Medicine </li></ul><ul><ul><li>MEDLINE publication database </li></ul></ul><ul><ul><ul><li>Over 17,000 journals </li></ul></ul></ul><ul><ul><ul><li>15 million citations since 1950 </li></ul></ul></ul><ul><li>http :// www . ncbi . nlm . nih . gov / PubMed / </li></ul>Bioinformatic Databases – PubMed
  27. 28. Bioinformatic Databases – Others <ul><li>Gene expression </li></ul><ul><ul><li>ArrayExpress, Gene Expression Omnibus (GEO) </li></ul></ul><ul><li>Multi-organism genomes </li></ul><ul><ul><li>Entrez Genome, HomoloGene, COGs, TIGR </li></ul></ul><ul><li>Genetic variation & genetic diseases </li></ul><ul><ul><li>dbSNP, OMIM, CGAP </li></ul></ul><ul><li>Metabolic pathways </li></ul><ul><ul><li>WIT, KEGG </li></ul></ul><ul><li>Many more… </li></ul><ul><ul><li>Listed in journal “Nucleic Acids Research” each January </li></ul></ul>
  28. 29. Bioinformatic Databases: SNP Database <ul><li>Single Nucleotide Polymorphisms (SNPs) </li></ul><ul><li>Single base difference in a single position among two different individuals of the same species </li></ul><ul><li>Play an important role in differentiation and disease </li></ul><ul><li>http://www.ncbi.nlm.nih.gov/projects/SNP/ </li></ul>
  29. 30. Sickle Cell Anemia <ul><li>Due to 1 swapping an A for a T, causing inserted amino acid to be valine instead of glutamine in hemoglobin </li></ul>Image source: http://www.cc.nih.gov/ccc/ccnews/nov99/
  30. 31. Healthy Individual <ul><li>>gi|28302128|ref|NM_000518.4| Homo sapiens hemoglobin, beta (HBB), mRNA </li></ul><ul><li>ACATTTGCTTCTGACACAACTGTGTTCACTAGCAACCTCAAACAGACACC ATG GTGCATCTGACTCCTGA </li></ul><ul><li>G G A G AAGTCTGCCGTTACTGCCCTGTGGGGCAAGGTGAACGTGGATGAAGTTGGTGGTGAGGCCCTGGGC </li></ul><ul><li>AGGCTGCTGGTGGTCTACCCTTGGACCCAGAGGTTCTTTGAGTCCTTTGGGGATCTGTCCACTCCTGATG </li></ul><ul><li>CTGTTATGGGCAACCCTAAGGTGAAGGCTCATGGCAAGAAAGTGCTCGGTGCCTTTAGTGATGGCCTGGC </li></ul><ul><li>TCACCTGGACAACCTCAAGGGCACCTTTGCCACACTGAGTGAGCTGCACTGTGACAAGCTGCACGTGGAT </li></ul><ul><li>CCTGAGAACTTCAGGCTCCTGGGCAACGTGCTGGTCTGTGTGCTGGCCCATCACTTTGGCAAAGAATTCA </li></ul><ul><li>CCCCACCAGTGCAGGCTGCCTATCAGAAAGTGGTGGCTGGTGTGGCTAATGCCCTGGCCCACAAGTATCA </li></ul><ul><li>CTAAGCTCGCTTTCTTGCTGTCCAATTTCTATTAAAGGTTCCTTTGTTCCCTAAGTCCAACTACTAAACT </li></ul><ul><li>GGGGGATATTATGAAGGGCCTTGAGCATCTGGATTCTGCCTAATAAAAAACATTTATTTTCATTGC </li></ul><ul><li>>gi|4504349|ref|NP_000509.1| beta globin [Homo sapiens] </li></ul><ul><li>MVHLTP E EKSAVTALWGKVNVDEVGGEALGRLLVVYPWTQRFFESFGDLSTPDAVMGNPKVKAHGKKVLG </li></ul><ul><li>AFSDGLAHLDNLKGTFATLSELHCDKLHVDPENFRLLGNVLVCVLAHHFGKEFTPPVQAAYQKVVAGVAN </li></ul><ul><li>ALAHKYH </li></ul>
  31. 32. Diseased Individual <ul><li>>gi|28302128|ref|NM_000518.4| Homo sapiens hemoglobin, beta (HBB), mRNA </li></ul><ul><li>ACATTTGCTTCTGACACAACTGTGTTCACTAGCAACCTCAAACAGACACC ATG GTGCATCTGACTCCTGA </li></ul><ul><li>G G T G AAGTCTGCCGTTACTGCCCTGTGGGGCAAGGTGAACGTGGATGAAGTTGGTGGTGAGGCCCTGGGC </li></ul><ul><li>AGGCTGCTGGTGGTCTACCCTTGGACCCAGAGGTTCTTTGAGTCCTTTGGGGATCTGTCCACTCCTGATG </li></ul><ul><li>CTGTTATGGGCAACCCTAAGGTGAAGGCTCATGGCAAGAAAGTGCTCGGTGCCTTTAGTGATGGCCTGGC </li></ul><ul><li>TCACCTGGACAACCTCAAGGGCACCTTTGCCACACTGAGTGAGCTGCACTGTGACAAGCTGCACGTGGAT </li></ul><ul><li>CCTGAGAACTTCAGGCTCCTGGGCAACGTGCTGGTCTGTGTGCTGGCCCATCACTTTGGCAAAGAATTCA </li></ul><ul><li>CCCCACCAGTGCAGGCTGCCTATCAGAAAGTGGTGGCTGGTGTGGCTAATGCCCTGGCCCACAAGTATCA </li></ul><ul><li>CTAAGCTCGCTTTCTTGCTGTCCAATTTCTATTAAAGGTTCCTTTGTTCCCTAAGTCCAACTACTAAACT </li></ul><ul><li>GGGGGATATTATGAAGGGCCTTGAGCATCTGGATTCTGCCTAATAAAAAACATTTATTTTCATTGC </li></ul><ul><li>>gi|4504349|ref|NP_000509.1| beta globin [Homo sapiens] </li></ul><ul><li>MVHLTP V EKSAVTALWGKVNVDEVGGEALGRLLVVYPWTQRFFESFGDLSTPDAVMGNPKVKAHGKKVLG </li></ul><ul><li>AFSDGLAHLDNLKGTFATLSELHCDKLHVDPENFRLLGNVLVCVLAHHFGKEFTPPVQAAYQKVVAGVAN </li></ul><ul><li>ALAHKYH </li></ul>
  32. 33. Disease Databases <ul><li>Genes are involved in disease </li></ul><ul><li>Many diseases are well studied </li></ul><ul><li>Description of diseases and what is known about them is stored </li></ul><ul><ul><li>A good place to start when you want to know about a certain disease </li></ul></ul><ul><ul><li>Linked to PubMed, the OMIM Morbid Map </li></ul></ul><ul><li>OMIM - Online Mendelian Inheritance in Man </li></ul><ul><ul><li>“ A catalog of human genes and genetic disorders maintained by Johns Hopkins University” </li></ul></ul><ul><ul><li>http:// www.ncbi.nlm.nih.gov/sites/entrez?db = omim </li></ul></ul>
  33. 35. Putting it All Together <ul><li>Each Database contains specific information </li></ul><ul><li>Like other biological systems also these databases are interrelated </li></ul>
  34. 36. GENOMIC DATA GenBank DDBJ EMBL ASSEMBLED GENOMES GoldenPath WormBase TIGR PROTEIN PIR SWISS-PROT STRUCTURE PDB MMDB SCOP LITERATURE PubMed PATHWAY KEGG COG DISEASE LocusLink OMIM OMIA GENES RefSeq AllGenes GDB SNPs dbSNP ESTs dbEST unigene MOTIFS BLOCKS Pfam Prosite GENE EXPRESSION Stanford MGDB NetAffx ArrayExpress
  35. 37. Where to get started? NCBI ENTREZ <ul><li>A search engine that provides access and links between various databases </li></ul>ENTREZ PubMed GenBank Protein databases Genomes SNP Taxonomy OMIM http://www.ncbi.nlm.nih.gov/sites/gquery
  36. 38. Outline <ul><li>Bioinformatics Databases </li></ul><ul><ul><li>Primary databases </li></ul></ul><ul><ul><li>Derived databases </li></ul></ul><ul><li>Nucleotide databases </li></ul><ul><ul><li>GenBank (P), EMBL-Bank (P) </li></ul></ul><ul><li>Protein databases </li></ul><ul><ul><li>Swiss-Prot (D), PIR-PSD (D) </li></ul></ul><ul><ul><li>GenPept (D), TrEMBL (D) </li></ul></ul><ul><ul><li>Protein Data Bank (P) </li></ul></ul><ul><li>Other Examples </li></ul><ul><ul><li>RefSeq </li></ul></ul><ul><ul><li>UniGene </li></ul></ul><ul><ul><li>PubMed </li></ul></ul><ul><ul><li>SNP </li></ul></ul><ul><ul><li>OMIM </li></ul></ul>

×