Your SlideShare is downloading. ×
Pelatihan Manajemen SDM Lengkap
Pelatihan Manajemen SDM Lengkap
Pelatihan Manajemen SDM Lengkap
Pelatihan Manajemen SDM Lengkap
Pelatihan Manajemen SDM Lengkap
Pelatihan Manajemen SDM Lengkap
Pelatihan Manajemen SDM Lengkap
Pelatihan Manajemen SDM Lengkap
Pelatihan Manajemen SDM Lengkap
Pelatihan Manajemen SDM Lengkap
Pelatihan Manajemen SDM Lengkap
Pelatihan Manajemen SDM Lengkap
Pelatihan Manajemen SDM Lengkap
Pelatihan Manajemen SDM Lengkap
Pelatihan Manajemen SDM Lengkap
Pelatihan Manajemen SDM Lengkap
Pelatihan Manajemen SDM Lengkap
Pelatihan Manajemen SDM Lengkap
Pelatihan Manajemen SDM Lengkap
Pelatihan Manajemen SDM Lengkap
Pelatihan Manajemen SDM Lengkap
Pelatihan Manajemen SDM Lengkap
Pelatihan Manajemen SDM Lengkap
Pelatihan Manajemen SDM Lengkap
Pelatihan Manajemen SDM Lengkap
Pelatihan Manajemen SDM Lengkap
Pelatihan Manajemen SDM Lengkap
Pelatihan Manajemen SDM Lengkap
Pelatihan Manajemen SDM Lengkap
Pelatihan Manajemen SDM Lengkap
Pelatihan Manajemen SDM Lengkap
Pelatihan Manajemen SDM Lengkap
Pelatihan Manajemen SDM Lengkap
Pelatihan Manajemen SDM Lengkap
Pelatihan Manajemen SDM Lengkap
Pelatihan Manajemen SDM Lengkap
Pelatihan Manajemen SDM Lengkap
Pelatihan Manajemen SDM Lengkap
Pelatihan Manajemen SDM Lengkap
Pelatihan Manajemen SDM Lengkap
Pelatihan Manajemen SDM Lengkap
Pelatihan Manajemen SDM Lengkap
Pelatihan Manajemen SDM Lengkap
Pelatihan Manajemen SDM Lengkap
Pelatihan Manajemen SDM Lengkap
Pelatihan Manajemen SDM Lengkap
Pelatihan Manajemen SDM Lengkap
Pelatihan Manajemen SDM Lengkap
Pelatihan Manajemen SDM Lengkap
Pelatihan Manajemen SDM Lengkap
Pelatihan Manajemen SDM Lengkap
Pelatihan Manajemen SDM Lengkap
Pelatihan Manajemen SDM Lengkap
Pelatihan Manajemen SDM Lengkap
Pelatihan Manajemen SDM Lengkap
Pelatihan Manajemen SDM Lengkap
Pelatihan Manajemen SDM Lengkap
Pelatihan Manajemen SDM Lengkap
Pelatihan Manajemen SDM Lengkap
Pelatihan Manajemen SDM Lengkap
Pelatihan Manajemen SDM Lengkap
Pelatihan Manajemen SDM Lengkap
Pelatihan Manajemen SDM Lengkap
Pelatihan Manajemen SDM Lengkap
Pelatihan Manajemen SDM Lengkap
Pelatihan Manajemen SDM Lengkap
Pelatihan Manajemen SDM Lengkap
Pelatihan Manajemen SDM Lengkap
Pelatihan Manajemen SDM Lengkap
Pelatihan Manajemen SDM Lengkap
Pelatihan Manajemen SDM Lengkap
Pelatihan Manajemen SDM Lengkap
Pelatihan Manajemen SDM Lengkap
Pelatihan Manajemen SDM Lengkap
Pelatihan Manajemen SDM Lengkap
Pelatihan Manajemen SDM Lengkap
Pelatihan Manajemen SDM Lengkap
Pelatihan Manajemen SDM Lengkap
Pelatihan Manajemen SDM Lengkap
Pelatihan Manajemen SDM Lengkap
Pelatihan Manajemen SDM Lengkap
Pelatihan Manajemen SDM Lengkap
Pelatihan Manajemen SDM Lengkap
Pelatihan Manajemen SDM Lengkap
Pelatihan Manajemen SDM Lengkap
Pelatihan Manajemen SDM Lengkap
Pelatihan Manajemen SDM Lengkap
Pelatihan Manajemen SDM Lengkap
Pelatihan Manajemen SDM Lengkap
Pelatihan Manajemen SDM Lengkap
Pelatihan Manajemen SDM Lengkap
Pelatihan Manajemen SDM Lengkap
Pelatihan Manajemen SDM Lengkap
Pelatihan Manajemen SDM Lengkap
Pelatihan Manajemen SDM Lengkap
Pelatihan Manajemen SDM Lengkap
Pelatihan Manajemen SDM Lengkap
Pelatihan Manajemen SDM Lengkap
Pelatihan Manajemen SDM Lengkap
Pelatihan Manajemen SDM Lengkap
Pelatihan Manajemen SDM Lengkap
Pelatihan Manajemen SDM Lengkap
Pelatihan Manajemen SDM Lengkap
Pelatihan Manajemen SDM Lengkap
Pelatihan Manajemen SDM Lengkap
Pelatihan Manajemen SDM Lengkap
Pelatihan Manajemen SDM Lengkap
Pelatihan Manajemen SDM Lengkap
Pelatihan Manajemen SDM Lengkap
Pelatihan Manajemen SDM Lengkap
Pelatihan Manajemen SDM Lengkap
Pelatihan Manajemen SDM Lengkap
Pelatihan Manajemen SDM Lengkap
Pelatihan Manajemen SDM Lengkap
Pelatihan Manajemen SDM Lengkap
Pelatihan Manajemen SDM Lengkap
Pelatihan Manajemen SDM Lengkap
Pelatihan Manajemen SDM Lengkap
Pelatihan Manajemen SDM Lengkap
Pelatihan Manajemen SDM Lengkap
Pelatihan Manajemen SDM Lengkap
Pelatihan Manajemen SDM Lengkap
Pelatihan Manajemen SDM Lengkap
Pelatihan Manajemen SDM Lengkap
Pelatihan Manajemen SDM Lengkap
Pelatihan Manajemen SDM Lengkap
Pelatihan Manajemen SDM Lengkap
Pelatihan Manajemen SDM Lengkap
Pelatihan Manajemen SDM Lengkap
Pelatihan Manajemen SDM Lengkap
Pelatihan Manajemen SDM Lengkap
Pelatihan Manajemen SDM Lengkap
Pelatihan Manajemen SDM Lengkap
Pelatihan Manajemen SDM Lengkap
Pelatihan Manajemen SDM Lengkap
Pelatihan Manajemen SDM Lengkap
Pelatihan Manajemen SDM Lengkap
Pelatihan Manajemen SDM Lengkap
Pelatihan Manajemen SDM Lengkap
Pelatihan Manajemen SDM Lengkap
Pelatihan Manajemen SDM Lengkap
Pelatihan Manajemen SDM Lengkap
Pelatihan Manajemen SDM Lengkap
Pelatihan Manajemen SDM Lengkap
Pelatihan Manajemen SDM Lengkap
Pelatihan Manajemen SDM Lengkap
Pelatihan Manajemen SDM Lengkap
Pelatihan Manajemen SDM Lengkap
Pelatihan Manajemen SDM Lengkap
Pelatihan Manajemen SDM Lengkap
Upcoming SlideShare
Loading in...5
×

Thanks for flagging this SlideShare!

Oops! An error has occurred.

×
Saving this for later? Get the SlideShare app to save on your phone or tablet. Read anywhere, anytime – even offline.
Text the download link to your phone
Standard text messaging rates apply

Pelatihan Manajemen SDM Lengkap

7,883

Published on

Bagi Perusahaan yang membutuhkan Pelatihan ini dapat menghubungi Kami HARD-Hi SMART CONSULTING di Hotline : 0878-7063-5053 (Fast Response) dengan Bpk. M. Shobrie H.W., SE, CFA, CLA, CPHR, CPTr.

Bagi Perusahaan yang membutuhkan Pelatihan ini dapat menghubungi Kami HARD-Hi SMART CONSULTING di Hotline : 0878-7063-5053 (Fast Response) dengan Bpk. M. Shobrie H.W., SE, CFA, CLA, CPHR, CPTr.

Published in: Business
3 Comments
10 Likes
Statistics
Notes
No Downloads
Views
Total Views
7,883
On Slideshare
0
From Embeds
0
Number of Embeds
10
Actions
Shares
0
Downloads
0
Comments
3
Likes
10
Embeds 0
No embeds

Report content
Flagged as inappropriate Flag as inappropriate
Flag as inappropriate

Select your reason for flagging this presentation as inappropriate.

Cancel
No notes for slide

Transcript

  • 1. MANAJEMEN S.D.M. By M. Shobrie H.W., SE, CFA, CLA, CPHR, CPTr.
  • 2. Konsep Dasar Manajemen
  • 3. Kenapa butuh MSDM? Manusia adalah aset yang paling berharga dalam organisasi; kekuatan organisasi yang tidak bisa „dijiplak‟ oleh pesaing Perlu pengelolaan khusus terhadap manusia agar memiliki daya saing yang kuat (Competitive Advantage)
  • 4.  Kenapa butuh MSDM? Banyak isu baru tentang manusia dan organisasi; “Penguranganpegawai(Downsizing); keanekaragamanpekerja(Diversity); perubahantempatkerja; teknologibaru; sempitnyalapanganpekerjaan; kurangnya tenagahandal; desainorganisasiyang baru; globalisasi; tuntutanpelayananprima dan standard etika kerja yang tinggi”
  • 5. Pergeseran istilah SDM Manajemen Personalia Manajemen Sumber Daya Manusia / Human Resource Management (HRM) “Terma Personalia cenderung berkonotasi pada hal-hal yang sifatnya ringan, orientasi pada kesejahteraan pegawai semata, dan hanya berdimensi aktivitas operasional”_ (Inkson: 2008)
  • 6.   Pergeseran istilah SDM Istilah “Human Resource” (Sumber Daya Manusia) adalah sebuah metafora untuk orang yang bekerja dalam organisasi Manusia adalah aset atau modal kapital yang paling berharga dan sumber utama penghasil daya bersaing
  • 7. Antara Manajemen Personalia dan Manajemen SDM Persamaan 1) Sama-sama bermuara dari strategi bisnis 2) Manajer lini bertanggung jawab untuk mengelola pegawai 3) Respek pada tiap individu dan berusaha memenuhi kebutuhannya 4) Bersama-sama menyelaraskan kemampuan pegawai dengan kebutuhan organisasi (The right people in and for the right jobs) Perbedaan 1) MSDM lebih menekankan pada penyelarasan strategi dan integrasi 2) MSDM didasarkan pada filsafat manajemen bisnis 3) MSDM lebih mengedepankan manajemen budaya dan pencapaian komitmen 4) MSDM lebih menekankan peranan manajer lini sebagai pihak pelaksana kebijakan SDM
  • 8. Antara Manajemen Personalia dan Manajemen SDM Persamaan 5) Melakukan seleksi, analisa kompetensi, manajemen kinerja, training and development, serta teknik reward manajemen 6) Membangun proses komunikasi dan partisipasi dalam sistem relasi pegawai Perbedaan 5) MSDM adalah sebuah pendekatan yang holistik tentang bisnis 6) Praktisi MSDM diharapkan menjadi partner bisnis daripada sebagai administrator personalia 7) MSDM memperlakukan pegawai sebagai aset, bukan biaya
  • 9. Gagasan baru tentang istilah Kata Sumber Daya ialah sebuah perantara yang digunakan untuk mencapai tujuan Sumber Daya merupakan objek pasif yang dimanfaatkan oleh pihak lain Jika manusia adalah sumber daya, maka manusia sama dengan peralatan furniture atau komputer Nyatanya, manusia punya hak untuk aktif dan bebas berkreasi
  • 10.      Gagasan baru tentang istilah Mungkin ... Human Resource Management (HRM) Knowledge Management Expertise Management Talent Management Human Partnership Management (HPM) Employment Partnership Management (EPM)
  • 11. Definisi MSDM Proses mengatur manusia dalam organisasi Pendekatan strategik dan koheren dalam mengatur aset organisasi yang paling bernilai Kapitalisasi manusia Mengacu pada kebijakan, praktek dan sistem yang mempengaruhi perilaku, sikap dan kinerja pegawai
  • 12. Pelaksana MSDM ...? Departemen Human Resource Manajer Lini atau Operasi “Tergantung dari besar kecilnya organisasi dan paradigma atau pemahaman yang berbeda-beda tentang wewenang pengelolaan pegawai”
  • 13. Aktivitas MSDM ... (1) Analisa pekerjaan Perencanaan SDM Rekruitmen dan seleksi Manajemen kinerja Pelatihan dan pengembangan SDM Perencanaan karier dan motivasi kepegawaian
  • 14. Aktivitas MSDM ... (2) Compensation dan benefits (Sistem penggajian) Hubungan industri Program jaminan kesehatan dan keamanan Manajemen keanekaragaman pegawai
  • 15.    Kategori Aktivitas MSDM Aktivitas Transaksional Pembayaran administrasi, HRIS (Human Resource information systems), pelayanan pegawai Aktivitas Tradisional Manajemen kinerja, recruitmen, seleksi, relasi industri Aktivitas Transformasional Knowledge management, perubahan budaya, pengembangan SDM, perubahan strategi bisnis
  • 16. “Sekilas Ulasan MSDM” Mathis and Jackson (2005), Human Resource Management
  • 17. Proses MSDM Perencanaan SDM Penilaian kinerja (Performance Appraisal) Pengembangan karier dekruitmen Rekruitmen Seleksi Identifikasi dan pemilihan kompetensi pegawai Penyelarasan skill dan pengetahuan pegawai Pelatihan Orientasi kepegawaian Sistem penggajian Relasi industri yang kondusif Muncul Pegawai yang kompeten dan high- performer untuk masa jangka panjang
  • 18. Rupiah dan kerja MSDM Aktivitas Rekruitmen dan Seleksi Sistem Penggajian dan Benefits Pengembangan SDM Jaminan Kesehatan dan Keamanan Relasi Industri Jenis Pengeluaran Periklanan dan biaya administrasi Gaji pegawai dan premium asuransi Biaya pelatihan dan tarif konsultan pelatihan Biaya kecelakaan, ganti rugi pegawai dan asuransi Bolos kerja (Absenteeism) dan tingginya persentasi keluar masuk pegawai (Turnover)
  • 19. Peran HR profesional (1) Pakar administrasi Pembela hak pegawai (Employee Champion) Agen perubahan Rekan strategi bisnis ______Ulrich (1997)
  • 20. Peran HR profesional (2)
  • 21. Pakar Administrasi Manajer SDM harus bisa: Mengatur urusan kepegawaian di setiap proses aktivitas organisasi Mengupayakan efisiensi dan efektivitas dalam setiap urusan administrasi pegawai
  • 22. Pembela hak pegawai Manajer SDM harus bisa: Memenuhi kebutuhan pegawai Menjadi „suara‟ pegawai di setiap pengambilan keputusan manajerial Adil dan menjunjung etika moral Meyakinkan pegawai bahwa aspirasi mereka telah diperhatikan
  • 23. Agen Perubahan Manajer SDM harus bisa: Mengelola perubahan Memimpin perubahan di dalam fungsi SDM dengan mengembangkan komunikasi problem-solving dan skill mempengaruhi orang Menghargai proses penciptaan, sharing dan penyebaran pengetahuan
  • 24. Rekan strategi bisnis Manajer SDM harus bisa: Mengasah naluri bisnis Mempraktekkan falsafah orientasi terhadap pelanggan (Customer oriented) Siaga dengan kompetisi bisnis
  • 25. Kompetensi HR profesional Evaluasi Benefits Audit Sistem Penggajian Manajemen Strategik Pengembangan Organisasi Manajemen Data Hubungan Industri Hukum Legal Analitis, Mengambil keputusan berdasar fakta Manajemen Perubahan Keanekaragaman Counselling Pengembangan pegawai Taken from (The Conference Board, 1990)
  • 26. Sebuah Otokritik ...? MSDM bersifat optimistik tetapi berupa konsep yang ambigius. Ia hanyalah “Hype and Hope” (Guest: 1991) Janji MSDM terlalu banyak ketimbang yang telah dicapainya Terlalu komprehensif dan sulit dipraktekkan; „hyperbole and rhetoric of human resource management‟ (Gratton et al: 1999)
  • 27. 27 SUMBER DAYA MANUSIA Semua daya yang dimiliki oleh setiap individuFisik–tampilan fisik (appearance) Mental: semangat, skill (keterampilan) dan kepiawaian moral dan kepribadian, kecerdasan, perilaku, pengalaman, dsb. Skill Hard skill dan soft skill
  • 28. 28 CIPTA RASA KARSA
  • 29. 29 KOGNITIF AFEKTIF PSIKO-MOTORIK
  • 30. 30 ORGANISASI YG UNGGGUL DLM BERSAING SUASANA ORGANISASI YANG KONDUSIF STRATEGI YANG JITU SDM YANG BAIK
  • 31. 31 SDM SEBAGAI SARANA KEUNGGULAN BERSAINGOrganisasi, bersaing secara efektif untuk menghadapi masa yang akan datangPersaingan yang terjadi sekarang dan masa yang akan datang diatasi dengan persaingan di bidang pengelolaan SDM. Dilihat dari sudut pandang strategi, SDM haruslah diperlakukan sebagai core competence.
  • 32. 32 SDM YANG BAIK32 FLEKSIBEL MOTIVASITINGGI PIAWAI
  • 33. 33 FUNGSI PENGELOLAAN SDM : 1.Perencanaan, 2.Pengadaan kebutuhan pekerja (karyawan), 3.Pelatihan dan pengembangan, 4.Penilaian kinerja, kompensasi, dan… 5.Hubungan indistrial (pemeliharaan) dengan tujuan untuk mencapai kepen- tingan individu (karyawan), konsumen, dan perusahaan.
  • 34. 34Menurut Noe (Human Resource Management, 2000) mendefinisikan MSDM sebagai: kebijakan, praktik, dan sistem yang mempengaruhi perilaku, sikap, dan prestasi karyawan. 34
  • 35. 35 TANTANGAN PERUSAHAANTantangan yang dihadapi oleh perusahaan dalam dekade mendatang mengharuskan perusahaan berkonsentrasi pada masalah SDM. Tantangan tersebut adalah: –theglobal Challenge, –memenuhi kebutuhan stakeholder,dan –sistem kerja yang semakin canggih
  • 36. 36 5 Tantangan yang mengharuskan Perusahaan Mengembangkan Kapabilitas Baru(Dave Ulrich ) 1.globalisasi, 2.profitabilitas melalui pertumbuhan, 3.teknologi, 4.intellectual capital, dan 5.perubahan (change, change, and more change).
  • 37. 37 David B. Jemison menggambarkansecaralebihtepatketerkaitanantarapengelolaanSDM denganstrategi.
  • 38. 38 Studi organisasi dalam konteks berkaitan dengan lingkungannnya. Studi tindakan manajerial (managerial action) dalam konteks organisasi. Studi dan pengembangan metode untuk memperbaiki kerjasama stratejik antara kapabilitas organisasi dengan lingkungannya. Kontribusiadministrative behaviorterhadapmanajemenstratejikadalah :
  • 39. 39 4 Cara Perusahaan dalam mencapai Keprimaan(excellence) : 1.HRDharus menjadi partner dengan manajer senior dan manajer lini dalam implementasi strategi (strategy execution), membantu menggerakkan planningdari ruang pertemuan ke pasar. 2.HRDharus ahli dalam pengorganisasian menyelesaikan pekerjaan, efisiensi administratif, untuk menjamin bahwa biaya-biaya terkurangi tanpamengurangi kualitas.
  • 40. 40 3. HR harus menjadi suatu championbagi pegawai secara bersemangat menampilkan perhatian mereka kepada senior managementpada saat yang sama bekerja untuk meningkatkan kontribusi pegawaikomitmen karyawan terhadap organisasi dan kemampuan mereka menyajikan suatu hasil. 4. HR harus menjadi agen transformasi yang continuous membentuk proses dan budaya secara bersama-sama memperbaiki kapasitas organisasi untuk berubah.
  • 41. 41 Untuk mencapai tujuan, sebuah organisasi tidak hanya membutuhkan sumberdaya saja 3 sumberdayayang diperlukan organisasi : 1.sumber daya manusia, 2.sumber daya keuangan, 3.sumber daya fisik. Ditambah kategori keempat yaitu sumberdaya teknologi seperti paten dalam proses produksi
  • 42. 42 Pergeseran dalam Manajemen SDM Berfokus pada administrasi Berfokus pada strategi Reaktif Proaktif MSDM terpisah dan terisolasi dari misi perusahaan MSDM merupakan bagian kunci dari misi perusahaan Berfokus pada produksi Berfokus pada pelayanan Fungsi organisasi berdasarkan kewenangan secara garis vertikal Proses dasar organisasi: Umumnya berdasarkan tanggung jawab sosial. Tim korporatyang terdiri dari para ahli Menganggap manusia sebagai biaya Menganggap manusia sebagai investasi(human capital) FUNGSI TRADISIONIL SDM MUNCULNYA PRAKTIK SDM
  • 43. 43 Tekanan pada manajemen stratejikFungsi SDM harus direncanakan, diorganisasi, dan dievaluasi dengan mendasarkan pada kontribusi SDM pada pencapaian tujuan perusahaan. Para profesionalis manajemen SDM membutuhkan kualifikasi tambahan, yaitu: 1.Business Capabilities : Profesional SDM membutuhkan bisnis perusahaan secara keseluruhan, konsekuensi-nya, mereka harus memahami aspek ekonomi dan keuangan. 2. State of the Art HRM Practices : Profesional SDM akan menjadi seorang ahli di bidang perilaku manusia. 3. Management of Change Process : Profesional SDM harus memiliki kemampuan dalam memahami dan mengelola setiap perubahan (organisasional) yang terjadi.
  • 44. 44 Kompetensi-kompetensi yang harus dimiliki SDM yang Profesional Business Capabilities: Financial, Strategic, Technological Managing Change Processes: Diagnosis, Influence, Con- tracting, Problem sol- ving, Relationship, Communi- cation Human Resources: Staffing, Development, Appraisal, Reward, Organi- zation Planning ,Communication
  • 45. 45 MENGELOLA SDM MENGHADAPI PERSAINGANKE DEPAN
  • 46. 46 Kegiatan mengelola karyawan, kebijakan dan praktek yang sekarang dapat digunakan perusahaan, Kegiatan mengelola kekuatan-kekuatan perubahan (seperti tehnologi, restrukturisasi bisnis, masalah hukum dan sosial) yang harus ditelaah organisasi supaya dapat memosisikan dirinya dalam menghadapi kedepan.
  • 47. 47 Menggunakan SDM untuk bersaing dalam Menghadapi keDepan (abad 21): Jack Creighton dan Herb Kelleher : SDM berperan besar untuk unggul dalam persainganJack Welch, CEO GE Company: Satu-satunya cara kami untuk dapat berkompetisi adalah dengan menggunakan SDM (karyawan). Budaya perusahaan yang memotivasi, memberdayakan dan mendidik karyawan merupakan sesuatu yang dapat membuahkan hasil mengagumkan.
  • 48. 48Robert J Eaton, CEO, Chrysler Corp: Kendala terbesar yang dihadapi perusahaan dalam menghadapi persaingan global adalah terbatasnya SDMdan bukan terbatas modal. Floris A Maljers, CEO Unilever NV; Bila anda memerhatikan sumber-sumber keunggulan kompetitif/bersaing yang dapat diperbaharui selama dekade terakhir, satu- satunya yang bisa bertahan adalah kualitas SDMyang bekerja di perusahaan. 48
  • 49. 49 Kebutuhan untuk Bersaing dan untuk Keberhasilan Organisasi : Perusahaan membutuhkan kemampuan karyawan dalam menghadapi kompetisi ke depan. Peneletian terakhir menunjukkan bahwa perusahaan yang mengelola SDM-nya secara efektif,memiliki: tingkat profitabilitas yang tinggi, penjualan tahunan per karyawan yang tinggi, nilai pasar yang tinggi, pertumbuhan laba per saham yang tinggi. (Lester C. Thurow).
  • 50. 50Manajemen SDM yang efektif dapat memenuhi kebutuhan karyawan dalam beberapa cara, antara lain, perusahaan menyediakan keamanan kerja, lebih banyak peluang pekerjaan/karier, dan gaji yang lebih baik.
  • 51. 51 Meraih KeunggulanBersaing: Perusahaan yang ingin meraih keunggulan bersaing salah satunya bisa melalui pemanfaatan SDM yang inovatifdan mempunyai motivasi yang tinggi untuk berkembang. Jenis keunggulan kompetitif yang bisa bertahan lama adalah: (1) karyawan yang dipilih dengan pertimbangan kompetensi, (2) bermotivasi tinggi, dan (3) bertekad memberikan kepuasan konsumen.
  • 52. 52 H.R. STAKEHOLDERsMasyarakat: •Kepatuhan hukum •Tanggung jawab sosial •Praktik manajemen etisMitra Strategis: •Pemasok, JointVentur, •Serikat pekerja •PelangganOrganisasi: •Produktivitas •Laba •Kelangsungan hidupKaryawan: •Perlakuan adil •Kepuasan •Pemberdayaan •Kesehatan-keselamatanPelanggan: •Kualitas pelayanan •Kualitas produk •Kecepatan dan respon •Biaya rendah •InovasiPemegang saham-Investor: •Return pemegang saham •Return atas penjualan •Return atas aktiva •Return atas investasi Human Resources Management
  • 53. 53 Konteks Pengelolaan SDM kedepan (di abad 21) 1. Arena Globalisasi Cara mengelola SDM sangat beraneka ragam, karena pasar internasional semakin terbuka, perusahaan- perusahaan menemukan peluang pasar internasional, mereka harus mempelajari praktek-praktek SDM yang berbeda. 2. Keanekaragaman TenagaKerja Keanekaragaman menyediakan lingkungan yang lebih kaya, berbagai macam sudut pandang, dan produktivitas yang lebih besar. Dan yang tidak kalah penting, menjadikan tempat kerja menarik dan menyenangkan.
  • 54. 54 3. Kelompok dan kelompok kerja Pendekatan berdasarkan kelompok dapat meningkatkan inovasi, memperbaiki kualitas, dan memperpendek waktu yang dibutuhkan untuk mengubah ide menjadi produk yang tersedia di pasar. Proses pembentukan kelompok: 1. Forming 2. Storming 3. Norming 4. WorkingDalammengorganisasi kelompok, karyawan harus dipilih, dinilai, dikompensasi, dan dilatih dengan cara yang mencerminkan hubungan baik yang berkembang diantara karyawan yang bekerja bersama.
  • 55. 55 Membedakan Karakteristik bagi Perusahaan yang Sukses/Berhasil Yang membedakan perusahaan yang berhasil dalam mencapai sasaran pengelolaan SDM adalah kapasitas untuk memilih dan melaksanakan kegiatan, kebijakan, dan praktek SDM yang dikehendaki. Hal ini diperlukan: 1.keahlian tehnikaldan 2.analisis yang sistematis.
  • 56. 56Keahlian TeknikalMengelola manusia secara efektif memerlukan pengetahuan tehnikal yang tersedia dengan cara yang sistematis dan penuh dengan pertimbangan. Perusahaan dapat membedakan dengan perusahaan lain dengan lebih kompeten secara tehnik dibandingkan dengan lainnya. Karena adanya kondisi yang terus berubah dan pengetahuan tehnikal telah diciptakan oleh para pakar, kita tidak hanya mengharapkan bahwa hanya pengetahuan saja yang menjadi dasar efektifnya MSDM. 56
  • 57. 57 Analisis sistematis Perusahaan yang efektif mengambil manfaatdari kebijakan dan praktik SDM dengan secara sistematis.
  • 58. 58 4 Karakteristik Pendekatan Sistimatis 1.Mencakup pertimbangan bagaimana praktek khusus dalam mengelola karyawan dapat mempengaruhi sikap dan perilaku karyawan dalam bekerja di berbagai jabatan. ▓Kebijakan dan praktek SDM yang konsisten serta terkoordinasi dengan lainnya, dapat dikomunikasi-kan dalam pesan yang sama kepada semua karyawan. ▓Sistem penilaian kinerja yang mengevaluasi karyawan atas dasar pencapaian sasaran kerja, dan yang dipadukan dengan sistem kompensasi yang memberikan penghargaan karyawan atas dasar yang sama akan memberikan kepuasan kerja yang tinggi.
  • 59. 59 2. Memerhatikan keunikan karakteristik perusahaan, seperti: ▓sejarah perusahaan, ▓sasaran manajemen puncak, ▓strategi yang ingin digunakan, ▓budaya perusahaan, ▓ukuran dan struktur perusahaan, ▓teknologi yang digunakan. 3. Pendekatan sistematis memerhatikan aspek lingkungan yang terus-menerus berubah.
  • 60. 60 4.Agar efektif, praktek SDM harus pekaterhadap perubahan ekonomi secara umum dan perubahan pasar kerja pada khususnya, tindakan pesaing dan mitra strategis, serta aspek legal dan peraturan. 5. Oleh karena itu, pihak manajemen harus mempertimbangkan unsur internal dan eksternal ketika memilih bagaimana mengelola SDM suatu perusahaan, dan tidak bisa memilih satu cara terbaik untuk diterapkan di semua perusahaan.
  • 61. 61 6. Proses trial and errorharus dikendalikan dengan informasi dan data dari awal sampai akhir. Informasi dan data dikumpulkan sebelum perubahan dilakukan dan digunakan untuk memutuskan perubahan apa yang harus dilakukan, pengawasan berlanjut selama proses perubahan agar memudahkan penyesuaian, dan setelah perubahan dilakukan, datanya digunakan untuk menilai akibat yang telah diprakirakan dan yang tidak diprakirakan. Dengan kata lain, pendekatan sistematis memastikan bahwa organisasi dan karyawan belajar dari kesalahan dan keberhasilan.
  • 62. 62
  • 63. 63Sistem Kumpulan elemen yang saling berinteraksi yang digerakkan untuk mencapai tujuan. Sistem sosial 1.Terdiri atas orang-orang 2.Hubungan antarelemen terstruktur 3.Dilengkapi dengan sanksi
  • 64. 64 ANGGOTA ORGANISASI FORMAL ANGGOTA ORGANISASI INFORMAL INDIVIDU
  • 65. 65 INDIVIDU KEBUTUHAN KEPRIBADIAN PERILAKU
  • 66. 66 NORMA INDIVIDU KELOMPOK INFORMAL MAKSUD PERILAKU
  • 67. 67 INDIVIDU BIROKRASI • Struktur organisasi • Hirarkhi • Spesialisasi • Sistem & prosedur • Aturan & Peraturan HARAPAN PERILAKU
  • 68. 68 BIROKRASI HARAPAN KEBUTUHAN KEPRIBADIAN KELOMPOK INFORMAL KAIDAH (NORMA) PERILAKU SOSIAL MAKSUD • Struktur organisasi • Hirarkhi • Spesialisasi • Aturan & Peraturan LINGKUNGAN LUAR ORGANISASI LINGKUNGAN DALAM ORGANISASI INDIVIDU LINGKUNGAN LUAR ORGANISASI
  • 69. PerencanaanSDM
  • 70. 1. KegiatanPenyediaanSDM (rekruitmen, seleksi& penempatan) 2.KegiatanMemperkiraanSupply & Demand SDM (mutasi, promosi, pensiun, undurkandiri, PHK) 3.KegiatanMeningkatkanMutuSDM (pelatihandanpengembangan) 4.KegiatanEvaluasiKondisiSDM (penilaianprestasikerja) 4 KEGIATAN TERPADU PERENCANAAN SDM
  • 71. Leadership and Management Managing Project Stakeholders Influence as Exchange Commonly Traded Organizational Currencies Social Network Building Ethics and Project Management Contradictions of Project Management Qualities of an Effective Project Manager Suggestions for Project Managers MANFAAT PERENCANAAN SDM 1.MengoptimalkanSDM ygsudahadaSDM yang sudahadaakandapatdimanfaatkandenganbaikapabilaorganisasitelahmelakukaninventarisasiSDM. Inventarisasitersebutmencakup: Jumlah& KualifikasiTenagakerja, MasaKerja, Pengetahuan& Ketrampilanyang dimiliki, Bakat& Minatyang perludikembangkan. HasilinventarisasitersebutdapatdigunakanuntukmelakukanPromosi, Mutasi, PeningkatanKemampuankaryawan. 2. MemperkirakanKebutuhanSDM untukMasaY.A.DKebutuhanSDM padamasayang akandatangbaikdariSegiJumlahmaupunKualifikasinyaperluDi-EstimasisetepatMungkinkarenaakanselaluterkaitdenganPerubahan- perubahanyang mungkinakanterjadidiLuarPerkiraanyang BerpengaruhterhadapJalannyaOrganisasi(Perusahaan).
  • 72. Leadership and Management Managing Project Stakeholders Influence as Exchange Commonly Traded Organizational Currencies Social Network Building Ethics and Project Management Contradictions of Project Management Qualities of an Effective Project Manager Suggestions for Project Managers 3. MemberikanGambaranSituasiPasarKerjadenganTepat Mencakupjumlah, kualifikasi, lokasi, sertakomposisitenaga kerjayang dimintaataudibutuhkanolehorganisasi, maupun darisisilatarbelakangprofesi, tingkatpendidikan, keahlian, tingkatupahyang diharapkanolehSi PencariKerja. 4. SebagaiDasarPenyusunanProgram-program SDM SalahsatuProgram PerencanaanSDM adalahPengadaan TenagaKerjabarumelaluiSeleksidanRekrutmen, serta Penempatannya. TanpaadanyaPerencanaanSDM yang baik, sulituntukmenyususnProgram Kerjayang Riil. MANFAAT PERENCANAAN SDM
  • 73. PROSES PERENCANAAN S.D.M. Peramalan Kebutuhan Peramalan Program
  • 74. PERAMALAN KEBUTUHAN 1.KondisiEksternalyang meliputi: •EkonomidanSosialPolitik •Undang-undangdanPeraturanPemerintah •PendudukdanAngkatanKerja •PasarKerjadanAngkatanKerja •PerkembanganTeknologi2.PersyaratanSDM di masamendatangPenentuanpersyaratanSDM yang dibutuhkandi masamendatangselaindipengaruhiolehFaktorEksternal, jugaditentukanoleh: •OrganisasidanRancanganPekerjaan •PerencanaandanAnggaran •KebijaksanaanManajemendanFilosofiOrganisasi •SistemdanTeknologidalamOrganisasi •TujuandanRencanaOrganisasi
  • 75. 3. KetersediaanSDM dimasay.a.d. dapatdiprediksimelalui: •InventarisasiBakatyang adasaatini •PrakiraanPenguranganPegawai •PrakiraanPerpindahandanPengembangan •PengaruhPascaProgram SDM4. PrakiraanKebutuhanSDM •Dari faktor-faktordiatas, kebutuhanSDM dimasayang akandatangakandapatdiprediksikan •Yang perludiingatdalammelaksanakanPrakiraanKebutuhanSDM adalahkebutuhantersebutharusdibedakan: Apakahkebutuhantersebutbersifatsegera(urgent) atauUntukwaktuyang cukuplama (Non-Urgent) •Di sampingitujugaperludipertimbangkanTingkat UpahEksternal, AdatidaknyaPenurunanJumlahPegawaiatauRealokasiPegawai, PerbaikandanPengembanganPegawai PERAMALAN KEBUTUHAN
  • 76. PERENCANAAN PROGRAM RencanaProgram tersebutmeliputi2 Hal besaryakni: ManajemenKinerja& ManajemenKarier
  • 77. planning is the process of setting goals and deciding best way to achieve them planning
  • 78. 1.Hal-hal yang berkaitan dengan keorganisasian seperti aktifitas kerja, hubungan kerja, tanggung jawab kerja, standar kerja, dan kualitas kehidupan kerja. 2.Penilaian kinerja yang terdiri dari perencanaan dan tujuan kinerja, bimbingan, dan evaluasi. 3.Struktur imbalan seperti kompensiasi dan pembagian keuntungan Manajemen Kinerja
  • 79. 1.Sistem dan kebijakan perusahaan yang terdiri dari rekrutmen, seleksi dan penempatan, promosi dan transfer, diklat dan pengembangan serta pemberhentian atau pensiun. 2.Suksesi Manajemen yang meliputi kajian individu, persyaratan posisi, Peta pergantian tempat, rencana penggantian ( Suksesi ) dan perjalanan kemajuan karier. 3.Kesempatan berkarier yang meliputi syarat jabatan, pola karier dan komunikasi karier. 4.Rencana karier individu yang terdiri atas analisisis diri sendiri, rencana karier perorangan dan rencana aksi pengembangan perorangan. Manajemen Karir
  • 80. BEBERAPA PERMASALAHAN PERENCANAAN SDM Kemampuan PerusahaanPerubahan Konsumen Perkembangan TeknologiPerubahanAngkatan KerjaKebijakanPemerintahPerilakuPesaing
  • 81. ANALISIS TENAGA KERJA Merupakan Penilaian terhadap Tenaga Kerja yang ada dalam suatu Departemen, yang masuk ke dalam dan keluar dari Departemen tsb
  • 82. ANALISA TENAGA KERJA 1. Jumlah Tenaga Kerja Bertolak dari Tujuan SDM yang disusun berdasarkan tugas-tugas di dalam Deskripsi Pekerjaan, termasuk wewenang dan tanggung jawabnya, dapat ditetapkan Volume dan Beban Kerja setiap unit kerja. Kemudian dapat dihitung jumlah SDM yang diperlukan. 2. Komposisi Tenaga Kerja Analisis Komposisi ini, pertama kegiatannya untuk mengetahui apakah semua posisi/jabatan telah terisi atau belum. Dengan demikian akan dapat diketahui jika ternyata masih terdapat posisi/jabatan yang kosong dari sudut jumlahnya. Kegiatannya yang kedua adalah menginventarisasikan adanya promosi, pemindahan, pensiun atau keluar/dikeluarkan.
  • 83. ANALISA TENAGA KERJA 3. Kualitas Tenaga Kerja Kegiatannya dilakukan dalam bentuk “inventarisasi kemampuan” para pekerja, dihubungkan dengan tugas-tugas yang sedang atau akan diembannya. ANALISA BEBAN KERJA Analisis ini menekankan pada bagaimana suatu pekerjaan akan dilakukan dan kemampuan untuk mengantisipasi munculnya suatu pekerjaan baru di masa datang. Opini manajer secara subyektif, tren masa lalu yang dianalisis menggunakan berbagai metode statistik, pengukuran produktivitas, dan work study merupakan beberapa pendekatan yang dapat digunakan dalam melakukan analisis ini.
  • 84. PASOKAN SDM Perencanaan pemenuhan SDM yang dibutuhkan tidak terlepas dari pasokan SDM yang tersedia. Terdapat dua sumber pasokan SDM, yaitu internal, berasal dari SDM yang ada kemudian dilatih kembali atau dipromosikan untuk mengisi kekosongan. Pasokan internal tergantung pada tenaga kerja yang dimiliki perusahaan dan tingkat kemampuan untuk mengerjakan pekerjaan yang ditawarkan. Sedangkan untuk sumber eksternal, dapat berasal dari lulusan perguruan tinggi, pencari kerja lokal, transfer dari perusahaan lain, agensi penyedia jasa tenaga kerja, dan tenaga kerja asing.
  • 85. TEKNIK PERAMALAN DALAM PERENCANAAN SDMTeknikDelphi Teknik IndeksasiTeknik ExtrapolasiAnalisis Statististik
  • 86. TEKNIK DELPHI Teknik ini menggunakan keahlian sekelompok orang (biasanya manajer). Para perencana di departemen SDM dalam hal ini berfungsi sebagai penengah, menyimpulkan berbagai pendapat dan melaporkan kesimpulan- kesimpulan dari pendapat-pendapat sekelompok orang tersebut kepada para ahli. Laporan ini kemudian dikaji ulang dengan cara mensurvei ulang. Kegiatan- kegiatan ini diulang sampai para ahli mencapai consensus (biasanya empat sampai lima kali survei sudah cukup).
  • 87. TEKNIK EKSTRAPOLASITeknik ekstrapolasi ini mendasarkan diri pada tingkat perubahan atau kecenderungan pada masa lalu untuk membuat proyeksi dimasa yang akan datang. Penggunaan teknik ekstrapolasi berangkat dari pemikiran bahwa kehidupan organisasi merupakan suatu yang berulang (kontinum). Teknik ini akan mempunyai keabsahan (Validitasi) yang tinggi bila menggunakan asumsi Cateris Paribus.
  • 88. TEKNIK INDEKSASIIndeksasi adalah teknik estimasi kebutuhan SDM di masa yang akan datang dengan menandai tingkat perkembangan karyawan dengan indeks. Teknik indeksasi berangkat dari asumsi bahwa faktor-faktor yang mempengaruhi permintaan atas tenaga kerja baik yang bersifat eksternal maupun internal berada pada kondisi konstan. Sebagaimana halnya dengan teknik ekstrapolasi, teknik ini juga hanya berguna untuk perencanaan jangka panjang. Contoh klasik teknik ini : rasio antara karyawan produksi dengan hasil penjualan. Sebagai contoh, para perencana bisa menyimpulkan bahwa setiap sepuluh juta rupiah kenaikan penjualan, departemen produksi memerlukan satu tambahan karyawan baru. teknik ini mengasumsikan penyebab-penyebab permintaan tetap sama dari waktu ke waktu.
  • 89. TEKNIK ANALISIS STATISTIKBerbeda dengan teknik ekstrapolasi dan taknik indeksasi, teknik ini digunakan untuk perencanaan SDM jangka panjang. Teknik ini lebih rumit dari indeksasi maupun ekstrapolasi, namun hasilnya lebih akurat untuk jangka panjang ,karena teknik ini mempertimbangkan perubahan bergesarnya tuntutan terhadap kebutuhan SDM. Analisis statistik yang dikenal umum adalah regresi dan korelasi.
  • 90. UPAYA MENCAPAI KESUKSESAN KARIR
  • 91. K A R I E R Tahap-tahap Perkembangan Pengalaman Kerja Seseorang selama Masa Kerjanya (Casscio, 1978) Suatu Rangkaian Posisi atau kesempatan yang dimiliki Seseorang selama Yang Bersangkutan Bekerja
  • 92. Faktor-faktor yang Mempengaruhi KARIER sebagai POSISI : Struktur Organisasi Sistem Reward Performance Appraisal Budaya Organisasi(Perusahaan) Sosialisasi dan Proses Pelatihan
  • 93. PERENCANAAN KARIER Proses dimana Individu Menganalisis Minat, Bakat, Personalitas&Kapabilitasnya (sendiri) untukMencoba Menyesuaikan Karakteristik Pribadinya dengan Kesempatan yang ada
  • 94. Kumpulan Aktivitas dari Tujuan Karier dan Usaha untuk Membantu Pencapaian Tujuan tersebut PENGEMBANGAN KARIER
  • 95. 1.Urutan Sikap &Perilaku seseorang, yang merupakan Proses kelanjutan dari Aktivitas yg berkaitandenganPekerjaan, dalam rentangwaktuKehidupan Orang tersebut 2. ...next… MANAJEMEN KARIER
  • 96. 2. Proses di mana Organisasi mencoba Menyesuaikan Minat Karier Individu & Kemampuan Organisasi untuk merekrut Karyawan (Gutteridge, 1976) Proses di mana individu mengumpulkan nilai, minat, kelebihan dan kekurangan (career exploration), mengidentifkasi tujuan karier, dan penggunaan karier tersebut agartercapai MANAJEMEN KARIER
  • 97. PERSPEKTIF MANAJEMEN KARIER A S P E K PARADIGMA TRADISIONAL PARADIGMA BARU Organization Bureaucracy Network Role Generalist Multiskilled Specialist Competencies System, Operations Teamwork Development Assessment Input Output Payment Jobs Skills Contract Security for Commitment Employability for Flexibility Career Management Paternalistic Self-managed Mobility Vertical Lateral Risk Rigidity, Dependencies Stress, Anarchy
  • 98. MANAJEMEN KARIER I N D I V I D U A L Ukuran Sukses Karier: 1.Kesuksesan Psikologik: Perasaan bangga atas prestasi yang dicapai 2.Kesuksesan Vertikal: Keberhasilan meniti Piramida Korporat dari Kontrak Karier yang lama 3.Diukur dari BesarnyaGaji, PromosidanJabatan(Daniel B.Turbon)
  • 99. PROMOSI & PERUBAHAN J A B A T A N Promosi dan Perubahan Jabatan merupakan Penentu Siapa yang Maju &Siapayang Stuck. Tidak hanya menyebabkan adanya Perbedaan Pekerjaan dan Reward, tetapijuga Perbedaan Lingkungan Tempat dimanaYbsberinteraksi. Promosi didasarkan atas social presentability, visibility, organizational domainataupunpolitical skill. (Kiduff & Day, 1994)
  • 100. MANAJEMEN KARIER ORGANISASIONAL Berbagai Kebijakan dan Tindakan Organisasi untuk Meningkatkan Efektivitas Karier dari Pekerjanya (Orpen, 1994) Mengacu kepada Struktur Organisasi dan Praktek Perekrutan, Pengembangan, dan Penugasan kepada Karyawan.
  • 101. CIRI-CIRI KARIER ORGANISASIONAL Sejauh mana Perekrutan yghanya dibatasi pada Pekerjaan-pekerjaan diTingkatbawah Sejauh mana Promosi ke Jabatan yang Lebih Tinggi berasal dari Dalam Sejauh mana Penyelenggaraan Training & Pengembangan karyawan di Semua Level Sejauh mana Komitmen Karyawan terhadap Keselamatan Karyawan
  • 102. Organisasi yg Berorientasi pada KARIER : Akan memperlakukan Para Karyawan sebagai SumberDaya yang Berharga KaryawanakanSelaluTerusDilatih KaryawanakanterusDikembangkan KaryawanakanterusDipertahankan
  • 103. Kunci Penerapan Karier adalah Mobilitas &Kesempatan Karier InternalbagiParaKaryawannya Desain Karier haruslah: 1.Logis 2.Linear 3.Rasional 4.Opportunistic 5.Incremental 6.Teratur &Prediktif 7.Adaptif
  • 104. K U A L I T A S KEHIDUPAN KERJA ( Q.W.L )
  • 105. PENENTU KESUKSESAN ORGANISASI (PERUSAHAAN)
  • 106. LingkunganLuar •Persaingan •Demografi AktivitasSDM lain •PerencanaanSDM •Rekrutmen& Seleksi •Pelatihan& Pengembangan •Hubungandengan SerikatPekerja •Industrial Relation LingkunganDalam •Teknologiyang ada / yang dipakai •StrukturOrganisasi Program- program K u a l it a s Kehidupankerja Program- program ProduktivitasKeterlibatan(GKM- QCC) DesainPekerjaanKepastianKerjaStrukturOrganisasiOtomatisasiSosialisasiFlexiTime TUJUAN •Kontroldiri •Kepuasankerja •Partisipasi •RespekDiri •Kinerja TUJUAN •Kinerja meningkat •Absent menurun •Perputaran(TO) TenagaKerja menurun KUALITAS KEHIDUPAN KERJA & PRODUKTIVITAS
  • 107. KUALITAS KEHIDUPAN KERJA ( Quality of Work Life ) UpayauntukmenciptakanSuasanaKehidupanKerja, secaraFisik& Psikologik didalamOrganisasisedemikianrupasehinggaKondusifagar Para KaryawanMampumemberikanKontribusi SeoptimalMungkinkepadaOrganisasi
  • 108. PENINGKATAN KUALITAS KEHIDUPAN KERJA MELALUI “KETERLIBATAN (involvement)” Cara untukMenimbulkan INVOLVEMENTsalahsatunyaadalahdengan membentukTeam GKM (Gugus Kendali Mutu-QCC), dimanasetiapKelompok terdiri dari8hingga10Orang, yang diminta untuk Merancang Cara Kerja, Mengevaluasi Cara Kerja, sertauntukMemecahkan Masalah2yang dihadapi
  • 109. PARTISIPASI & KENDALANYA CARA PARTISIPASI KENDALAUMUM Analisis Jabatan &Desain Pekerjaan Frekuensi Perubahan ygterbatas Rekrutmen &Seleksi Aturan &Prosedur ygterlalu ketat K o m p e n s a s I Resistensi dariTop Management PenilaianPrestasiKerja(Kinerja) Resistensi Manajemen diLevelmenengah Pelatihan &Pengembangan Ketersediaandan Akses Informasiyang terbatas Kesehatan& Keselamatan Kerja(K3) Ketidaksediaan untukBerubah Hak & Tanggung-jawabKaryawan Personil SDM yg kurangProaktif
  • 110. DESAIN PEKERJAAN( JOB DESIGN ) RancanganPekerjaan(Job Design) dapatdilakukandenganCara : 1.Scientific Method 2.Individual Contemporary 3.Team Contemporary 4.Ergonomic
  • 111. SCIENTIFIC METHOD KEUNGGULAN KELEMAHAN 1.Dapat digunakan sebagaiAlatuntukPrediksi 2.Lebih Jelas 3.Menjamin “The Right Man on The Right Place” 1.MembuatJenuh 2.Dapat Mengakibatkan “Absenteeism” & “LaborTurnover”yang Tinggi serta“Sabotage”
  • 112. INDIVIDUAL CONTEMPORARY KEUNGGULAN KELEMAHAN 1.Memenuhi Kebutuhan & Tanggung-jawab 2.Membuka Peluang untuk Berkembang 3.Meningkatkan Kualitas EtikadanMoral 4.“Labor Turnover”rendah 1.Menimbulkan Masalah dibidangRutinitas 2.Peningkatan Kebutuhan Skill mengakibatkan Tuntutan Kenaikan Gaji 3.Tidak mungkin untuk Pekerjaan2yang sulit untukdiperkaya 4.Tidak semuaorang bisamenerima rotasi jabatan
  • 113. TEAM CONTEMPORARY KEUNGGULAN KELEMAHAN 1.Menimbulkan Interaksi Sosial yang sangatintens 2.Menimbulkan Dukungan SosialPara Pekerja 3.Mengurangi Masalah “Absenteeism” 1.Sulit bagi Orang yang SukarBerinteraksi 2.Memerlukan Pelatihan HubunganAntarManu- sia(Interpersonal Skills) 3.Adakalanya Kelompok Tidak Lebih Baik dari- pada Orang (individu) yang Paling Lemah
  • 114. ERGONOMIC KEUNGGULAN KELEMAHAN 1.Menjamin “The Right Man on The Right Place” 2.Mengatasi kendala Fisik 3.Memungkinkan SuatuPekerjaan dapatdiakses oleh Banyak Orang 1.Bila akan Mendesain UlangsuatuPekerjaan Biayanya akanMahal 2.Pengubahan Pekerjaan sering Terkendala oleh Struktur Organisasi
  • 115. PRODUKTIVITASKemampuanKaryawandalammelakukanPekerjaanyang menjadiTanggungjawabnyasecaraEfisien& Efektif
  • 116. Jaminan yang diharapkan olehPekerja dari Pemberi Kerja terhadap Perlindungan Status Pekerjaandari berbagai Perlakuan yang Tidak Adil HAK-HAK KARYAWAN
  • 117. Lingkungan Dalam Preferensidari Top ManagementAktivitas MSDMlainnya 1.Pelatihan & Pengembangan 2.Penilaian Kinerja(PA) 3.HubunganManajemen-SPLingkungan Luar 1.Peraturan 2.PesaingHak-hak Karyawan yangBerkaitan dengan Kepastian Pekerjaan 1.Pembubaran yangDapat Diperkirakan 2.Pembubaran yangTak DapatDiperkirakanHak-hak Karyawan yangBerkaitan dengan Pekerjaan 1.Privacy &PersonalRecord Accessibility2. Kerjasama(teamwork) 3. Pemberitahuan tentangPembubaran Maksud & Tujuan 1.Menarik Calon-calonKaryawanyang Baik 2.MempertahankanParaKaryawan yang Baik3. Mengurangi Biaya Legal SKEMA HAK-HAK KARYAWAN
  • 118. 119
  • 119. Competency Framework 120 Competency Kombinasi keahlian, pengetahuan dan kemampuan yang merupakan dasar bagi keberhasilan organisasi, kinerja individu, dan kontribusinya pada seluruh aspek organisasi NOTES Competency-based model akan bermanfaat pada organisasi yang memandang pekerja sebagai contributor dan partnerbukan sebagai input
  • 120. Pentingnya Kompetensi 121 Kompetensi adalah alat yang penting bagi pekerja dan bagi perencanaan keberhasilan. Mengidentifikasi kapabilitas, sikap, dan atribut yang diperlukan untuk kebutuhan staffingsaat ini dan masa datang sesuai dengan perubahan prioritas dan strategi perusahaan Memfokuskan upaya pengembangan SDM pada meminimalisir kesenjangan antara kapabilitas yang dibutuhkan dengan yang ada
  • 121. Tiga Komponen Kompetensi 122 Core (Inti) Kompetensi yang penting untuk pencapaian strategi. Apa yang harus dimiliki untuk menjalankan strategi organisasi dan mencapai tujuan organisasi Business Knowledge (perilaku, teknik, leadership) Kompetensi yang diterapkan pada level fungsional Kompetensi yang diperlukan untuk berhasil dalam fungsi atau jabatannya
  • 122. Dua Jenis Kompetensi 123 Hard Competenciesadalah kompetensi yang berasal dari karakteristik yang sifatnya esensial, misalnya, pengetahuan dan keahlian dasar yang secara minimal harus dimiliki pemangku jabatan tertentu sehingga mampu melaksanakan setiap tugasnya dengan baik. Soft Competencies(core competencies/core personality) adalah karakteristik individu yang berasal dari dalam diri manusia yang sulit dilihat, sehingga pengembangannya pun lebih sulit. Karena itu hasilnya pun tidak bisa dilihat dalam jangka pendek, tetapi justru akan berdampak dalam jangka panjang. Pengembangan motivasi, sikap, nilai-nilai, konsep diri, adalah unsur-unsur yang antara lain ada dalam soft competencies.
  • 123. Tiga Jenis Kompetensi 124 1. Essential Competencies (Kompetensi Dasar) -Sebagai fondasi dari pengetahuan dan keahlian yang dibutuhkan oleh setiap pemegang jabatan -Dapat dikembangkan melalui pelatihan -Relatif mudah diidentifikasi
  • 124. 125 2.Differentiating Competencies(Kompetensi Khusus) membedakan kinerja superior dari rata-rata kinerja. Ini meliputi self concept, sifat, dan motivasi dan meskipun sulit dikembangkan dapat menentukan keberhasilan jangka panjang. Dengan metodologi pengembangan kompetensi yang valid, manajer dapat menentukan, mengukur dan memberi imbalan untuk kompetensi ini. Tiga Jenis Kompetensi
  • 125. 126 3. Strategic Competencies (Kompetensi Strategis) meliputi kompetensi inti dari organisasi. Cenderung memfokuskan pada kapabilitas organisasi dan meliputi kompetensi yang akan menghasilkan keunggulan bersaing (mis: innovation, speed, service, technology). Tiga Jenis Kompetensi
  • 126. Kompetensi Organisasi & Kompetensi inti 127 Kompetensi inti dapat berupa analisis yang didasarkan pada organisasi, individu, dan sumber daya Kompetensi inti pekerja : merupakan kompetensi dasar yang penting untuk keberhasilan kinerja suatu jabatan pada tingkat tertentu dari hirarki organisasi Kompetensi inti organisasi adalah :melihat kompetensi internal dimana organisasi dinilai kurang, sangat baik, lebih baik dari pada pesaing, dan dimana kita akan mengembangkan dan menggunakannya untuk bersaing dan mencapai tujuan strategis perusahaan
  • 127. Apa itu Competitive Advantage ? 128 Kompetensi yang Membedakan Apa-apa yang Anda bisa Lakukan sementara Orang lain Tidak Bisa Apa-apa yang Anda Miliki sementara Orang Lain tidak Punya
  • 128. Kompetensi Organisasi sbg Competitive Advantage 129 • Analogidenganindividual skill : –Perbedaansetiappegawaihanyadalamhalkeahlian (skill) nya saja • Key Difference : kompetensi seharusnyaadalahlebihdari penjumlahan seluruhskill pegawai. –Pegawaiyang ahlimemiliki“bargaining power” –Untukmenjadikompetensiorganisasi, individuyang samaharuslebihbernilaididalamperusahaandibandingkandenganditempatlain
  • 129. Strategy & Competitive Advantage 130 Competitive advantage adalah sesuatu yang membuat perusahaan memperoleh posisi di atas pesaing dalam hal menarik konsumen dan mempertahankan dirinya dalam persaingan
  • 130. Tantangan dalam Competitive Advantage 131 1. Membangun Keunggulan 2. Mengembangkan Keunggulan 3. Mengorganisir Kunggulan 4. Mempertahankan Keunggulan 5. Memperbaharui Keunggulan
  • 131. Rute2Menuju Competitive Advantage 132 •Quality •Superior customer service •Achieving lower costs •Better geographic location •Technical expertise •Supply chain management •Brand image / reputation Sumber Daya yang menjadikan Beda : • Entitlements• Acquisitions & developmentsInformasi yang menjadikan Beda : • Education & research• InsightsRelationship yang menjadikan Beda : • Markets• Logistics and stakeholders
  • 132. Karakteristik Kompetensi 133 Nilai-nilai Peranan Sosial Konsep Diri Ciri-ciri Motif Kemahiran Pengetahuan Perlu untuk melaksanakan tugas dengan baik tetapi tidak memadai Ciri-ciri yang membedakan seseorang yang berhasil Mudah untuk dilihat, diukur dan dibangun Sukar untuk dilihat dan dibangun
  • 133. 134Competencies FactorsPersonal Attributes •Tingkat Energy •Etika •Keberanian / Moral •Percaya diri •Ketahanan terhadap Stress CompetenciesKnowledge •Sistem kekuasaan •Distribusi •FinanceSkills •Komunikasi •Problem Solving •AnalysisBehaviors •Teamwork •Leadership •Customer FocusMotives, Gaya Personal, Traits, Attitudes Peran/tugasyang berhubungan Denganpengetahuandan keahlian Traits Atribut yang menyebabkan seseorang berperilaku dengan cara tertentu Perilaku penting
  • 134. Apa itu Model Kompetensi ? 135 Sebuah daftar mengenai identifikasi kelompok kompetensi yang menunjukkan pekerja yang berhasil pada posisinya
  • 135. Manfaat Model Kompetensi 136 Kompetensi digunakan untuk memfokuskan diri Si Organisasi pada sesuatu yang benar-benar penting serta bagaimana membuat Para SDM berhasil mencapainya Kompetensi sangat dibutuhkan organisasi sebagai kendaraan untuk melakukan perubahan
  • 136. 137 Meningkatkan Kinerja Memfokuskan pada organizational culture dan values Mengkomunikasikan business strategy ke seluruh organisasi Memfokuskan pekerja pada hasil Memberikan kerangka bagi pengintegrasian praktek SDM yang “evolutionary”, bukan yang “revolutionary” Manfaat Model Kompetensi
  • 137. KomponenDasarModel Kompetensi 138Competencies SuccessionPlanning Rewards WorkDesign Recruitment PerformanceManagement Training & Development Notes Semua komponen dihubungkan dengan filosofi HRM
  • 138. 139 Succession Planning Penting pada saat menggunakan model kompetensi kepemimpinan Meliputi mekanisme coaching dan mentoring Menggunakan teknologi untuk mengikuti perubahan demografis dan kebutuhan organsiasi KomponenDasarModel Kompetensi
  • 139. 140 Recruitment Penarikan pegawai dilakukan berbasis kompetensi organisasi Mengidentifikasi kebutuhan dan memberikan insentif dimana diinginkan oleh target Misalnya apa yang akan menarik orang ke dalam organisasi ? Remuneration, pekerjaan yang menantang dan menarik,lingkungan kerja, kemampuan bekerja di area internasional, mobility, melayani kepentingan publik dngan memberikan kontribusi pada kebaikan masyarakat, dll. KomponenDasarModel Kompetensi
  • 140. 141 Performance Management Didasarkan pada tujuan organisasi dan personal Memberikan pengukuran yang penting dari kinerja SDM yang dihubungkan dengan kompetensi Memfokuskan pada pengembangan SDM dan telah berubah menjadi mekanisme untuk menghargai perilaku dan sikap yang penting : Meliputicompensation, training, career development, multiple-level feedback and programs, termasuk 360 degree feedback mechanisms Peningkatan imbalandidasarkan pada kontribusi, bukan pada kepemilikanKomponenDasarModel Kompetensi
  • 141. 142 Training & Development Pengembangan didasarkan pada pemahaman mengenai bisnis Pelatihan keahlian yang bersifat tradisional gigabungkan dengan program pengembangan kompetensi Pengembangan kepemimpinan difokuskan pada peningkatan kompetensi Work Design Kompetensi sesuai dengan model desain kerja yang flat dan horizontalKomponenDasarModel Kompetensi
  • 142. 143 Contoh Competency Model Manajer Pemasaran Leadership Kemampuan untuk mempengaruhi dan memotivasi bawahan, bekerja bersama untuk mengembangkan sasaran dan memimpin melalui lingkungan yang berubahCoaching & DevelopingKemampuan untuk secara efektif memberikan bimbingan /coach kepada bawahan sehingga mereka bekerja secara optimal,menngungkit kekkuatan dan pengetahuan individu Kompetensi Umum Sales Representatives Insight Kemampuan menganalisis dan engevaluasi situasi dan orang, mengembangkan perhatian Technical Expertise Menerapkan pengetahuan dengan efektif, mengikuti wilayah profesional/ teknis dan menggunakan tpengetahuan pada wilayah kerjanya dan memahami akibatnya pada wilayah lain Influence Mendorong dan memimpin kearah solusi, yang menunjukkan pemikiran kelompok. Perlu negosiasi untuk hasil yang diterima bersama Business Development Kemampuan untuk membnagun dan memelihara hubungan baik dengan klien, sales team, dalam hubungannya dengan upaya memenuhi kebutuhan dan merespon mereka. Achievement Orientation Kemampuan untuk membuat sesuatu terjadi dalam hubungannya dengan pencapaian tujuan organisasi. Innovation Kemampuan untuk secara konstan meningkatkan efektifitas organsiasi dan kinerja penjualan dengan memberikan ide, melaukan sesuatu yang baru, untuk mencapai hasil positif Teamwork Kemmapuan untuk berkolaborasi dengan orang lain, memberikan kontribusi pada tim, membantu membangun komitmen dan keberanian pada semua anggota dalam semangat kerjasama dan akuntabilitas bersama Organization and Planning Membuat tujuan operasional, mengembangkan rencana untuk menterjemahkan tujuan jangka panjang menjadi kerangka acuan pengembangan rencana operasional
  • 143. Sistem SDM Berbasis Kompetensi 144 Menjadi landasan untuk semua penerapan manajemen SDM Seperangkat proses yang terintegrasi Berhubungan dengan/dan mendukung strategi bisnis, visi dan misi perusahaan Cukup fleksibel untuk berubah sesuai dengan perubahan secara prioritas
  • 144. SARAN PRAKTIS UNTUK PENERAPAN KOMPETENSI 145
  • 145. CHECKLIST UNTUK PROYEK KOMPETENSI  ORIENTASI & PLANNING  PENGEMBANGAN KOMPETENSI  MENGEMBANGKAN APLIKASI/ALAT 146
  • 146. ORIENTASI DAN PLANNING Orientasi awal mengenai kompetensi Merencanakan pertemuan dengan kelompok manajemen dan serikat pekerja (SP) untuk penerapannya Menentukan kesiapan SDM Survey iklim kerja Observasi Memberikan sesi orientasi pada seluruh bagian Membuat komite khusus untuk menangani proyek ini 147
  • 147. MENGEMBANGKAN KOMPETENSI Mendeskripsikan jabatan ke profil jabatan dan memastikan klasifikasinya tepat Memberikan sesi penjelasan untuk masing- masing jabatan Mengorganisir pengumpulan data dan/atau mengembangkan model dan acuannya 148
  • 148. APPLICATIONS/TOOLS 149 Profil Jabatan Penilaian Kinerja Vacancy Announcements Interview mengenai Perilaku Pengembangan Karyawan : Training Program Career Path Perencanaan Karier Aturan mengenai Kompensasi
  • 149. 150Are You Ready for CBHRM?

×