Your SlideShare is downloading. ×
D1_EstructProt_02
D1_EstructProt_02
D1_EstructProt_02
D1_EstructProt_02
D1_EstructProt_02
D1_EstructProt_02
D1_EstructProt_02
D1_EstructProt_02
D1_EstructProt_02
D1_EstructProt_02
D1_EstructProt_02
D1_EstructProt_02
D1_EstructProt_02
D1_EstructProt_02
D1_EstructProt_02
D1_EstructProt_02
D1_EstructProt_02
D1_EstructProt_02
D1_EstructProt_02
D1_EstructProt_02
D1_EstructProt_02
D1_EstructProt_02
D1_EstructProt_02
D1_EstructProt_02
D1_EstructProt_02
D1_EstructProt_02
D1_EstructProt_02
D1_EstructProt_02
D1_EstructProt_02
D1_EstructProt_02
D1_EstructProt_02
D1_EstructProt_02
D1_EstructProt_02
D1_EstructProt_02
D1_EstructProt_02
D1_EstructProt_02
D1_EstructProt_02
D1_EstructProt_02
D1_EstructProt_02
D1_EstructProt_02
D1_EstructProt_02
D1_EstructProt_02
D1_EstructProt_02
D1_EstructProt_02
D1_EstructProt_02
D1_EstructProt_02
D1_EstructProt_02
D1_EstructProt_02
D1_EstructProt_02
D1_EstructProt_02
D1_EstructProt_02
D1_EstructProt_02
D1_EstructProt_02
D1_EstructProt_02
D1_EstructProt_02
Upcoming SlideShare
Loading in...5
×

Thanks for flagging this SlideShare!

Oops! An error has occurred.

×
Saving this for later? Get the SlideShare app to save on your phone or tablet. Read anywhere, anytime – even offline.
Text the download link to your phone
Standard text messaging rates apply

D1_EstructProt_02

891

Published on

Universidad Nacional de Quilmes Curso Bioinformatica Estructural de Proteinas 2007 Dia 1 - Estructura de Proteinas - 02

Universidad Nacional de Quilmes Curso Bioinformatica Estructural de Proteinas 2007 Dia 1 - Estructura de Proteinas - 02

0 Comments
1 Like
Statistics
Notes
  • Be the first to comment

No Downloads
Views
Total Views
891
On Slideshare
0
From Embeds
0
Number of Embeds
0
Actions
Shares
0
Downloads
43
Comments
0
Likes
1
Embeds 0
No embeds

Report content
Flagged as inappropriate Flag as inappropriate
Flag as inappropriate

Select your reason for flagging this presentation as inappropriate.

Cancel
No notes for slide

Transcript

  • 1. Estructura de Proteínas Aspectos prácticos
  • 2. http://www.rcsb.org
  • 3.  
  • 4. HEADER ACYLTRANSFERASE 07-OCT-95 1LXA TITLE UDP N-ACETYLGLUCOSAMINE ACYLTRANSFERASE COMPND MOL_ID: 1; COMPND 2 MOLECULE: UDP N-ACETYLGLUCOSAMINE O-ACYLTRANSFERASE; COMPND 3 CHAIN: NULL; COMPND 4 SYNONYM: LPXA; COMPND 5 EC: 2.3.1.129; COMPND 6 ENGINEERED: YES; COMPND 7 MUTATION: S64Q, V65F, D125H SOURCE MOL_ID: 1; SOURCE 2 ORGANISM_SCIENTIFIC: ESCHERICHIA COLI; SOURCE 3 STRAIN: K12; SOURCE 4 EXPRESSION_SYSTEM: MC1061; SOURCE 5 EXPRESSION_SYSTEM_PLASMID: PSR1; SOURCE 6 EXPRESSION_SYSTEM_GENE: LPXA KEYWDS 2 LIPID SYNTHESIS EXPDTA XRAY DIFFRACTION - SINGLE CRYSTAL AUTHOR S.L.RODERICK REMARK 2 REMARK 2 RESOLUTION. 2.6 ANGSTROMS. REMARK 290 REMARK 290 CRYSTALLOGRAPHIC SYMMETRY REMARK 290 SYMMETRY OPERATORS FOR SPACE GROUP:P213 REMARK 290 CRYST1 99.000 99.000 99.000 90.00 90.00 90.00 P 1 1 SCALE1 0.010101 0.000000 0.000000 0.00000 SCALE2 0.000000 0.010101 0.000000 0.00000 SCALE3 0.000000 0.000000 0.010101 0.00000 ATOM 1 N MET A 1 88.077 94.618 63.411 1.00 77.61 ATOM 2 CA MET A 1 87.915 95.650 64.419 1.00 75.36 ATOM 3 C MET A 1 86.517 95.664 65.029 1.00 59.38 ATOM 4 O MET A 1 85.616 95.027 64.492 1.00 60.53 ATOM 5 CB MET A 1 88.320 97.030 63.876 1.00 81.46 ATOM 6 CG MET A 1 88.928 97.940 64.937 1.00 90.73 ATOM 7 SD MET A 1 88.279 99.634 64.871 1.00100.00 ATOM 8 CE MET A 1 87.314 99.554 63.336 1.00 96.83 ATOM 9 N ILE A 2 86.335 96.385 66.151 1.00 38.83 ATOM 10 CA ILE A 2 85.048 96.441 66.828 1.00 33.63 ATOM 11 C ILE A 2 84.476 97.800 67.176 1.00 40.90 ATOM 12 O ILE A 2 85.112 98.600 67.855 1.00 41.85 ATOM 13 CB ILE A 2 85.132 95.721 68.140 1.00 35.31 ATOM 14 CG1 ILE A 2 85.453 94.275 67.899 1.00 37.35 ATOM 15 CG2 ILE A 2 83.799 95.853 68.856 1.00 32.19 ATOM 16 CD1 ILE A 2 85.370 93.526 69.210 1.00 53.60 ATOM 17 N ASP A 3 83.226 97.987 66.777 1.00 41.11 ATOM 18 CA ASP A 3 82.469 99.207 67.004 1.00 42.45 ATOM 19 C ASP A 3 82.283 99.669 68.426 1.00 42.41 Archivo de coordenadas Formato PDB
  • 5. http://www.ebi.ac.uk/thornton-srv/databases/pdbsum/
  • 6. Importancia del conocimiento de la estructura nativa ????
  • 7. Estructura Básica
  • 8.  
  • 9.  
  • 10. Dinámica
  • 11. Superficie y cavidades
  • 12.  
  • 13.  
  • 14.  
  • 15. Dominios
  • 16.  
  • 17.  
  • 18.  
  • 19. http://www.sanger.ac.uk/Software/Pfam/iPfam/
  • 20. Estructura cuaternaria: obligómeros
  • 21. Estructura cuaternaria: Oligómero transitorio
  • 22.  
  • 23.  
  • 24. Clasificación de plegamientos
  • 25.  
  • 26.  
  • 27.  
  • 28. Comparación de la estructura de proteínas Cambios conformacionales (ligandos, inhibidores) Detección de relaciones evolutivas lejanas Variación estructural en una familia por adaptación funcional Identificación de estructuras nativas comunes. Super plegamientos
  • 29. Cambios conformacionales (ligandos, inhibidores)
  • 30. Detección de relaciones evolutivas lejanas
  • 31. Variación estructural en una familia por adaptación funcional ( embellishments )
  • 32. Identificación de estructuras nativas comunes. Super plegamientos
  • 33. Métodos de comparación de estructuras
    • Superposición de estructuras y medición de distancias intermoleculares basados principalmente en características geométricas
    • Comparación de medidas intramoleculares
    • Combinación de ambas
  • 34.
    • Uso de métodos intermoleculares
    • Rossman y Argos 1970s. Superposición de cuerpo rígido
    • Aplicación directa para proteínas con mas de 35% I
    • Descartar regiones de loops (no da alineamientos seguros)
    • Dividir las proteínas en fragmentos
    • Uso de métodos de optimización ( Dynamic programming )
    • STAMP (Russell and Barton)
  • 35.  
  • 36. 2. Uso de métodos intramoleculares Matrices de distancias
  • 37.  
  • 38. 1LXA_model_de 1 ---------------------------MIDKSAFVHPTAIVEEGASIGAN 23 :||.:|::.|.|.|....:|||| 1THJ_model_de 1 MQEITVDEFSNIRENPVTPWNPEPSAPVIDPTAYIDPEASVIGEVTIGAN 50 1LXA_model_de 24 AHIGPFC----------IVGPHVEIGEGTVLKSHVVVNGHTKIGRDNEIY 63 ..:.|.. .||....:.:|.||.:...:|...:...|| 1THJ_model_de 51 VMVSPMASIRSDEGMPIFVGDRSNVQDGVVLHALETINEEGEPIEDN--- 97 1LXA_model_de 64 QFASIGEVNQDLKYAGEPTRVEIGDRNRIRESVTIHRGTVQGGGLTKVGS 113 |.||: |:...|.||:...:.....:| |...||. 1THJ_model_de 98 ----IVEVD------GKEYAVYIGNNVSLAHQSQVH-------GPAAVGD 130 1LXA_model_de 114 DNLLMINAHIAHDCTVGNRCILANNATLAGHVSVDDFAIIGGMTAVHQFC 163 |..:.:.|.: ....|||.|:|...:...|....|...|..||....| 1THJ_model_de 131 DTFIGMQAFV-FKSKVGNNCVLEPRSAAIGVTIPDGRYIPAGMVVTSQ– 177 1LXA_model_de 164 IIGAHVMVGGCSGVAQDVP----PYVIAQGNHATPFGVNI---EGLKRRG 206 ..|..:| .|..:..|.|..: ||: ||.|.. 1THJ_model_de 178 ------------AEADKLPEVTDDYAYSHTNEAVVY-VNVHLAEGYKET- 213 1LXA_model_de 207 FSREAITAIRNAYKLIYRSGKTLDEVKPEIAELAETYPEVKAFTDFFARS 256 1THJ_model_de 214 -------------------------------------------------- 213 1LXA_model_de 257 TRGLIR 262 1THJ_model_de 214 ------ 213 1150 1150 824 206 Atoms 15.76 15.76 15.79 15.73 RMSD All Heavy Back Bone Alpha Carbons 0-27, 28-61, 62-106, 107-170, 171-183, 191-212, 214-214 1THJ chain 'A' 1-28, 32-65, 80-124, 127-190, 193-205, 206-227, 228-228 1LXA Residues Structure
  • 39. 2. Uso de métodos intramoleculares Uso de fragmentos DALI y SSAP
  • 40. 3. Uso de métodos intramoleculares e intermoleculares COMPARER
  • 41. http://www.cathdb.info/latest/index.html
  • 42.  
  • 43.  
  • 44.  
  • 45. El número de plegamientos posibles es limitado Se estima que en la PDB existe un 20% del total de plegamientos posibles en proteínas
  • 46. Superfolds
  • 47.  
  • 48.  
  • 49. http://scop.mrc-lmb.cam.ac.uk/scop/ 2845 1539 945 Total 171 108 75 Small proteins 99 88 47 Membrane and cell surface proteins 61 46 46 Multi-domain proteins 717 409 279 Alpha and beta proteins (a+b) 629 222 136 Alpha and beta proteins (a/b) 560 290 144 All beta proteins 608 376 218 All alpha proteins Number of families Number of superfamilies Number of folds Class
  • 50. http://www.molmovdb.org/
  • 51.  
  • 52. http://www.ebi.ac.uk/msd-srv/prot_int/pistart.html
  • 53. http://pqs.ebi.ac.uk/
  • 54. http://www.supfam.org/elevy/3dcomplex/Home.cgi
  • 55. http://i.moltalk.org/

×