Your SlideShare is downloading. ×
Bse kelas 6
Upcoming SlideShare
Loading in...5
×

Thanks for flagging this SlideShare!

Oops! An error has occurred.

×

Introducing the official SlideShare app

Stunning, full-screen experience for iPhone and Android

Text the download link to your phone

Standard text messaging rates apply

Bse kelas 6

16,181
views

Published on


0 Comments
2 Likes
Statistics
Notes
  • Be the first to comment

No Downloads
Views
Total Views
16,181
On Slideshare
0
From Embeds
0
Number of Embeds
0
Actions
Shares
0
Downloads
87
Comments
0
Likes
2
Embeds 0
No embeds

Report content
Flagged as inappropriate Flag as inappropriate
Flag as inappropriate

Select your reason for flagging this presentation as inappropriate.

Cancel
No notes for slide

Transcript

  • 1. viiPanduan Membaca Buku Ini ................................................................................. ivKata Pengantar ............................................................................................................ viSemester 1Bab 1Bilangan Bulat ........................................................................................ 1A. Operasi Hitung Campuran dan Sifat-Sifat Operasi Hitungpada Bilangan Bulat............................................................................................. 2B. Perpangkatan Tiga................................................................................................ 6C. Penarikan Akar Pangkat Tiga ............................................................................ 8D. Operasi Hitung Bilangan Berpangkat Tiga dan Akar Pangkat Tiga .... 11E. Menentukan FPB dan KPK ................................................................................ 12Proyek Siswa Semester 1 ........................................................................ 15Uji Pemahaman Bab 1 ............................................................................ 16Bab 2Debit ........................................................................................................ 17MengenalDebit ............................................................................................................. 18Uji Pemahaman Bab 2 ............................................................................ 24Bab 3Luas Bangun Datar:Segibanyak dan Lingkaran .................................................................... 25A. Luas Segibanyak ................................................................................................... 26B. Luas Lingkaran....................................................................................................... 29Uji Pemahaman Bab 3 ............................................................................ 37Bab 4Volume Prisma Segitiga dan Tabung ................................................... 39A. Volume Prisma Segitiga...................................................................................... 40B. Volume Tabung ..................................................................................................... 42Uji Pemahaman Bab 4 ............................................................................ 47Bab 5Pengumpulan dan Pengolahan Data ................................................... 49A. Mengumpulkan dan MembacaData ............................................................. 50B. Menyajikan dan Menafsirkan Data dalam Bentuk Tabel ....................... 54C. Membaca dan Menafsirkan Data dalam Bentuk Diagram .................... 58Daftar IsiKata Sambutan .................................................................................................................. iii
  • 2. Bilangan BulatDi Kelas V, kamu sudah belajar operasi hitung bilangan bulat besertasifat-sifatnya. Materi tersebut akan dipelajari dan diperdalam pada bab ini.Materi bilangan bulat sangat penting peranannya dalam kehidupan sehari-hari, seperti contoh berikut.Mula-mula, suhu udara di ruangan adalah 30˚C. Di ruangan tersebutterdapat beberapa alat pendingin (AC). Dengan menggunakan alat itu, suhuudara di ruangan diatur turun 2˚C setiap jamnya. Berapakah suhu udara diruangan sesudah 3 jam?Ayo, pelajari uraian pada bab ini agar kamu dapat menyelesaikanmasalah tersebut.Apa yang kamu pelajari?Bab 11
  • 3. 2Coba Dulu1. Tentukanlah hasilnya.a. –6 + 8 d. –40 : (–5)b. 7 – (–3) e. 2 × 6 : 3c. –5 × 8 f. (2 + 3) × 6 : 102. Isi titik-titik dengan bilangan yang tepat.a. 22= … × … = … c. 16 = … karena … × … = …b. 32= … × … = … d. 25 = … karena … × … = …3. Carilah FPB dan KPK dari kedua bilangan berikut.a. 4 dan 8 c. 12 dan 16b. 10 dan 15 d. 18 dan 27Operasi Hitung Campurandan Sifat-Sifat Operasi Hitungpada Bilangan Bulat1. Operasi Hitung CampuranKamu sudah mempelajari aturan operasi hitung campuran bilanganbulat. Coba kamu jelaskan aturan tersebut dengan kata-katamu sendiri.Bandingkan hasilnya dengan aturan berikut, apakah sama?a. Jika dalam soal hanya ada perkalian dan pembagian, yang di depandikerjakan lebih dahulu. Demikian pula untuk penjumlahan danpengurangan.b. Jika dalam soal terdapat penjumlahan, pengurangan, perkalian, danpembagian sekaligus, perkalian atau pembagian dikerjakan lebihdahulu. Selanjutnya, dikerjakan penjumlahan atau pengurangan.c. Jika dalam soal terdapat tanda kurung, operasi hitung yang ada didalam tanda kurung harus dikerjakan lebih dahulu.Contoh 1:a. 9 + (–8) – 11= 1 – 11 kerjakan dari depan karena + dan – setara= –10b. 16 : 2 × (–3) = 8 × (–3) kerjakan dari depan karena : dan × setara= –24A
  • 4. 3Amati kembali Contoh 1b. Bagaimana jika pengerjaan dilakukan daribelakang, apakah hasilnya sama? Ayo, kita periksa.16 : 2 × (–3) = 16 : (–6) kerjakan dari belakang= –2,667Dari hasil ini, apa yang dapat kamu simpulkan?Contoh 2:a. –20 + 2 × (–3) = –20 + (–6) kerjakan × sebelum += –26b. 30 – 81 : (–3) = 30 – (–27) kerjakan : sebelum –= 30 + 27 aturan pengurangan= 57c. –10 × ( 26 – (–4) )= –10 × 30 kerjakan soal pada tanda kurung dahulu= –300Aku Mau TahuPernahkah kamu menggunakan kalkulator ilmiah?Kalkulator ilmiah digunakan untuk mempercepatperhitungan berbagai operasi hitung campuran.Hasil dari 8 + 6 : 2 dengan menggunakan kalkulatorilmiah adalah 11, sedangkan jika menggunakankalkulator biasa, hasilnya adalah 7. Coba praktikanolehmu. Sumber: Dokumentasi PenerbitKalkulator Biasa Kalkulator IlmiahContoh 3:Diketahui suhu udara pagi di puncaksebuah gunung adalah –8˚C. Semakinsiang, suhu udara di puncak gunungtersebut naik 5˚C setiap jam.Berapa derajat suhu udara tersebutsetelah 4 jam?Jawab:Diketahui: Suhu udara mula-mula –8˚C.Setiap jam, suhu naik 5˚C.Ditanyakan: Suhu udara setelah 4 jam.Pengerjaan:Kalimat matematika dari soal tersebut adalah sebagai berikut:–8 + 4 × 5 = –8 + (4 × 5) = –8 + 20 = 12Jadi, suhu udara di puncak gunung setelah 4 jam adalah 12˚C.Sumber: www.fone.net
  • 5. 4Ayo, Berlatih 1Ayo, kerjakan dengan benar di buku latihanmu.1. Isilah titik-titik dengan jawaban yang tepat.a. –11 – 4 + 20 = … d. 25 : (–5) × 6 = …b. 25 + 50 – (–40) = … e. –36 : (–9) × 10 = …c. –8 + (–4) – 10 = … f. –7 × (–6) : 2 × (–6) = …2. Hitunglah dengan benar.a. 20 : (–4) + 15 d. 50 : 10 + (–5) × 9b. 45 – 20 : (–4) e. –7 × {105 + (–75)} : 42c. (–14 + 20) × 11 f. 36 : (12 – 3) + 40 : (–5)3. Selesaikan soal cerita berikut.a. Diketahui suhu udara di sebuah ruangan adalah –5˚C. Suhu udara diruangan tersebut naik 2˚C setiap jam. Berapa derajat suhu di ruangantersebut setelah 3 jam?b. Suhu udara di kota Tokyo pada siang hari adalah15˚C. Semakin sore, suhu udara turun 6˚C setiapjam. Berapa derajat suhu udara tersebut 3 jamkemudian?c. Dalam suatu permainan, jika menang diberi nilai3, jika kalah diberi nilai –2, sedangkan jika seridiberi nilai –1.Tabel berikut menunjukkan hasil yang diperoleh setiap regu yang masing-masing telah bermain sebanyak 4 kali.ReguABCDEMain44444Menang21003Seri12311Kalah11130Nilai……………1) Tentukan nilai dari setiap regu.2) Regu manakah yang memperoleh nilai tertinggi?d. Seekor siput berada di dasar sumur kering sedalam 6 m. Setiap hari, siputtersebut bergerak naik sejauh 120 cm. Akan tetapi, tergelincir turun sejauh50 cm. Setelah berapa hari siput dapat naik ke permukaan sumur?e. Dalam sebuah ujian, ditetapkan setiapjawaban yang benar diberi nilai 4. Setiapjawaban yang salah diberi nilai –1. Jikatidak dijawab diberi nilai 0. Dari 50 soal,Ani dapat mengerjakan 40 soal. Adapun10 soal lainnya tidak dikerjakan. Setelahdiperiksa, jawaban Ani yang benar ada 25soal. Berapakah nilai yang diperoleh Ani?Sumber: CD ImageSumber: Dokumentasi Penerbit
  • 6. 52. Penggunaan Sifat-Sifat Operasi Hitungpada Bilangan BulatDi Kelas V, kamu sudah mempelajari sifat-sifat operasi hitung padabilanganbulat.Cobakamukemukakansifat-sifattersebut.Sifat-sifattersebutberguna untuk mempermudah perhitungan.Untuk itu, pelajari contoh berikut.Contoh 1:1. Gunakan sifat operasi hitung untuk mempermudah perhitunganbilangan-bilangan berikut.a. 256 + 160 + (–56) c. (24 × 46) + (24 × 54)b. 5 × (–49) × 20 d. (41 × 158) – (58 × 41)Jawab:a. 256 + 160 + (–56) = {256 + (–56)} + 160 sifat komutatif= 200 + 160 = 360b. 5 × (–49) × 20 = (5 × 20) × (–49) sifat komutatif= 100 × (–49) = –4.900c. (24 × 46) + (24 × 54) = 24 × (46 + 54) sifat distributif= 24 × (100)= 2.400d. (41 × 158) – (58 × 41) = (41 × 158) – (41 × 58) sifat komutatif= 41 × (158 – 58) sifat distributif= 41 × 100 = 4.1002. Lengkapi perkalian berikut dengan menggunakan sifat operasi hitung.a. 9 × 47 b. 12 × 521. Tentukan bilangan yang tepat untuk mengisi kotak kosong berikut.a. + – = –2b. × + = –2(Jawaban bisa berbeda-beda)2. Tuliskan tanda operasi (×), (:), (+), atau (–) pada titik-titik berikut sehinggamenjadi pernyataan benar.a. –6 … 4 …10 = –12 b. 20 … ( 2 … (–4) ) = –10Aku Pasti Bisa
  • 7. 6Perpangkatan TigaDi Kelas V semester 1, kamu telah mempelajari perpangkatan dua. Suatubilangan dipangkatkan dua berarti bilangan tersebut dikalikan sebanyakdua kali dengan dirinya sendiri.Untuk mengingatnya kembali, carilah bilangan yang tepat agarpernyataan berikut benar.22= … × … = … 52= … × … = …32= … × … = … 82= … × … = …Pernyataan tersebut menggambarkan perpangkatan dua dari suatubilangan.Pernyataan lain yang menggambarkan perpangkatan dua dari suatubilangan, misalnya.2= 9 × 9 = 81 9 dikalikan dengan dirinya sendiri sebanyak dua kali2= 10 × 10 = 100 10 dikalikan dengan dirinya sendiri sebanyak dua kaliPengertian pangkat dua tersebut sangat berguna untuk memahamipangkat tiga suatu bilangan, misalnya 53dan 43.3= 5 × 5 × 5 = 125 5 dikalikan dengan dirinya sendiri sebanyak tiga kali3= 4 × 4 × 4 = 64 4 dikalikan dengan dirinya sendir sebanyak tiga kaliBagaimana dengan 23? Berapakah hasilnya?23dibaca dua pangkat tiga.Artinya, 2 × 2 × 2 = 8.2 disebut bilangan pokok, 3 disebut pangkat, dan8 disebut hasil perpangkatan.Jadi, 23= 2 × 2 × 2 = 8.BAyo, Berlatih 2Ayo, kerjakan dengan benar di buku latihanmu.Hitunglah hasil operasi hitung campuran berikut dengan menggunakan sifat operasihitung.1. 132 + 170 + (–32) 4. (33 × 179) – (79 × 33)2. –5 × 73 × 20 5. 2 × (–120) × (–10)3. (25 × 49) (25 × 51) 6. 8 × 56Jawab:a. 9 × 47 = 9 × (50 – 3)= 9 × 50 – 9 × 3 sifat distributif= 450 – 27 = 423b. 12 × 52 = 12 × (50 + 2)= 12 × 50 + 12 × 2 sifat distributif= 600 + 24 = 624
  • 8. 7Pangkat tiga suatu bilangan artinya mengalikan bilangan tersebut dengandirinya sendiri sebanyak tiga kaliContoh:Sumber: Dokumentasi PenerbitBak mandi di rumah Ibu Dudi berbentuk kubus.Panjang sisi bak mandi tersebut 2 m. Berapakahvolume air (dalam liter) yang dapat ditampung baktersebut?Jawab:Volume bak mandi = Volume kubus= s3= 23= 2 × 2 × 2 = 8Jadi, volume bak tersebut 8 m3= 8 × 1 m3=8× 1.000dm3=8.000dm3=8.000L.Amati kembali bilangan-bilangan 125, 64, dan 8. Bilangan tersebut termasukbilangan kubik. Alasannya, ketiga bilangan dapat dinyatakan sebagai per-pangkatan tiga suatu bilangan cacah, yaitu 53, 43, dan 23.Bilangan kubik adalah bilangan yang dapat dinyatakan sebagaiperpangkatan tiga dari suatu bilangan cacahContoh lain dari bilangan kubik adalah 27. Hal ini disebabkan 27 dapatdinyatakan sebagai perpangkatan tiga dari 3, yaitu 33= 27. Adapun bilangan 30bukan bilangan kubik. Hal ini disebabkan 30 tidak dapat dinyatakan sebagaiperpangkatan tiga dari suatu bilangan cacah.Ayo, kerjakan di buku latihanmu.1. Tentukan hasil perpangkatan tiga dari bilangan berikut.a. 73= … c. 103= … e. 133= …b. 83= … d. 113= … f. 143= …2. Jiplak dan beri tanda ✓ pada gambar jeruk yang memuat bilangan kubik.215 1.331729121 7003. Jawab soal berikut dengan benar.a. Tulis 5 bilangan kubik antara 1 sampai 1.000.b. Sebuahdaduberbentukkubuspanjangrusuknya1,2cm.Berapa cm3volume dadu tersebut?c. Hitung volume kubus yang panjang sisinya sebagaiberikut.1) 14 cm 2) 2,1 cm 3) 4,25 cmAyo, Berlatih 31,2 cm
  • 9. 8Tugas 1Ayo, lakukan tugas ini secara berkelompok (4 sampai 6 orang).Carilah benda di sekitarmu yang berbentuk kubus (paling sedikit 3 benda).Kemudian, ukur panjang rusuknya dan tentukan volumenya.No. Nama Benda Bilangan Pokok VolumeV = 8 × 8 × 8 = 512 mm3……8 mm……Dadu……1.2.3.Buatlah laporannya dan kemukakan hasilnya secara singkat di depan kelas.Penarikan Akar Pangkat TigaSebuah dus berbentuk kubus volumenya 64 dm3.Berapakah panjang rusuk kubus tersebut?Untuk menjawabnya, pelajari cara penarikan akarpangkat tiga berikut.Kamu telah mengetahui bahwa kebalikan dariperpangkatan dua adalah akar pangkat dua. Misalnya,kebalikan dari 52= 25 adalah akar pangkat dua dari 25,yaitu 5. Secara singkat, ditulis 25 = 5.C4. Tentukan apakah bilangan-bilangan berikut merupakan bilangan kubik ataubukan. Jelaskan cara yang kamu lakukan untuk memperoleh jawabanmu.a. 216 b. 525 c. 900Aku Mau TahuUntuk menghitung 73dengan kalkulator, tekan tombol-tombol berikut.=3x y7Hasil yang akan didapat adalah 343.Sekarang, peragakan cara menghitung soal-soal padaAyo, Berlatih 2 no 1 dan 2. Diskusikan bersama teman-temanmu.Sumber: Dokumentasi PenerbitSumber: CD Image
  • 10. 9Pengertian tersebut dapat digunakan untuk mengartikan kebalikan dariperpangkatan tiga.Kebalikan dari perpangkatan tiga adalah akar pangkat tigaPerhatikan perpangkatan tiga berikut.23= 2 × 2 × 2 = 853= 5 × 5 × 5 = 125Akar pangkat tiga adalah kebalikan dari perpangkatan tiga.83= 2 2 2322 = 2 karena 23= 81253= 5 5 5355 = 5 karena 53= 125Contoh 1:Tentukanlah hasilnya.a. 273b. 643c. 2163Jawab:a. Untuk menentukan 273, cari bilangan yang apabila dikali dirinya sendirisebanyak tiga kali hasilnya 27.Ayo, coba dengan bilangan 1.1 × 1 × 1 = 1 ≠ 27 tidak memenuhiKita coba lagi dengan 2.2 × 2 × 2 = 8 ≠ 27 tidak memenuhiCoba lagi dengan 3.3 × 3 × 3 = 27 memenuhiJadi, 273= 3 karena 3 × 3 × 3 = 27b. 643= 4 karena 4 × 4 × 4 = 64c. 2163= 6 karena 6 × 6 × 6 = 216Contoh 2:Volume sebuah kubus adalah 512 cm3.Tentukanlah panjang sisi kubus tersebut?Jawab:Volume kubus V = s3ss512 = s3ss masukkan nilai yang diketahuis3ss = 512s = 5123= 8 karena 8 × 8 × 8 = 512Jadi, panjang sisi kubus tersebut 8 cm.
  • 11. 10Sebuah dus kosong berbentuk kubus yang panjang rusuknya 16 cm akan diisidengan dus-dus kecil berbentuk kubus yang panjang rusuknya 4 cm.Berapa banyak dus kecil yang dapat dimasukkan ke dalam dus besar tersebut?Aku Pasti BisaV = 729 cm3Ayo, Berlatih 4Ayo, kerjakan di buku latihanmu.1. Tentukan bilangan yang tepat untuk mengisi titik-titik berikut.Contoh: 643= 4 karena 4× 4 × 4 = 64a. 2163= … karena ….b. 21973= … karena ….c. 3.3753= … karena ….d. 9.2613= … karena ….e. 15.6253= … karena ….f. 4.9133= … karena ….2. Isilah titik-titik berikut dengan tanda <, >, atau =.a. 1253… 4b. 13313. … 10003.c. 12 … 33753.d. 273… 33. Selesaikan soal cerita berikut.a. Diketahui volume sebuah kubus 729 cm3.Berapakah panjang rusuk kubus tersebut?b. Sebuah bak mandi berbentuk kubus. Volumenya 343 L.Berapa centimeter panjang rusuk kubus tersebut?c. Sebuah kubus mempunyai volume yang sama dengan balok yang berukuranpanjang 16 cm, lebar 8 cm, dan tinggi 4 cm. Berapa cm panjang sisi kubustersebut?d. Coba tuliskan cara mencari akar pangkat tiga dari 216.
  • 12. 11Operasi Hitung Bilangan BerpangkatTiga dan Akar Pangkat TigaKamu telah mempelajari perpangkatan tiga dan akar pangkat tiga.Sekarang, kamu akan mempelajari operasi hitung bilangan berpangkat tigadan akar pangkat tiga. Pelajari contoh berikut.Contoh:1. 43+ 23= 64 + 8 = 72 4. 63: 23= 216 : 8 = 272. 53– 33= 125 – 27 = 98 5. 8 643 38 = 2 + 4 = 63. 23× 43= 8 × 64 = 512 6. 1253× 33= 5 × 27 = 135DAyo, Berlatih 5Ayo, kerjakan di buku latihanmu.1. 63+ 33= ... 4. 83: 43= ...2. 83– 23= ... 5. 2 363 333= ...3. 33× 33= ...Aku Mau TahuBilangan 153 mempunyai sifat yang unik. Bilangan tersebut sama denganjumlah pangkat tiga dari angka-angka yang menyusunnya.153 = 13+ 53+ 33= 1 + 125 + 27Ada tiga bilangan lain yang lebih kecil dari 500 yang memenuhi sifat seperti153. Coba kamu temukan ketiga bilangan tersebut.Ayo, lakukan tugas ini secara perseorangan.Carilah buku yang memuat tabel pangkat 3 dan akar pangkat 3.Kamu dapat mencarinya di perpustakaan. Fotokopi atau salin tabel tersebutuntuk membantumu ketika mengerjakan soal.Tugas 2
  • 13. 1224221230323 52615Menentukan FPB dan KPK1. Menentukan FPB dan KPK dari Dua BilanganDi Kelas IV dan V, kamu sudah belajar FPB dan KPK. Kamu pun telahmempelajari cara menentukan FPB dan KPK dari dua bilangan. Coba kamujelaskan dengan kata-katamu sendiri cara tersebut. Apakah hasilnya samadengan uraian berikut?Cara Menentukan FPB dari Dua Bilangana. Tuliskan kedua bilangan itu sebagai perkalian faktor prima (faktorisasiprima).b. Tentukan perkalian faktor prima yang sama dari kedua bilangan itu. Jikafaktor yang sama tersebut pangkatnya berbeda, tentukan faktor yangpangkatnya terkecil (misalnya, 22dan 23, diambil 22) dan kalikan.Cara Menentukan KPK dari Dua Bilangana. Tuliskan kedua bilangan itu sebagai perkalian faktor prima (faktorisasiprima).b. Tentukan semua perkalian faktor prima dari kedua bilangan itu. Untukfaktor yang sama, tentukan faktor yang pangkatnya terbesar (misalnya,32dan 33, diambil 33) dan kalikanContoh 1:Tentukan FPB dan KPK dari 24 dan 30.Jawab:Cara 1:Dari diagram pohon di samping diperoleh:24 = 2 × 2 × 2 × 3 = 23× 330 = 2 × 3 × 5FPB dari 24 dan 30 adalah 2 × 3 = 6KPK dari 24 dan 30 adalah 23× 3 × 5 = 8 × 3 × 5 = 120Cara 2:24 3012 154 532FPB = 2 × 3 = 6KPK = 2 × 3 × 4 × 5= 6 × 20 = 120Jadi, FPB dan KPK dari 24 dan 30 adalah 6 dan 120.Cara manakah yang menurutmu lebih mudah? Berikan alasan untukjawabanmu.E
  • 14. 132. Menentukan FPB dan KPK dari Tiga BilanganCara yang digunakan untuk mencari FPB dan KPK dari tiga bilanganhampir sama dengan cara mencari FPB dan KPK dari dua bilangan. Untuklebih jelasnya, pelajari contoh berikut.Contoh 1:Tentukan FPB dan KPK dari 8, 12, dan 36.Jawab:362283212222 3231894 6Faktorisasi prima dari 8 adalah 2 × 2 × 2 = 23Faktorisasi prima dari 12 adalah 2 × 2 × 3 = 22× 3Faktorisasi prima dari 36 adalah 2 × 2 × 3 × 3 = 22× 32FPB dari 8, 12, dan 36 adalah 22= 4KPK dari 8, 12, dan 36 adalah 23× 32= 8 × 9 = 72Jadi, FPB dan KPK dari 8, 12, dan 36 adalah 4 dan 72.Contoh 2:Ada 3 lampu. Lampu A menyala setiap 8 detik, lampu B setiap 15 detik,Bdan lampu C setiap 20 detik. Berapa detik sekali ketiga lampu itu menyalaCbersamaan?Jawab:Untuk menyelesaikan soal ini, kamu harus mencari KPK dari 8, 15, dan 20.Faktorisasi prima dari 8 adalah 23Faktorisasi prima dari 15 adalah 3 × 5Faktorisasi prima dari 20 adalah 2 × 2 × 5 = 22× 5KPK dari 8, 15, dan 20 adalah 23× 3 × 5 = 8 × 3 × 5 = 120Jadi, ketiga lampu menyala secara bersamaan setiap 120 detik (2 menit).Ayo, kerjakan dengan benar di buku latihanmu.1. Tentukan FPB dan KPK dari bilangan berikut.a. 8 dan 12b. 10 dan 20c. 15 dan 20d. 18 dan 40e. 72 dan 90Ayo, Berlatih 6
  • 15. 14erangkumngkumAyo, MeranAyo, Merangyyo, ee aarrMMAAAAyo, MeraooAyo MeraAAyAyoyyoooo,, MMeeerarrara gg uuuukknnnngggkumnnggkukuuummmmmmmm1. Aturan operasi hitung campuran pada bilangan cacah berlaku juga padabilangan bulat.2. Sifat-sifat operasi hitung berguna untuk mempermudah perhitungan.Adakah materi lain yang kamu peroleh dari bab ini? Tulislah di buku catatanmumengenai rangkuman materi lainnya.f.ff 80 dan 100g. 240 dan 300h. 330 dan 5002. Tentukan FPB dan KPK dari bilangan berikut.a. 8, 12, dan 20b. 10, 20, dan 30c. 15, 18, dan 28d. 20, 28, dan 35e. 40, 45, dan 50f.ff 70, 80, dan 100g. 200, 250, dan 500h. 400, 550, dan 600i. 720, 800, dan 1.2003. Selesaikan soal cerita berikut dalam buku latihanmu.a. Pak Husin membeli 15 pulpen, 24 buku, dan 30 pensil. Alat-alat tulistersebut akan dibagikan kepada sebanyak mungkin siswanya. Setiap siswamemperoleh pulpen, buku, dan pensil yang jumlahnya sama. Berapa siswayang menerima pulpen, buku, dan pensil tersebut? Berapa banyak pulpen,buku, dan pensil yang diterima setiap siswa?b. Pak Yoyo mempunyai 24 apel, 16 jeruk, dan 20 pisang. Ketiga jenis buah-buahan tersebut akan dimasukkan ke dalam kantong-kantong plastiksebanyak-banyaknya. Ketiga jenis buah-buahan dalam setiap kantongsama banyak. Berapa banyak kantong plastik yang dibutuhkan Pak Yoyo?c. Tiga buah lampu lalu lintas masing-masing menyalakan warna hijau setiap8 detik, 10 detik, dan 12 detik. Setiap berapa detikkah ketiga lampu lalulintas tersebut akan menyala secara bersamaan?d. Amir, Hilman, dan Janu bermain bulutangkis ber-sama-sama. Merka bermain pada tanggal 4 Januari2007. Amir bermain bulutangkis setiap 8 hari sekali.Hilman bermain bulutangkis setiap 12 hari sekali.Janu bermain bulutangkis setiap 24 hari sekali. Kapanmereka akan bermain bersama-sama untuk keduadan ketiga kalinya?e. Ibu Desi membagikan 40 permen dan 25 makanan ringan kepada siswa-siswanya. Setiap siswa memperoleh permen dan makanan ringan denganjumlah yang sama. Berapa banyak siswa yang mendapatkan permen danmakanan ringan tersebut?
  • 16. 15Apakah Kamu Sudah Paham?Setelah kamu mempelajari materi bilangan bulat, adakah yang belum kamupahami? Bagian mana yang masih belum kamu pahami? Diskusikanlah bersamateman dan gurumu.Peta Penuntun BelajarBilangan BulatSifat OperasiHitungOperasi HitungCampuranAkardan Pangkat TigaFPBdan KPKmempelajariMateri Pokok: Bilangan BulatLakukanlah tugas ini secara berkelompok.Di Kelas V, kamu sudah belajar pada penjumlahan dan perkalianbilangan bulat berlaku sifat komutatif, sifat asosiatif, dan sifat distributif.Sekarang,selidikilahapakahsifat-sifattersebutberlakupadapengurangandan pembagian bilangan bulat?Berikan contoh untuk mendukung jawabanmu. Setelah itu, cari dibuku lain mengenai hal ini. Berikan laporannya.Proyek Siswa Semester 1
  • 17. 16A. Ayo, isititik-titikberikutdenganjawabanyangbenar.1. –26 + 30 – (–14) = ...2. –11 × 4 + 28 = ...3. –32 × (10 + (–3)) = ...4. 43= ...5. 3433 = ...6. 33+ 23= ...7. 93: 273 = ...8. FPB dari 20, 28, dan 36 adalah ....9. KPK dari 14, 22, dan 30 adalah ....10. Soal terbukaDiketahuiFPB dari ketiga bilanganadalah 1. Ketiga bilangan tersebutyang mungkin adalah ....Uji Pemahaman Bab 1B. Ayo, kerjakan soal-soal berikut ini.1. Jelaskan apa yang dimaksud sifatkomutatif. Berikan contohnya.2. Jelaskan cara mencari akar pangkattiga dari sebuah bilangan.3. Sebuahbakmandiberbentukkubus.Volume air yang dapat ditampungadalah 216 liter. Tentukan panjangsisi bak mandi (dalam cm).4. Jelaskan cara mencari FPB dari tigabilangan.5. Andi berlatih bulutangkis setiap3 hari sekali. Badu berlatih bulu-tangkis setiap 5 hari sekali. Can-dra berlatih bulutangkis setiap 6hari sekali. Mereka bertiga berlatihbulutangkis di Gelanggang Olah-raga(GOR)yangsama.Padatanggal1 Mei 2008, mereka bersama-samaberlatih bulu-tangkis. Pada tanggalberapa mereka akan berlatih bersa-ma-sama lagi?
  • 18. DebitDi Kelas V, kamu sudah mempelajari kecepatan dan satuan kecepatan.Sekarang, akan dipelajari kecepatan air yang mengalir dari sebuah pipa.Kecepatan air yang mengalir lebih sering disebut dengan debit. Materidebit ini sangat berguna dalam kehidupan sehari-hari. Salah satunya untukmenyelesaikan masalah berikut.Pak Hamdan akan mengisi tong air dengan selang air. Kapasitas tongair tersebut 250 liter. Jika debit air yang mengalir pada selang 2 liter/detik,berapa lama waktu untuk mengisi tong sampai penuh?Dapatkah kamu menyelesaikan masalah tersebut? Untuk itu, pelajaribab ini dengan baik.Apa yang kamu pelajari?Bab 217
  • 19. 18Mengenal Debit1. Pengertian DebitPernahkah kamu mengisi bak mandi? Berapalama kamu mengisinya sampai penuh? Lama waktupengisian bak bergantung pada ukuran bak tersebut.Semakin besar bak mandi, tentu waktu pengisiansemakin lama.Selain itu, besar kecilnya air yang memancar darikran bak mandi mempengaruhi lama waktu pengisian.Semakin besar air yang memancar, semakin sedikit waktu yang diperlukan.Banyaknya air yang mengalir dari kran dalam waktu tertentu inilah yangdisebut debit.Debit (D) =Volume air (dalam liter / detik)Waktu (detik)Contoh 1:a. Andi mengisi bak mandi dengan air dari kran.Debit air yang keluar dari kran tersebut adalah3 L / detik.Artinya, dalam waktu 1 detik, air yang keluar darikran tersebut adalah 3 L.b. Debit air sebuah air terjun adalah 5 m3/detik.Artinya dalam waktu 1 detik, air yang mengalir padaair terjun tersebut 5 m3.1. Isilah titik-titik dengan bilangan yang tepat.a. 1 menit = … detik c. 1 L = … cm3b. 1 L = … dm3d. 1 m3= … L2. Tentukan volume bangun berikut.a.2 m2 m2 mb.3 dm 1 dm2 dmSumber: CD ImageSumber: Dokumentasi PenerbitCoba Dulu
  • 20. 19Contoh 2:Di dasar bak mandi terdapat pipa saluran pembuangan. Jika pipa tersebutdibuka, air sebanyak 30 L akan mengalir selama 1 menit.Berapa debit air pada pipa tersebut?Jawab:1 menit = 60 detikDebit air =volume airwaktu=3060=12Jadi, debit air yang mengalir pada pipa tersebut12L / detik.Contoh 3:Untuk mencuci motor, Pak Feri menggunakan selang air. Debit air yangmengalir dalam selang tersebut adalah 2 L/detik. Jika Pak Feri menggunakanselang air tersebut selama 20 detik, berapa liter air yang ia gunakan?Jawab:Debit air yang mengalir pada selang 2 L/detik.Berartidalam1detik,airyangbanyakmengalir melalui selang adalah 2 L. Denganbegitu, dalam waktu 20 detik, air mengalirpada selang adalah 20 × 2 L = 40 L.Jadi, Pak Feri menggunakan 40 L air untukmencuci motor.Sumber: Dokumentasi PenerbitAktivitas 1Ayo, lakukan aktivitas ini secara berkelompok (3 sampai 5 orang).Sediakan botol minuman bervolume/berkapasitas tertentu (misal 600 ml atau1,5 L). Sediakan pula Stopwacth atau jam tangan. Buka penuh tutup kran air.Isi botol dari kran tersebut sampai penuh dan catat waktunya. Hitung puladebitnya. Sekarang, perkecil bukaan kran air sedikit. Isi botol dengan air darikran. Hitung debitnya. Ulangi lagi untuk bukaan kran lainnya.Salin dan isikan hasilnya pada tabel berikut.
  • 21. 20Kranterbuka penuh……Volume Waktu Debit………………………Amati tabel yang kamu peroleh. Apakah semakin besar debit air yang keluar darikran, semakin lama waktu yang diperlukan.Hasil apalagi yang dapat kamu peroleh dari tabel tersebut.Buat laporannya. Bacakan hasilnya di depan kelas.Ayo, lakukan secara berkelompok ( 3 – 5 orang ).Carilah informasi di buku, koran, atau internet mengenai debit air yangmengalir pada sungai di daerahmu. Kamu dapat menanyakannya ke kantorperairan. Pada bulan apa debit airnya paling tinggi? Pada bulan apa debit airnyapaling rendah? Pada nilai berapakah debit air sungai mengakibatkan banjir?Buatlah laporannya. Bacakan hasilnya di depan kelas.Ayo, Berlatih 1Ayo, kerjakan di buku latihanmu.1. Jelaskan arti dari satuan debit berikut.a. 6 L/ detik b. 12 L/ detik c. 4 m3/ detik2. Tentukanlah debit airnya.a. Dalam waktu 3 detik, pipa dapat mengalirkan air sebanyak 12 Literb. Kran air dapat memancarkan air sebanyak 18 m3dalamwaktu 6 detik.c. Pipa pembuangan kolam dapat mengeluarkan air sebanyak30 m3dalam waktu12menit.Sebuah kolam renang dialiri air dari 4 buah selang hingga penuh. Debit padasetiap selang adalah 1,5 L/detik. Jika waktu yang diperlukan agar kolam renangterisi penuh adalah 5 jam, tentukan volume kolam renang tersebut?Aku Pasti BisaTugas 1
  • 22. 21bak tersebut, dialirkan air melalui kran. Debit air yangkeluar dari kran adalah 4 L/detik. Berapa lama waktuuntuk mengisi bak sampai penuh?5. Kapasitastempatbensin(tangki)sepedamotor adalah 6 L. Dalam tangki tersebuttersisa bensin sebanyak 1 Liter. Pak Arifhendak mengisi lagi dengan bensin.Debit yang keluar dari pipa pom bensinadalah 1,25 L/detik. Berapa lama waktuuntuk mengisi tangki sampai penuh?6. Debitairyangkeluardaripipapombensinadalah0,5L/detik.Jikasebuahmobildiisi bensin dari pipa tersebut selama12menit, berapa banyak bensin yangdiisikan? Harga 1 L bensin Rp4.500,00. Berapa uang untuk membeli seluruhbensin tersebut?7. Sebuah bak mandi berbentuk kubus. Panjang sisinya 1 m. Bak mandi tersebutdialiri air melalui kran dengan debit 4 L/detik.Berapa lama waktu yang diperlukan untuk mengisi sampai penuh baktersebut?8. Bak mandi di rumah Ibu Hindun berbentuk kubus. Panjang sisi bak manditersebut adalah 1,5 m. Suatu hari, Ibu Hindun menguras bak mandi tersebut.Untuk mengisi lagi bak tersebut, ia mengalirkan air melalui kran. Debit airyang keluar dari kran adalah 5 L/detik. Berapa lama waktu untuk mengisipenuh bak tersebut? Jika ia mulai mengisi pada pukul 16.30, pada pukulberapakah ia selesai.9. Amati gambar di samping.Dari keadaan penuh, kolam tersebuthendak dikuras. Untuk mengurasnyadigunakan 2 pipa saluran pembuangan.Pipa pertama dapat mengalirkan airdengan debit 12 L / detik. Pipa keduadapat mengalirkan air dengan debit8 L / detik. Berapa lama waktu yangdiperlukan untuk mengosongkan kolamtersebut?p = 5 mt = 2 ml = 3 m3. Debit air yang keluar dari pipa adalah 7 L/detik. Berapabanyak air yang dikeluarkan pipa tersebut selama 1 menit.4. Volume sebuah bak mandi adalah 20 Liter. Untuk mengisi
  • 23. 222. Hubungan Antarsatuan DebitSatuan debit yang biasa digunakan adalah L/detik dan m3/detik.Bagaimanakah hubungan antara kedua satuan debit ini?Kamu telah mengetahui bahwa 1 L = 1 dm3=11.000m3.Jadi, 1 L /detik =11.000m3/detik.Kalikan kedua ruas dengan 1.000 sehingga diperoleh persamaanberikut.1 L/detik × 1.000 =11.000m3/detik × 1.0001.000 L/detik = 1 m3/detikJadi, 1 m3/detik = 1.000 L/detik.Jika terdapat satuan mL maka ubahlah terlebih dahulu ke dalam L.Jadi, 1 mL =11.000L atau 1 L = 1.000 mL.Contoh:a. 2 m3/detik = … L/detik2 m3/detik = 2 × 1 m3/detik = 2 × 1.000 L/detik = 2.000 L/detikJadi, 2 m3/detik = 2.000 L /detik.b. 4.000 L/detik = … m3/detik4.000 L/detik = 4.000 × 1 L/detik = 4.000 ×11.000m3/detik=4.0001.000m3/detik = 4 m3/detikJadi, 4.000 L/detik = 4 m3/detik.Ayo, Berlatih 2Ayo, kerjakan di buku latihanmu.1. Jawab dengan benar.a. 5 m3/detik = … L /detik d. 9.000 L/detik = … m3/detikb. 12 m3/detik = … L /detik e. 4.500 L/detik = … m3/detikc. 1,5 m3/detik = … L /detik f. 7.500 L/detik = … m3/detik2. Hitung dengan benar.a. 2,5 m3/detik + 1.200 L /detik = … L /detikb. 4.500 L /detik + 1,5 m3/detik = … m3/detikc. 12.000 L /detik – 7,5 m3/detik = … m3/detikd. 15.200 L /detik + 6 m3/detik – 7.200 L /detik = … m3/detike. 20.000 dm3/detik + 200 L/detik + 1,2 m3/detik = … m3/detik
  • 24. 233. Selesaikan soal cerita berikut.a. Sebuah kolam diisi air dari pipa A dan pipa B. Debit air pada pipa A adalah2 L /detik dan debit air pada pipa B adalah12kali debit air pada pipa A.Berapa m3/detik debit air pada pipa B ?b. Debit sebuah air terjun 5 m3/detik. Berapa L /detik debit air terjun itu?c. Warga desa Mekar Asih ditimpamusibah banjir selama 2 hari. Debitair pada hari pertama adalah 2.000m3/detik dan debit air pada harikedua adalah 112kali debit air padahari pertama. Berapa L/detik debitair pada hari kedua?d. Sebuah kolam akan diisi air menggunakan 2 buah pipa. Debit air pada pipapertama adalah 1,2 L/detik dan debit air pada pipa kedua 0,8 L/detik.Berapa liter volume air yang telah tertampung dalam kolam tersebutsetelah12jam?e. Sebuah akuarium dengan panjang100 cm, lebar 60 cm, dan tinggi 80 cmakan diisi air menggunakan sebuahselang yang debitnya 0,15 L/detik.Berapa lama waktu yang dibutuhkanagar34akuarium itu terisi air?Sumber: www.tempointeraktif.comAyo, Merangkum1. Debit adalah banyaknya volume air yang mengalir per satuan waktu.2. Satuan debit yang biasa digunakan adalah L/detik dan m3/detik.Adakah materi lain yang kamu peroleh dari bab ini? Tulislah di buku catatanmumengenai rangkuman materi lainnya.Setelah kamu mempelajari materi debit, adakah yang belum kamu pahami?Bagian mana yang masih belum kamu pahami? Diskusikanlah bersama temandan gurumu.Apakah Kamu Sudah Paham?100 cm80 cm60 cmSumber: Dokumentasi Penerbit
  • 25. 24Uji Pemahaman Bab 2A. Ayo, isititik-titikberikutdenganjawabanyangbenar.1. Arti dari satuan debit 5 L/detikadalah ....2. Arti dari satuan debit 2 m3/detikadalah ....3. Dalam 2 detik, pipa air dapatmengalirkan air sebanyak 64 L.Debit air yang mengalir pada pipaadalah ....4. Debit air sebuah pipa saluranpembuangan adalah 3 m3/detik.Banyak air yang dapat dibuangdalam waktu 12 detik adalah ....Peta Penuntun BelajarDebitPengertianDebitSatuan Debit dan HubunganAntarsatuan Debitmempelajari5. Debit air pada pipa A adalah 3 L/detik. Debit air pada pipa B adalah5 L/detik. Pipa yang aliran airnyapaling lambat adalah ....6. 3 m3/detik = ... L/detik7. 7.000 L/detik = ... m3/detik8.12m3/detik = ... L/detik9. 4 m3/detik + 2.000 L/detik = ... m3/detik10. 5.000 L/detik – 3 m3/detik = ... L/detikB. Ayo, kerjakan soal-soal berikut ini.1. Jelaskanlah dengan kata-katamusendiri apa yang dimaksud dengandebit.2. Sebuah pipa dapat mengalirkan airsebanyak 1.200 L/menit. Tentukanberapa L/detik debit air pada pipa?3. Jelaskan dengan kata-katamu caramengubah satuan debit m3/detikke L/detik.4. Untuk mengisi bak mandi, PakRado menggunakan 2 pipa. Debitairpipapertama4L/detik.Debitairpipa kedua 5 L/detik. Volume bakmanditersebutadalah900L.Berapalama waktu yang diperlukan untukmengisi bak mandi tersebut.5. Debit air pada pipa A adalah 2.000L/detik.AdapundebitairpadapipaB adalah 3 m3/detik. Sebuah bakmandi akan diisi dengan salah satupipa. Pipa mana yang digunakanagar bak cepat terisi penuh?
  • 26. Luas Bangun Datar:Segibanyak dan LingkaranDi kelas sebelumnya, kamu sudah mempelajari luas dari persegi,persegipanjang, segitiga, jajarangenjang, trapesium, dan layang-layang. Padabab ini, kamu akan mempelajari cara menentukan luas bangun datar yangmerupakan gabungan dari bangun datar yang telah dipelajari.Amati bentuk benda dalam kehidupan sehari-hari. Banyak benda yangberupagabungandaribangun-bangundatarsederhana.Contohnya,seorangperajin akan membuat bentuk bintang dari kertas karton tebal. Berapacm2kertas yang diperlukan untuk membuat 100 bentuk bintang tersebut?Pelajari bab ini dengan baik. Dengan demikian, kamu dapat menyelesaikanmasalah tersebut.Apa yang kamu pelajari?Bab 325
  • 27. 26Luas SegibanyakPak Jaya seorang penjahit. Suatu hari, ia hendak membuat logo sekolahberikut dari kain.Berapa cm2luas kain yang diperlukan untuk membuat logo ini?Amati dengan saksama bentuk logo tersebut. Jika diperhatikan, bentuklogo tersebut terbentuk dari 5 segitiga yang berukuran sama.5cm4 cmLuas kain untuk membuat logo ini adalah luas bangun segilima. Olehkarena bangun ini terdiri atas 5 segitiga, luasnya sama dengan luas 5 segitiga.Satu segitiga memiliki ukuran panjang alas 5 cm dan tinggi 4 cm.ACoba DuluTentukanlah luas bangun berikut.1.10 cm6 cm4.3 cm2.20 cm32 cm12 cm5.12 cm22 cm3.8 cm14 cm6.8 cm4 cm
  • 28. 27Luas bangun segilima = 5 × luas segitiga= 5 ×alas tinggi¥2= 5 ×5 42= 5 ×202=1002= 50 cm2Jadi, luas kain yang diperlukan untuk membuat logo tersebut adalah 50 cm2.Untuk lebih memahami cara menentukan luas segibanyak, pelajaricontoh berikut.Contoh 1:10 cm6 cm Tentukanlah luas bangun tersebut.Jawab:Bangun tersebut terdiri atas persegi dan segitiga. Luas bangun tersebutadalah jumlah dari luas persegi dan segitiga.10 cm6 cm10 cm10 cm6 cmLuas bangun tersebut L = luas persegi + luas segitiga= 10 × 10 +10 62¥= 100 +602= 100 + 30 = 130Jadi, luas bangun tersebut 130 cm2.Contoh 2:Tentukanlah luas bangun berikut.6 cm12 cm8 cm
  • 29. 28Jawab:Bangun tersebut merupakan gabungan dari dua jajargenjang.6 cm12 cm12 cm8 cmLuas bangun tersebut L = luas jajargenjang I + luas jajargenjang II= a × t + a × t= 12 × 6 + 12 × 8= 72 + 96 = 168Luas bangun tersebut 168 cm2.Ayo, kerjakan di buku latihanmu.1. Tentukanlah luas bangun berikut.a. 12 cm20 cm15 cmb. 16 cm8 cm25 cm25 cmc.6 cm14 cm 12 cm11 cm8 cm2. Tentukanlah luas bangun berikut.a.4 cm5 cmb.segienamberaturan16 cm20 cm3. Ibu Tari hendak membuat hiasan berbentuk berikut dari kain. Berapa cm2kain yang diperlukan untuk membuat bentuk berikut.a.7 cm12 cm20cm5 cm45 cm6cmb.40 cm 40 cm30 cm12 cm 12 cmAyo, Berlatih 1
  • 30. 29Luas Lingkaran1. Menentukan Keliling LingkaranMasih ingatkah kamu dengan bentuk lingkaran? Apa saja unsur-unsurlingkaran itu? Salah satu benda yang berbentuk lingkaran adalah uang logam.Amati uang logam berikut.Titik O pada gambar tersebut merupakan pusat lingkaran.Ia terletak di tengah-tengah lingkaran. Panjang PO samadengan panjang OQ, disebut jari-jari lingkaran. Adapunpanjang PQ yang besarnya 2 kali panjang PO disebutdiameter.Sekarang,cobasediakanuanglogamdanbenang.Lilitkanbenang sepanjang sisi uang logam. Rentangkan benang tersebut. Panjangbenang yang terbentang ini menunjukkan keliling lingkaran.Adakah cara yang lebih mudah untuk menentukan keliling lingkaran?Lakukanlah aktivitas berikut.BPOQAktivitas 1Ayo, lakukan aktivitas ini secara berpasangan.a. Sediakanlah benda-benda yang permukaannya berbentuklingkaran. Misalnya, uang logam, tutup stoples, gelas, dankaleng susu.b. Ukur diameter uang logam. Caranya, impitkan uang logamdi antara dua buku. Jarak dua buku menunjukkan diameteruang logam. Kemudian, catat hasilnya. Diameter lingkaran(d) = … cm.c. Lingkarkan benang sepanjang keliling, kemudianbentangkan dan catat hasilnya. Keliling lingkaran(K) = … cm.d. Bagi keliling lingkaran dengan diameter yang telahkamuperoleh.Kamudapatmenggunakankalkulatorsebagaialatbantu.Kemudian,buattabelnyasepertiberikut.No. BendaKeliling(K)Diameter(d)KdTutup stoplesUang logamPermukaan gelas……… cm… cm… cm… cm… cm… cm… cm… cm… cm… cm1.2.3.4.5.……………Benang sepanjang kelilinglingkaran
  • 31. 30Jika kamu melakukan aktivitas tersebut dengan benar, nilai dariKdinicenderung tetap, yaitu mendekati nilai 3,1416. Nilai ini diberi lambang khusus,yaitup(dibaca"phi").Untukselanjutnya,nilaipdibulatkanmenjadiduadesimal,yaitu menjadi 3,14 atau dalam bentuk pecahan adalah227.Jadi,Keliling lingkaran ( )diameter lingkaranK( )d= p atauKd= p.Oleh karena itu, keliling lingkaran dapat dirumuskan sebagai berikut.K = p× d = 3,14 × d atau K =227× dKamu telah mengetahui bahwa d = 2r. Dengan demikian, rumus kelilinglingkaran dapat juga ditulis sebagai berikut.K = p× d = p × 2 r = 2 p rNilai p =227dipilih apabila panjang jari-jari atau diameter lingkaranmerupakan faktor atau kelipatan 7. Adapun nilai p = 3,14 dipilih apabilapanjang jari-jari atau diameter lingkaran bukan merupakan faktor ataukelipatan 7.Contoh 3:Tentukan keliling lingkaran berikut.14 cmJawab:Dari gambar diperoleh jari-jari lingkaran r = 14 cm. Oleh karena r = 14 cmmerupakan kelipatan 7, pilih p=227untuk menghitung kelilingnya.e. Ulangi langkah a sampai d untuk benda-benda lainnya, seperti uang logam,gelas, dan kaleng susu.f. Bandingkan hasil panjang keliling dan panjang diameter dari benda-bendayangtelahkamuukur.Apayangkamuperoleh?Bagaimanakahperbandingankeliling dan diameternya? Apakah nilai perbandingannya sama?
  • 32. 31Keliling lingkaran K = 2 × p ×r= 2 ×227×14= 2 ×22 ×2 = 44 × 2 = 88Jadi, keliling lingkaran tersebut adalah 88 cm.Contoh 4:Panjang jari-jari roda sebuah sepedaadalah 35 cm. Jika roda tersebut berputar7 kali, berapa jarak yang ditempuh sepedatersebut?Jawab:Diketahui:Roda sepeda berbentuk lingkaran denganjari-jari 35 cm (r = 35 cm).Ditanyakan:Jarak yang ditempuh sepeda jika roda berputar 7 kali.Pengerjaan:Jarak yang ditempuh roda untuk satu kali putaran adalah keliling rodatersebut.Keliling roda (keliling lingkaran) = 2 pr= 2 × 227× 35 cm= (2 × 22 × 5) cm= (2 × 5 × 22) cm sifat komutatif= (10 × 22) cm= 220 cmJadi, sekali berputar roda menempuh jarak 220 cm.Untuk 7 kali putaran, roda menempuh jarak 7 × 220 cm = 1.540 cm.Ayo, kerjakan di buku latihanmu.1. Tentukanlah keliling setiap lingkaran berikut.a.28 cmb.40 cmc.60 cm2. Keliling sebuah lingkaran adalah 88 dm. Tentukanlah jari-jari dan diameterlingkaran tersebut?Ayo, Berlatih 2Sumber: i166.photobucket.com35 cm
  • 33. 321. Buatlah sebuah lingkaran dari karton.2. Coba gunting lingkaran tersebut menjadi 12 bagian yang sama.659 10 11 127 81 2 3 4159261037114812LingkaranAktivitas 23. Ambil salah satu bagian. Kemudian, guntinglah menjadi 2 bagian yangsama.Sebuah roda sepeda berbentuk lingkaran dengan panjang jari-jari 21 cm. Jika Ghea mengendarai sepeda itu sejauh 396 m,sudah berapa kali roda sepeda itu berputar?Aku Pasti Bisa2. Menentukan Luas LingkaranJendela rumah Maya berbentuk lingkaran. Panjangdiameter jendela tersebut 42 cm. Berapa luas kaca yangdiperlukan untuk menutup jendela tersebut?Untuk menjawabnya, kamu harus menentukan luaslingkaran. Bagaimana cara mencari luas lingkaran? Ayo,lakukan aktivitas berikut.3. Sebuah tutup stoples berbentuk lingkaran mempunyai panjang diameter 18 cm.Tentukan keliling tutup stoples itu.4. Panjang jarum menit sebuah jam dinding adalah 5,7 cm. Tentukan lintasanujung jarum tersebut selama 212jam?5. Diameter sebuah roda sepeda 700 mm. Jika roda itu berputar 15 kali, berapajarak yang ditempuh roda tersebut?
  • 34. 33Contoh 4:Diketahui sebuah lingkaran memiliki jari-jari 14 mm. Tentukanlah luaslingkaran tersebut.Jawab:Dari gambar tampak jari-jari lingkaran r = 14 cmLuas lingkaran L = π× r2=227× (14)2pilih π≈ 227karena r kelipatan 7=227× 14 ×14 = 616 cm2Jadi, luas lingkaran tersebut adalah 616 cm2.Contoh 5:Amati gambar jendela tersebut.Jendela tersebut hendak dipasangi kaca.Berapa cm2luas kaca yang diperlukan untuk menutup jendela tersebut?Jawab:Diketahui : Diameter jendela = 42 cmDitanyakan : Luas kaca untuk menutupi jendela4. Susunlah bagian-bagian tadi sehingga menyerupai persegipanjang.1 3 5 7 9 112 4 6 8 10p =12× keliling lingkaranl = r12Menyerupai Persegipanjang5. Tentukan luas daerah yang dibentuk oleh potongan-potongan tersebut.Luas daerah yang terbentuk menyerupai persegipanjang. Kamu sudah tahuluas persegipanjang adalah L = p × ℓ.Pada persegipanjang tersebut, diketahuip =12× keliling lingkaran =12× (2 × π× r) = π× r ;ℓ = jari-jari lingkaran = r.Jadi, luas persegipanjang adalah L = (π× r) × r = π× r × r.Luas lingkaran adalah luas daerah yang dibatasi oleh lingkaran. Oleh karenapersegipanjang tersebut diperoleh dari lingkaran maka luas persegipanjang samadengan luas lingkaran.Dengan demikian, luas lingkaran adalahL = π× r2dengan π≈ 3,14 atau π ≈227.
  • 35. 34Pengerjaan :Luas kaca yang diperlukan untuk menutup jendela sama dengan luas jendelayangberbentuklingkaran. Diameterjendelad=42cm jari-jarir=422=21cmLuas L = π× r2=227× (21)2=227× 21 × 21= 1.386 cm2.Jadi, luas kaca yang diperlukan untuk menutup jendela tersebut adalah1.386 cm2.Ayo, Berlatih 3Ayo, kerjakan di buku latihanmu.1. Salin dan lengkapilah tabel berikut.No.Jari-jariLingkaranDiameterLingkaranKelilingLingkaranLuasLingkarana.b.c.d.e.4 cm21 cm… cm… cm… cm… cm… cm50 cm56 cm… cm… cm… cm… cm… cm… cm… cm2… cm2… cm2… cm2154 cm2Aku Mau Tahuπ adalah sebuah konstanta dalam matematika yangmerupakan perbandingan keliling lingkaran dengandiameternya, Huruf π adalah aksara Yunani yangdibaca pi.Nilai π yang lazim digunakan adalah 3,14 atau227.Namun untuk lebih tepatnya, sudah dicari sampai> 1,241,100,000,000 tempat desimal. Nilai π sampai10 tempat desimal adalah 3,14159265358. Sumber: id.wikipedia.org
  • 36. 352. Tentukanlah luas bangun berikut.a.35 cmb.14 cmc.42 cmd.10 cme.50 cmf.26 cm14 cm3. Selesaikan soal berikut.a. Luas sebuah lingkaran adalah 628 cm2. Carilah jari-jari lingkaran tersebutjika π ≈ 3,14.b. Di halaman rumah Pak Andi terdapat kolam hias. Kolam tersebutberbentuk lingkaran berdiameter 4,8 m. Berapa luas tanah yang digunakanuntuk membuat kolam tersebut?c. Berapa luas kaca yang diperlukan untuk membuatpiring berikut?d. Sebuah meja yang berbentuk lingkaran memilikidiameter 1,4 m. Di atas meja tersebut akan dipasangkaca sesuai dengan luas meja tersebut. Tentukan luaskaca yang diperlukan.e. Diketahui sebuah taman yang berbentuk lingkaran. setengah dari luastaman tersebut akan ditanami rumput. Jika jari-jari taman tersebut 21 m,tentukan luas taman yang ditanami rumput.4. Tentukanlah luas daerah yang diwarnai.a.35 cmc.160 cmb.7 cm26 cm23 cmd.40 cm14 cm
  • 37. 36Luas Bangun DatarLingkaranLuas SegibanyakPeta Penuntun BelajarmempelajariSetelah kamu mempelajari materi luas bangun datar: segibanyak dan lingkaran,adakah yang belum kamu pahami? Bagian mana yang masih belum kamupahami? Diskusikanlah bersama teman dan gurumu.Apakah Kamu Sudah Paham?Ayo, Merangkum1. Untuk menentukan luas suatu segibanyak, kamu harus membagi banguntersebut menjadi beberapa bangun datar. Hitunglah masing-masing luasbangun datar tersebut. Kemudian, jumlahkan.2. Keliling lingkaran (K) = π × d atau K = 2 πr3. Luas Lingkaran (L) = πr2Adakah materi lain yang kamu peroleh dari bab ini? Tulislah dibukucatatanmu mengenai rangkuman materi lainnya.
  • 38. 37A. Ayo, isititik-titikberikutdenganjawabanyangbenar.1. Bangun berikut terdiri atas bangun... dan ....2. Luas bangun berikut adalah ....9 cm12 cm3. Bangun yang terdiri atas duajajargenjang adalah bangun ....ABC4. Bangun berikut memiliki luas ....3 cm 3 cm4 cm5. Luas bangun berikut adalah ....4 cm14 cm20 cm4 cm6. Keliling lingkaran berikut adalah ....7 cm7. Keliling lingkaran berikut adalah ....28 cm8. Luas lingkaran berikut adalah ....21 mm9. Luas bangun berikut adalah ....7 cm10. Luas daerah yang diwarnai padagambar berikut adalah ....7 cm20 cm22 cmUji Pemahaman Bab 3
  • 39. 38B. Ayo, kerjakan soal-soal berikut ini.1. Logo sebuah perusahaan sepertiberikut.CROWN20 cm12 cm4 cm3 cm3 cm4 cmTentukan luas kain yang diperlukanuntuk membuat logo seperti ini.2. Luas sebuah lingkaran adalah616 cm2. Carilah keliling lingkarantersebut.3. Tentukanlah luas bangun berikut.4 cm18 cm4 cm3 cm6 cm24 cm6 cm18 cm3 cm
  • 40. 3 cm8 cm18 cmVolume Prisma Segitigadan TabungDiKelasV,kamusudahmempelajarivolumebalokdankubus.Padababinikamu akan mempelajari volume bangun ruang lainnya, yaitu prisma segitigadan tabung. Materi yang akan kamu pelajari ini berguna dalam kehidupansehari-hari. Salah satunya untuk menyelesaikan masalah berikut.Tentunyakamutidakasinglagidengancokelat,bukan?Kemasancokelatada yang berbentuk seperti prisma segitiga. Misalnya, pada kemasan cokelattersebut tertera isi bersih 162 gram. Jika berat 1 cm3cokelat adalah 0,9 gram,apakah berat yang tertera pada kemasan benar?Ayo,pelajaribabinidenganbaikuntukmenyelesaikanmasalahtersebut.Apa yang kamu pelajari?Bab 439
  • 41. 40Volume Prisma SegitigaPernahkah kamu melihat kemasan cokelat tersebut? Kemasan cokelat sepertiituberbentukprismasegitiga.Banyaknya cokelat yang dapat dimuat dalamkemasan ini menunjukkan volumenya. Bagaimanacara menentukan volume benda berbentuk prismasegitiga?Ayo, pelajari uraian berikut.Amatigambarberikut.Jikabalokberikutdibelahmenjadiduabagiansama,apayangterbentuk?ACoba Dulu1. Tentukan volume bangun bangun berikut.a.6 cm12 cm10 cmb.8 cm2. Tentukan luas bangun berikut.a.7 cmb.28 cmc. 4 cm3 cmd.10 cm12 cm8 cmDari peragaan tersebut terlihat hasilnya berupa 2 bangun prisma segitigaberukuran sama. Dengan demikian, volume prisma segitiga adalah setengahvolume balok.A ACGBFHDBE FHDBCE FGHDBalok ABCD.EFGH yangdibelah dua secaradiagonal memuat bidangDBFH.Balok ABD.EFHdengan alas segitigasiku-siku ABD.Prisma DBC.HFG dengan alassegitiga siku-sikuDBC.
  • 42. 41Volume prisma =12× volume balok =12× p × l × t=12¥ÊËÁÊÊËˈ¯˜ˆˆ¯¯¥p l¥ tËLuas alasOleh karena alas prismaberbentuk segitiga= Luas alas × tinggiVolume Prisma Segitiga adalah V = Lalas× tdengan V = volume prisma, Lalas= luas alas prisma, dan t = tinggi prisma.Contoh 1:Tentukan volume prisma di samping.Jawab:Diketahui Lalas= 12 cm2dan t = 14 cm makaV = Lalas× t = 12 × 14 = 168Jadi, volume prisma tersebut adalah 168 cm2.Contoh 2:Tentukanlah volume prisma segitiga berikut ini.Jawab:Dari gambar diperoleh alasnya berbentuk segitiga denganpanjang alas 3 cm dan tinggi 4 cm. Dari gambar tampakpula tinggi prisma t = 35 cm.Volume prisma = Luas alas × tinggi= (12× 3 × 4 ) × 35 = (12× 4 × 3 ) × 35= (2 × 3 ) × 35 = 6 × 35 = 210Jadi, volume prisma tersebut 210 cm3.Contoh 3:Sebuah wadah cokelat berbentuk prisma segi-tiga. Tentukanlah volume cokelat yang dapatdimasukkan ke dalam wadah tersebut. Jika 1 cm3cokelat beratnya 0,9 gram. Berapa gram cokelatdalam wadah tersebut?Jawab:Banyak cokelat yang dapat dimasukkan ke dalam wadah menunjukkanvolume wadah. Wadah berbentuk prisma segitiga sehinggaV = Luas alas × tinggi =12× 8 × 3 × 15 = 180 cm3Jadi, volume cokelat yang dapat dimuat wadah adalah 180 cm3.luas 12 cm214 cm3 cm8 cm18 cm35 cm3 cm4 cm
  • 43. 42Darisoaldiketahuiberat1cm3cokelatadalah0,9gram.Berarti,beratseluruhcokelat dalam wadah 180 × 0,9 gram = 162 gram.Ayo, kerjakan di buku latihanmu.1. Hitunglah volume prisma segitiga berikuta.Luas alas 14 cm230 cmb.42 cmLuas alas 36 cm2c.15 cm11 cm12 cm2. Selesaikan soal cerita berikut.a. Luasalassebuahprismategak24cm3.Jikatinggiprisma6cm,tentukanlahvolume prisma tegak tersebut.b. Alas sebuah prisma berbentuk segitiga. Panjang alas dan tinggi segitigaadalah 12 dan 9 cm. Jika tinggi prisma 28 cm, tentukan volumenya.c. Diketahui volume sebuah prisma tegak 1.824 cm3. Jika luas alas prismatersebut 96 cm2, berapakah tinggi prisma tersebut?d. Diketahui volume sebuah prisma tegak 1.792 cm3. Jika tinggi prismatersebut 8 cm, berapakah luas alas prisma?e. Sebuah papan nama yang terbuat dari kayuberbentuk prisma segitiga.Berapa cm3kayu yang diperlukan untukmembuat papan nama tersebut?f. Soal terbukaVolume sebuah prisma segitiga adalah 64 dm3.Carilah luas alas dan tinggi prisma yangmungkin.Volume TabungSebuah kaleng susu kental berbentuk tabung. Padakemasan susu tersebut tertera isi bersih 390 gram. Apakahkamu percaya isi bersihnya seperti yang tertera? Apakahkaleng susu terisi penuh? Untuk mengetahui jawabannya,kamu harus menghitung volume dari kaleng tersebut?Bagaimana cara mencari volume tabung?Agar kamu dapat mengetahuinya, perhatikan peragaanberikutBAyo, Berlatih 125 cm5 cm4 cm
  • 44. 43prisma tegak segiempatberaturan (balok)ttabungJika pada bidang alas dibentuk segiberaturan secara terus-menerus,bentuk apa yang kamu peroleh?Dari peragaan tersebut, terlihat bahwa dengan membentuk segiberaturan pada bidang alas secara terus-menerus, bentuk prisma akanmenyerupaibentuktabung.Olehkarenaitu,volumetabungdapatdipandangsebagai volume prisma. Kamu sudah mengetahui volume prisma = luas alas ×tinggi.Berarti,volumetabung=luasalas×tinggi.Volume tabung sama dengan luas alas dikali tinggiOleh karena alas tabung berbentuk lingkaran maka luas alas tabungadalah πr2sehingga volume tabung adalah sebagai berikut.V = πr2× t, dengan V volume tabung, r jari-jari tabung, dan t tinggi tabungContoh 1:Hitung volume tabung di samping.Jawab:Volume tabung = luas alas × tinggi= πr2× t =227× 6 × 6 × 14 = 1.584 cm3Jadi, volume tabung 1.584 cm21.584 cm3.Contoh 2:Diketahuitinggitabung21cm.Jikaalasnyaberdiameter20 cm dan π≈227, tentukan volume tabung.Jawab:Diketahui π≈227.Diameter tabung 20 cm maka panjang jari-jarinyaprisma tegak segilimaberaturan14 cm6 cm21 cm20 cmprisma tegaksegienam beraturan
  • 45. 4410 cm7 cmr =202= 10 cm dan t = 21 cm.V = πr2× t =227× (10)2× 21 = 6.600Jadi, volume tabung 6.600 cm3.Contoh 3:Volume sebuah tabung adalah 6.600 dm3.Tentukanlah jari-jari tabung tersebut jika tingginya 21 dm dan π≈227.Jawab:V = πr2× t6.600 =227× r2× 21 masukkan nilai-nilai yang diketahui6.600 =227× 21 × r2sifat komulatif6.600 = 66 r2Dengan cara coba-coba, r2yang memenuhi adalah r2= 100 karena66 × 100 = 6.600r2= 100 r = 10Jadi, jari-jari tabung tersebut 10 cm.Contoh 4:Sebuah gelas yang berdiameter 7 cm dan tinggi 10 cm penuhberisi air susu. Santi meminum habis air susu dalam gelastersebut. Berapa liter susu yang diminum Santi tersebut?Jawab:Diketahui: Diameter gelas 7 cm sehinggapanjang jari-jari gelas r =72cm = 3,5 cm = 0,35 dmDitanyakan: Volume air susu yang diminum Santi ( dalam L)Pengerjaan:Tinggi gelas t = 10 cm = 1 dm.Volume gelas = volume tabung= πr2× t=227× (0,35)2× 1= 0,385 dm3= 0,385 LOleh karena gelas tersebut penuh berisi air susu, banyakair susu yang diminum Santi = volume gelas = 0,385 L.
  • 46. 45Ayo, kerjakan di buku latihanmu.1. Hitunglah volume tabung berikut.a.11 cmluas alas 32 cm2b.42 cmd = 28 cmc.32 cmr = 7cm2. Tentukan berapa mL susu yang dapat ditampung wadah berikut.a.20 cm7 cmb.8 cm10 cmTugas 1Ayo, lakukan tugas ini secara berkelompok ( 4 sampai 5 orang).Sediakan beberapa kaleng bekas susu kentalatau kaleng berisikan daging giling/sosis.Catat isi setiap kaleng yang tertera pada sisikaleng. Kemudian, ukur diameter, tinggi, danvolume setiap kaleng. Apakah volumenyasamadenganisiyangterterapadasisikaleng?Mungkinkah jika isi yang tertera pada kalenglebih besar daripada volumenya? Bacakanhasilnya di depan kelas.Ayo, Berlatih 2
  • 47. 463. Salin dan lengkapi tabel berikut.No.Jari-jariAlas TabungDiameterAlas TabungTinggiTabungVolumeTabunga.b.c.d.7 cm21 cm… cm… cm… cm… cm24 cm… m25 cm36 cm40 cm… m… cm3… cm3… cm31.408 m34. Selesaikan soal cerita berikut.a. Keliling alas sebuah tabung adalah 44 cm. Jika tinggi tabung 30 cm,tentukan volumenya?b. Sebuah tabung dengan tinggi 14 cm memiliki 176 cm3. Tentukanlahdiameter dan keliling alas tabung?c. Volume sebuah tabung adalah 693 cm3. Jika diameter tabung 7 cm,tentukanlah tinggi tabung ini?d. Pak Kadir membeli 4 kaleng susu kental yang berbentuk tabung. Setiapkaleng susu memiliki panjang jari-jari alas 4 cm dan tinggi 9 cm. Berapamilimeter kubik susu kental yang dibeli Pak Kadir?e. Sebuahdrumminyaktanahberbentuktabung.Drumtersebut memiliki diameter alas 50 cm. Jika tinggidrum 120 cm, berapa desimeter kubik volumenya?Berapa literkah itu?f. Sebuah penampung air berbentuk tabung. Panjangdiameter alasnya 30 cm dan tinggi 1 m. Jika pe–nampung itu diisi air sampai penuh, berapa liter airyang ada dalam penampung itu?g. Sebuah tangki susu murni berbentuk tabung. Jari-jari alas tangki 1 mdan panjang tangki 28 dm. Berapa liter yang dapat dimuat oleh tangkitersebut?h. Soal terbukaVolume sebuah tabung adalah 176 dm3. Carilah jari-jari dan tinggi tabungyang mungkin.Aku Pasti BisaSebuah tabung pada gambar di samping akan diisi air dari sebuahkeran. Jika debit air pada keran 0,3 L/detik, berapa lama waktuyang dibutuhkan agar tabung ini penuh berisi air?120 cm50 cm
  • 48. 471. Volume prisma segitiga = luas alas × tinggi=12× p × l × t2. Volume tabung = luas alas × tinggi= πr2× t= πr2tAdakah materi lain yang kamu peroleh dari bab ini? Tulislah di buku catatanmumengenai rangkuman materi lainnya.Ayo, MerangkumPeta Penuntun BelajarVolume Prisma Segitigadan TabungVolume TabungVolume Prisma SegitigamempelajariApakah Kamu Sudah Paham?Setelah kamu mempelajari materi volume prisma segitiga dan tabung, adakahyang belum kamu pahami? Bagian mana yang masih belum kamu pahami?Diskusikanlah bersama teman dan gurumu.A. Ayo, isititik-titikberikutdenganjawabanyangbenar.1. Volume sebuah prisma segitiga samadengan ... volume balok.2. Rumus luas sebuah volume prismasebarang adalah ... × ....Uji Pemahaman Bab 43. Volume prisma berikut adalah ....luas alas = 36 cm243 cm
  • 49. 484. Prisma segitiga berikut memilikivolume sebesar ....26 cm9 cm 6 cm5. Volume sebuah prisma segitigaadalah 168 cm3. Luas alas prismatersebut adalah 24 cm2. Tinggiprisma adalah ....6. Prisma segitiga yang volumenyalebih besar adalah ....46 cm12 cm 9 cmluas alas 36 cm252 cmAB7. Volume tabung berikut adalah ....28 cm10 cm4. Volumesebuahtabungadalah3.300cm3. Jari-jari tabung adalah 10 cm.Carilah tingginya.5. Amati gambar berikut.3 cm 35 cmtTentukanlah tinggi prisma segitigatersebut jika volumenya 210 cm3.8. Diketahui volume sebuah tabungadalah 1.582 cm3. Tinggi tabungtersebut adalah 7 cm. Luas alastabung adalah ....9. Volumesusuyangdapatditampungwadah berikut adalah ....15 cm14 cm10. Kaleng berikut yang dapat memuatjusbuahlebihbanyakadalahkaleng....20 cm14 cm10 cm28 cmA BB. Ayo, kerjakan soal-soal berikut ini.1. Soal terbukaVolume sebuah prisma segitigaadalah 96 dm3. Carilah luas alasdan tinggi prisma tersebut yangmungkin.2. Kelilingsebuahtabungadalah88cm.Tinggitabungtersebut15cm.Carilahvolume tabung tersebut.3. Sebuah papan nama berbentukprisma segitiga samasisi. Luas alas-nya 20 cm2dan volume 300 cm3.Tentukan panjang papan namatersebut.
  • 50. Pengumpulan danPengolahan DataMateri ini merupakan materi yang belum kamu pelajari sebelumnya.Materi pada bab ini membahas cara mengumpulkan dan mengolah data.Materi pada bab ini sangat diperlukan dalam kehidupan sehari-hari. Contoh-contoh penerapan materi ini dapat kamu lihat pada uraian berikut.Petugas posyandu menimbang berat badan bayi setiap bulan. Data beratbadan bayi ini dicatat setiap bulannya sampai umur 5 tahun. Dari data ini,petugas dapat mengetahui apakah perkembangan tubuh bayi bagus atautidak. Jika beratnya terus bertambah setiap bulan, berarti perkembangannyabagus. Jika beratnya berkurang, ada masalah dengan bayi tersebut.Contoh lainnya, pemilik toko mencatat penjualan barang setiap harinya.Dari data ini, ia dapat memperkirakan barang yang laku dan kurang laku.Apa yang kamu pelajari?Bab 549
  • 51. 50Warna Kaos BanyakMerahHijauKuningMengumpulkan dan Membaca DataSiswa Kelas VI SD Banjarsari sepakat untukmembuatkaosolahraga.Ibuguruinginmengetahuiwarna kaos olahraga yang disukai siswanya. Untukitu,ibugurubertanyakepadasetiapsiswamengenaiwarna yang disukainya. Warna yang paling banyakdipilih dijadikan warna kaos. Dalam hal ini, ibuguru sedang mengumpulkan data mengenai warnakesukaan muridnya.Contohlainnya,dapatkamusimaksebagaiberikut.ACoba Dulu1. Urutkan bilangan berikut dari yang terkecil.a. 36, 30, 32, 37, 40 b. 29, 21, 28, 36, 472. Tentukan hasil dari:a. 3 4 53+4 c.7 10 23 25 30 38 15 208+ + +23 25 30 38b. 9 4 5 64+ 4 d. 108 210 330 420 210 1086+ + +210 330 + +210Sebuah stasiun televisi ingin mengetahuisiapa calon presiden terkuat Indonesia tahun2009. Untuk itu, ia melakukan jajak pendapatmelalui SMS ( Short Message Service ). Hasilnya,2.100 orang memilih calon A, 2.750 orangmemilih calon B, dan 1.420 orang memilih calonC. Dalam hal ini, stasiun televisi tersebut jugatelah melakukan pengumpulan data.Ada beberapa cara mengumpulkan data. Misalnya, mengumpulkan datadenganpencatatanlangsungdanmengisilembarisian.1. MengumpulkanDatadenganCaraPencatatanLangsungPernahkahberatbadansiswadikelasmuditimbang?Berapaberatbadanmu?Berapa berat badan temanmu? Untuk mengetahuinya, kita harus mendatasetiap siswa satu per satu secara langsung. Proses seperti inilah yang disebutmengumpulkan data dengan pencatatan langsung. Setelah tiap siswa ditimbang,dicatatlangsunghasilnya.
  • 52. 512. MengumpulkanDatadenganCaraMengisiLembarIsianUntukmengetahuicaramengumpulkandatadenganmengisiisian,lakukanaktivitas berikut.Contoh lainnya, pada proses pemilihan ketua kelas secara langsung. Setiapsiswa memberikan langsung hak pilihnya kepada calon yang diinginkan.Agar kamu lebih memahami cara mengumpulkan data dengan pencatatanlangsung, lakukan aktivitas berikut.Ayo, lakukan aktivitas ini oleh 4 atau 5 orang.a. Ambil sebuah penggaris. Kemudian, ukur panjang sepatu setiap orang dalamkelompokmu. Pengukuran dibulatkan sampai cm terdekat.b. Catat hasilnya.c. Gabungkan hasil ini dengan kelompok lainnya.Aktivitas 1Ayo, lakukan aktivitas ini secara perseorangan.a. Misalnya, kamu ingin mengetahui jenis olahraga yang disukai siswa disekolahmu. Untuk itu, buatlah pertanyaan dalam selembar kertas seperticontoh berikut. Kemudian, perbanyaklah lembar isian tersebut.Berilah tanda ✓ pada satu jenis olahraga yang kamu paling sukaiBulutangkisSepakbolaRenangBola BasketSenamBola Voli Larib. Bagikan lembar isian tersebut kepada teman-temanmu untuk diisi.c. Kumpulkan hasilnya.Aktivitas 2Aku Mau TahuPemenang dari hasil pemilihan presiden atau gubernur dapat diperkirakan be-berapa jam setelah pemilihan. Hal ini dapat terjadi dengan teknik pengumpulandata yang disebut Quick Count.
  • 53. 523. MembacaDataAyo, pelajari contoh-contoh berikut.Contoh 1:Padasemester1,nilaiulanganbahasaIndonesiayangdiperolehIndriadalah:6, 8, 9, 7, 5, 6.Dari data tersebut, tentukanlah:a. berapa kali Indri ikut ulangan bahasa Indonesia?b. berapa nilai terendah dan tertinggi yang Indri peroleh?c. berapa kali Indri memperoleh nilai 6?Jawab:a. BanyaknyaulanganyangIndriikutiadalahbanyakdatatersebut.Banyakdata ulangan tersebut ada 6. Jadi, ia mengikuti 6 kali ulangan bahasaIndonesia.b. Nilai terendah adalah nilai paling kecil dari data tersebut, yaitu 5.Adapun nilai terbesarnya adalah 9.c. Dari data diketahui Indri memperoleh nilai 6 sebanyak 2 kali.Contoh 2:Data berikut menunjukkan cara berangkat ke sekolah sisiwa SDN 1Banjarsari.Berjalan kaki sebanyak 36 orang, naik sepeda : 45 orang, menggunakanangkutan umum : 78 orang, dan naik sepeda motor 26 orang. Dari datatersebut, tentukan:a. berapa banyak siswa yang menggunakan sepeda untuk pergi ke sekolah,b. palingbanyakdenganmenggunakanapa,siswadiSDtersebutberangkatke sekolah,c. berapa selisih siswa yang naik angkutan umum dan berjalan kaki?Jawab:a. 45 siswa.b. Siswa di SD tersebut paling banyak menggunakan angkutan umumuntuk pergi ke sekolah.c. Banyak siswa yang naik angkutan umum : 78Banyak siswa yang berjalan kaki : 36Selisih : 78 – 36 = 42 siswaContoh 3:Databerikutmenunjukkantinggibadan(dalamcm)siswa Kelas VI di SDN 1 Daya137 139 136 139 140 150136 133 131 132 131 136147 150 139 133 143 150131 134 131 135 137 139133 135 137 138 140 150
  • 54. 53a. Tentukan banyaknya siswa di kelas tersebut.b. Berapa banyak siswa yang memiliki tinggi badan 139 cm?c. Berapa banyak siswa yang memiliki tinggi badan 143 cm?d. Berapakah tinggi badan yang tertinggi di kelas tersebut?Jawab:a. Banyak data tersebut menunjukkan banyak siswa. Jika kamu menghitungdengan benar, diperoleh banyak siswa tersebut adalah 30 orang.b. Dengan mengamati data satu per satu, banyaknya siswa dengan tinggi139 cm ada 4 orang.c. Dengan mengamati data satu per satu, banyaknya siswa dengan tinggi143 cm ada 1 orang.d. 150 cm.Ayo, kerjakan di buku latihanmu.1. Hasil penimbangan berat badan bayi selama setahun adalah sebagai berikut.Berat waktu lahir : 2,6 kgBerat waktu 1 bulan : 2,8 kgBerat waktu 2 bulan : 3,0 kgBerat waktu 3 bulan : 3,4 kgBerat waktu 4 bulan : 3,4 kgBerat waktu 5 bulan : 3,6 kgBerat waktu 6 bulan : 4 kgBerat waktu 7 bulan : 4,2 kgBerat waktu 8 bulan : 5 kgBerat waktu 9 bulan : 5,2 kgBerat waktu 10 bulan : 7,8 kgBerat waktu 11 bulan : 5,8 kgBerat waktu 12 bulan : 6,9 kga. Berapa berat badan bayi pada bulan ke–9?b. Pada bulan ke berapa berat badan bayi 5 kg?c. Pada bulan ke berapa berat badan bayi terberat?2. Banyaknya jenis kendaraan yang melewati jalan Sudirman pada hari Selasaadalah sebagai berikut.Bus 10 buah, angkot 36 buah, sedan 17 buah, sepeda motor 96 buah, truk 6buah, sepeda 13 buah.Dari data tersebut, tentukanlah:a. berapa banyak jenis kendaraan yang melewati jalan Sudirman;b. jenis kendaraan apa yang paling banyak melewati jalan Sudirman;c. berapa banyak kendaraan yang melewati jalan Sudirman;d. manakah yang lebih sedikit melewati jalan Sudirman, kendaraan berodadua atau empat?Ayo, Berlatih 1
  • 55. 543. Hasil ulangan Matematika siswa Kelas VI C adalah sebagai berikut.6, 7, 5, 4, 5, 7, 7, 8, 9, 10, 10, 8, 6, 7, 7, 5, 4, 3, 6,4, 3, 5, 4, 6, 7, 8, 9, 10, 9, 9, 6, 5, 7, 4, 8, 9, 8, 7.a. Berapa banyak siswa di Kelas VI C?b. Berapa nilai ulangan Matematika palingbesar yang diperoleh?c. Berapa banyak siswa yang memperolehnilai 6?d. Berapa banyak siswa yang memperolehnilai terkecil?Menyajikan dan Menafsirkan Datadalam Bentuk TabelAmatikembaliContoh3.Berapabanyaksiswadengantinggi135cm?Untukmengetahui jawabannya, kamu harus mengamati satu per satu data tersebut.Tentu saja cara seperti ini cukup menyulitkan dalam membaca data. Akan lebihmudah membaca jika data disajikan dalam bentuk tabel. Bagaimana caranya?Pelajari contoh berikut.Contoh 4:Hasil ulangan siswa di Kelas VI C adalah sebagai berikut.Vonny 8; Popi 7; Budi 4; Rudi 9; Susi 6; Cici 6; Iwan 10; Lola 8; Intan 9; Wawan3; Nisa 7; Toni 8; Rian 5; Dodi 7; Ika 6.Nyatakan data tersebut dalam bentuk tabel. Kemudian tentukan:a. siapa yang nilainya tertinggi? terendah?b. berapakah nilai Rian?BNo. Nama Nilai9.10.11.12.13.14.15.PopiRudiRianSusiToniVonnyWawan7956883No. Nama Nilai1.2.3.4.5.6.7.8.BudiCiciDodiIwanIkaIntanLolaNisa467106987Jawab:Untuk memudahkan biasanya nama siswa diurutkan dari A – Z.Amati tabel tersebut dengan saksama.a. Dari tabel tersebut tampak yang nilainya paling besar adalah Iwan.Adapun siswa dengan nilai terendah adalah Wawan.b. Nilai yang diperoleh Rian adalah 5.
  • 56. 55Contoh 5:Berat badan siswa di Kelas VI C adalah sebagai berikut.33 29 32 33 30 30 33 35 39 4028 29 30 31 32 38 37 36 40 3435 37 39 38 31 38 32 38 39 38Nyatakan data tersebut dalam bentuk tabel. Kemudian,tentukan:a. berapa banyak siswa yang beratnya 32 kg;b. berapa banyak siswa yang beratnya 40 kg;c. berapa banyak siswa yang beratnya terendah;d. di kelas tersebut, berapa berat badan yang paling banyak?Jawab:Mulai dari 33, tuliskan tanda turus di kolom turus sebelah 33. Lanjutkansampai selesai.Berat Badan Turus Banyak Siswa28293031323334353637383940IIIIIIIIIIIIIIIIIIIIIIIIIIIII123233121253230Amati tabel tersebut dengan saksama. Dari tabel diperoleh:a. banyaknya siswa dengan berat 32 kg ada 3 orang.b. banyaknya siswa dengan berat 40 kg ada 2 orang.c. banyaknya siswa dengan berat terendah, yaitu 28 kg ada 1 orang.d. banyaknya siswa dengan berat paling banyak adalah 38 kg.Jumlah
  • 57. 56Ayo, lakukan aktivitas ini secara berkelompok.Sajikan data hasil Aktivitas 1 dalam bentuk tabel berikut.No. Nama Turus Panjang Sepatu1.2.….………………………Ceritakan apa yang dapat kamu peroleh dari tabel tersebut.Siapakah yang sepatunya paling panjang?Siapakah yang sepatunya paling pendek?Sajikan pula data hasil Aktivitas 2 dalam bentuk tabel berikut.No. Jenis Olahraga yang Disukai Turus Banyak SiswaSepakbolaBulutangkisBola VoliRenangBola BasketSenamLari1.2.3.4.5.6.7.……………………………………Ceritakan hal apa yang dapat kamu peroleh dari tabel tersebut.Aktivitas 3Tugas 1Ayo, lakukanlah tugas ini secara berkelompok ( 3 – 5 orang )Mintalah hasil ulangan mata pelajaran tertentu seluruh siswa di kelasmu kepadagurumu. Tampilkan hasilnya dalam bentuk tabel. Jawablah pertanyaan berikut.1. Berapa banyak siswa yang memperoleh nilai 7?2. Nilai berapakah yang paling banyak diperoleh siswa di kelasmu?3. Berapa nilai tertinggi yang diperoleh?Ceritakan pula hal lainnya yang dapat kamu peroleh.Bacakan hasilnya di depan kelas.
  • 58. 57Ayo, kerjakan di buku latihanmu.1. Tabel berikut menunjukkan data kegemaran siswa Kelas VI B terhadap jenismusik.Jenis Musik Turus BanyaknyaPopDangdutRockJazz18………IIII IIII IIIIIIIIIIIIIIIII IIIIIIIIISalin dan lengkapi tabel tersebut di buku latihanmu. Kemudian, tentukan:a. berapa banyak siswa yang gemar musik Dangdut?b. berapa banyak siswa yang gemar musik Jazz?c. berapa banyak siswa di kelas tersebut?d. jenis musik apakah yang paling banyak digemari?2. Pada suatu hari, Pak Guru mengadakanulangan Matematika. Nilai Matematikayang diperoleh 30 siswa Kelas VI adalahsebagai berikut: 6, 5, 7, 7, 7, 5, 8, 8, 8, 5, 6,6, 7, 7, 8, 8, 7, 6, 9, 9, 10, 7, 6, 5, 5, 6, 7, 8, 9,7. Dari data tersebut,a. kelompokkanlah nilai-nilai tersebutdengan cara membuat tabelnya?b. berapa siswa yang mendapat nilai 7?c. berapa siswa yang memperoleh nilai 9?d. nilai berapakah yang paling banyak diperoleh siswa?e. nilai berapakah yang paling sedikit diperoleh siswa?3. Kelas VI D mengadakan pengukuran tinggi badan.Data tinggi badan 25 siswa (dalam cm) adalah sebagai berikut.127, 128, 126, 130, 125, 127, 127, 128, 130, 132, 132, 134, 133, 132, 130, 129, 130,128, 135, 134, 136, 131, 133, 134, 133.a. Buatlah tabel dari data tersebut.b. Berapa banyak siswa yang tinggi badannya 127 cm?c. Berapa banyak siswa yang tinggi badannya 130 cm?d. Berapa banyak siswa yang tinggi badannya 134 cm?Ayo, Berlatih 2Sumber: www.pikiran-rakyat.com
  • 59. 58Membaca dan Menafsirkan Data dalamBentuk DiagramPada Aktivitas 1 dan 2, kamu telah mempelajari cara mengumpulkandata. Agar data mudah dibaca dan diamati, biasanya disajikan dalam bentukdiagram. Sekarang, kamu akan belajar cara membaca data dalam bentukdiagram. Kamu pun dapat belajar menafsirkan data dalam bentuk diagram.Adapun cara membuat atau menyajikan data, akan dibahas pada semester 2.1. MembacadanMenafsirkanDatadalamBentukDiagramBatangDiagram batang merupakan diagram yang paling sederhana untukmenyajikan data. Bagaimana cara membaca dan menafsirkannya? Maripelajari contoh berikut.Contoh 1:Diagram batang siswa Kelas VIB yang memelihara binatang.C2Ayam BurungBinatang Peliharaan SiswaBanyakAnakJenis BinatangKucing KelinciIkan4680Amati diagram tersebut dengan baik.a. Berapa banyak siswa yang memelihara ayam?b. Berapa banyak siswa yang memelihara binatang?c. Bintang apa yang paling sedikit dipelihara siswa?d. Jika banyak siswa di kelas tersebut 28 orang, berapa siswa yang tidakmemelihara binatang?Jawab:a. Dari diagram tersebut tampak 8 siswa memelihara ayam.b. Banyak siswa yang memelihara binatang = banyak siswa yangmemelihara ayam, burung, kucing, ikan, dan kelinci = 8 + 6 + 4 + 3 + 2 =23.Jadi, di Kelas VIB banyak siswa yang memelihara binatang adalah 23siswa.
  • 60. 59c. Binatang yang paling sedikit dipelihara adalah kelinci. Hal ini dapatdilihat dari tinggi batang yang paling rendah.d. Banyak siswa yang tidak memelihara binatang = banyak seluruh siswa –banyak siswa yang memelihara binatang = 28 – 23 = 5.Amati kembali diagram pada Contoh1. Dari diagram tersebut kita tahubinatang yang paling banyak dipelihara adalah ayam. Adapun binatang yangpaling sedikit dipelihara adalah kelinci. Siswa yang memelihara kucing lebihbanyak daripada siswa yang memelihara ikan. Menurutmu, mengapa ayambanyak dipelihara?2. MembacadanMenafsirkanDatadalamBentukDiagramLingkaranPernahkah kamu melihat diagram sepertigambar di samping ini. Diagram seperti inilah yangdisebut diagram lingkaran.Diagram lingkaran digunakan untuk menam-pilkan perbandingan suatu obyek terhadap ke-seluruhan. Coba amati diagram tersebut dengansaksama. Ceritakan apa yang dijelaskan oleh diagram tersebut?Sekarang, amati diagram lingkaran berikut. Menampilkan apakah diagramlingkaran berikut?Diagramlingkarantersebutmenampilkanbanyakjenis siswa di Kelas VI. Dari diagram tersebut kitaperoleh data sebagai berikut.45% siswa di Kelas VI adalah laki-laki. Adapunsiswa perempuan adalah 55%. Berarti siswa laki-lakilebih sedikit daripada siswa perempuan.Misalnya, diketahui jumlah seluruh siswa di KelasVI adalah 80 orang. Berapa banyak siswa laki-laki?Berapa banyak siswa perempuan?Banyak siswa laki-laki = 45% × 80=45100× 80= 36 orangBanyak siswa perempuan = 80 – banyak siswa laki-laki= 80 – 36= 44 orangSumber: Majalah Tempo, Februari 2004Banyak siswa di Kelas VIPerempuan(55%)Laki-laki(45%)
  • 61. 60Ayo, kerjakan di buku latihanmu.1. Diagram berikut ini menyajikan data jenis jus buah yang paling disukai siswaKelas VI SDN Gorontalo.Ayo, Berlatih 3Jenis Jus BuahBanyakSiswa10Jeruk Alpukat Mangga Apel Melon2030Denganmemperhatikandiagramtersebut,isilah titik-titik berikut.a. Berapa banyak siswa yang menyukaijus apel?b. Jus buah yang paling banyak disukaisiswa adalah ....c. Siswa yang menyukai jus mangga ...orang lebih banyak dibandingkansiswa yang menyukai jus apel.d. Berapa banyak siswa Kelas VI SDNGorontalo tersebut?e. Jus buah yang paling tidak disukaisiswa adalah ....f. Banyak siswa yang tidak menyukaijus alpukat dan jus mangga adalah ...orang.2. Hasil ulangan matematika siswa Kelas VI SDN I Tanjung Pura disajikan dalamdiagram berikut.Nilai Ulangan MatematikaBanyaknyaSiswa246810121416182022241 2 3 4 5 6 7 8 9 10a. Nilai yang paling banyak diperolehsiswa adalah ....b. Hanya ... orang siswa yang mendapatnilai 10.c. Siswa yang memperoleh nilai 8 lebihbanyak ... orang daripada siswa yangmemperoleh nilai 4.d. Ada ... siswa yang memperoleh nilailebih besar dari 6.e. Diketahui jumlah siswa Kelas VI di SDtersebut adalah 45 orang. Jika siswayang tidak mengikuti ujian tidakdiberi nilai, berapa siswa yang tidakmengikuti ujian tersebut?
  • 62. 61Sopian(27,2%)Dian(21,8%)Paul(17%)Butet(10,2%)Sandi(23,8%)3. Data nilai ujian matematika siswa Kelas VI SD Melati adalah sebagai berikut.NilaiBanyakSiswa246810040 50 60 70 80 90Dengan memperhatikan diagram batang tersebut,a. berapa orang yang memperoleh nilai tertinggi?b. berapa orang yang memperoleh nilai terendah?c. nilai berapa yang paling banyak diperoleh siswa?d. nilai berapa yang paling sedikit diperoleh siswa?e. berapa rata-rata nilai ujian matematika siswa Kelas VI SD Melati tersebut.f. coba sajikan data tersebut dalam bentuk diagram lingkaran.g. berapa perbandingan banyak siswa yang mendapat nilai 60 dan 90?4. Perhatikan diagram lingkaran pemilihan Ketua Murid berikut.Bolabasket(25%)Sepak-bola(20%)Bola voli(30%)Bulutangkis(25%)Diagram tersebut menampilkan hasil pemilihanKetua Murid Kelas VI B.a. Siapa yang terpillih sebagai Ketua Murid?b. Berapa persen siswa yang memilih Paul?c. Dapatkah kamu menentukan banyak siswayang memilih? Berikan alasannya.5. Diagram berikut menunjukkan olahraga yang disukai dari 60 siswa Kelas VI.a. Banyak siswa yang menyukai bulutangkis adalah ... orang.b. Banyak siswa yang menyukai bola voli adalah ...orang.c. Jenis olahraga yang paling disukai siswa adalah ....d. Selisih banyak siswa yang menyukai sepakboladan bola basket adalah ... orang.e. Jenis olahraga yang disukai lebih dari 15 orangadalah ....
  • 63. 62Pengumpulandan Pengolahan DataPengumpulan DatamempelajarimempelajariPengolahan DataMetode PencatatanLangsungPengisian LembarIsianPenyajian Datadalam BentukTabelPenyajian Datadalam BentukDiagramterdiri atasjarrPeta Penuntun BelaPePeteta PePenuntun BelajarelajaelajajaarrrrA. Ayo, isititik-titikberikutdenganjawabanyangbenar.1. Pengumpulandatadapatdilakukandengan cara ... dan ....Berikut ini adalah data banyak anggotakeluarga dari beberapa siswa.3 4 6 5 7 8 4Uji Pemahaman Bab 5Gunakah data tersebut untuk menjawabsoal 2–4.2. Banyak siswa yang didata ada ....3. Banyak anggota keluarga dari siswayang paling sedikit adalah ....Apakah Kamu Sudah Paham?Setelah kamu mempelajari materi pengumpulan dan pengolahan data, adakahyang belum kamu pahami? Bagian mana yang masih belum kamu pahami?Diskusikanlah bersama teman dan gurumu.erangkumngkumAyo, MeranAyo, Merangyyo, ee aarrMMAAAAyo, MeraooAyo MeraAAyAyoyyoooo,, MMeeerarrara gg uuuukknnnngggkumnnggkukuuummmmmmmm1. Pengumpulan data dapat dilakukan dengan pencatatan langsung danmengisi lembar isian.2. Untuk memudahkan pengolahan, data disajikan dalam tabel dan diagram.Adakah materi lain yang kamu peroleh dari bab ini? Tulislah di buku catatanmumengenai rangkuman materi lainnya.
  • 64. 634. Banyak siswa yang anggotakeluarganya 4 adalah ....Gunakan tabel berikut untuk menjawabsoal 5–10. Data pada tabel berikutmenyatakan data warna yang disukaisiswa di Kelas VI. Setiap siswa hanyamemilih 1 warna.JenisWarnaTurus BanyaknyaMerahKuningBiruPinkHijauHitamPutihUnguIIIIIIII IIIIIIIIIIIIIIIIIIII IIIII IIII IIIIIIIIIII IIIII IIII IIIII IIIIIIIIIIIIIIIIIIIIIII IIIIIIIIIIII IIII8…………………5. Banyak siswa di kelas tersebut ada ....6. Warna yang paling banyak disukaiadalah warna ....7. Warna yang paling tidak disukaiadalah warna ....8. Banyaksiswayangmenyukaiwarnabiru ada ....9. Siswa yang menyukai warna merahsama banyak dengan siswa yangmenyukai warna ....10. Selisih banyak siswa yang menyukaiwarna warna pink dan biru adalah ....B. Ayo, kerjakan soal-soal berikut ini.1. Data berikut merupakan data jenispekerjaan dari orang tua siswaKelas VI.Pedagang : 20, PNS : 6, Petani : 12,Guru : 4, Polisi : 7, Tentara : 6.a. Berapa banyak siswa di KelasVI tersebut?b. Jenispekerjaanapayangpalingbanyakdigelutiorangtuasiswatersebut?c. Berapa jumlah orang tua siswayang pekerjaannya tentara danpolisi.2. Data berikut merupakan data hasilpelemparan dadu.1, 3, 4, 5, 6, 3, 2, 1, 4, 5, 6, 4.a. Berapa kali dadu tersebutdilemparkan?b. Mata dadu apakah yang palingbanyak muncul?3. Jelaskan dengan kata-katamu per-bedaan antara mengumpulkan datadengan pencatatan langsung danlembar isian.4. Jelaskan dengan kata-katamu caramenyajikan data dalam bentuktabel.5. Tinggi badan (dalam cm) siswaKelas VI C adalah sebagai berikut.101, 111, 120, 120, 125, 120, 102, 103,104, 105, 106, 107, 108, 109, 110, 111,112, 113, 114, 115, 116, 117, 118, 119,120, 121, 122, 123, 124, 120, 111, 113,118, 110, 103, 104, 103, 104.Nyatakan data tersebut dalambentuk tabel.a. Berapa banyak siswa di kelastersebut?b. Berapakah tinggi badan yangpaling pendek di kelas tersebut?c. Berapa banyak siswa yangtingginya 113 cm?
  • 65. 64A. Ayo, kerjakan di buku latihanmu.1. Soal terbukaHasil kali dua bilangan adalah–64. Kedua bilangan tersebut yangmungkin adalah … dan ….2. –11 × (8–(–4)) + (–20) = …3. FPB dari 12, 20, dan 36 adalah …dan ….4. 113= …5. 7293= …6. Sebuah pipa dalam waktu 1 menitdapat mengalirkan air sebanyak 30liter. Debit air pada pipa tersebutadalah … L/detik7. Luas bangun berikut adalah ….200 cm50 cmm 15 cmcmmm15 cm15 cmm118. Luas lingkaran yang memilikidiameter 40 dm adalah ….9. Sebuah wadah berbentuk prismadengan luas alas 15 cm2dan tinggi35 cm. Wadah tersebut kemudiandiisi air. Banyak air yang dapatditampung wadah tersebut palingbanyak … mL.Gunakan tabel berikut untuk menjawabsoal nomor 10 sampai dengan 15.Tabel berikut menampilkan data jeniswarna yang disukai siswa Kelas IV.Catatan: Setiap siswa hanya menyukai 1warnaNo. Jenis Warna Umur Banyaknya1.2.3.4.5.6.merahpinkbiruhitamhijaukuningIIIIIIIIIIIIIIIIIII IIIII IIII IIIII IIII IIIII IIIIIIIIIIII IIIIIIIII IIIIIIIIII IIIII..................10. Banyak siswa yang menyukai warnahijau ada … orang.11. Banyak siswa di Kelas VI ada …orang.12. Warna yang paling banyak disukaiadalah ….13. Warna yang disukai oleh 2 orangadalah ….14. Banyak jenis warna pada tabeltersebut ada ….15. Jenis warna yang paling tidakdisukai adalah warna ….B. Ayo, selesaikan soal berikut denganbenar.1. Tiga buah lampu menyala, lampumerah menyala setiap 2 detik,lampu kuning setiap 4 detik danlampu hijau menyala setiap 5 detik.Pada detik ke berapa ketiga lampuitu menyala secara bersamaan?2. Volume kubus adalah 512 dm3.Carilah panjang sisi kubus.3. Sebuah kolam hias yang berbentuklingkaran. Jika keliling kolam ikanadalah 22 m, berapakah luas tanahyang dibuat kolam?Uji Pemahaman Semester 1
  • 66. Pak, beli telur12kgPecahanDi Kelas V, kamu sudah mempelajari pecahan. Materi tersebut akandipelajari dan dikembangkan pada bab ini. Materi pecahan ini sangatdiperlukan dalam kehidupan sehari-hari. Contohnya dapat kamu lihat padauraian berikut.Banyak 1 kg telur yang sama besar ada 16 buah. Anita disuruh ibu untukmembeli12kg telur tersebut. Berapa banyak telur yang ia peroleh?Ayo, pelajari bab ini dengan baik untuk mengetahui jawabannya.Apa yang kamu pelajari?Bab 665
  • 67. 66Menyederhanakan dan MengurutkanPecahan1. MenyederhanakanBerbagaiBentukPecahanDi Kelas IV, kamu sudah mempelajari cara menyederhanakan pecahan.Masih ingatkah kamu dengan hal tersebut? Yaitu, membagi pembilang danpenyebut dengan bilangan yang sama.Amati gambar berikut.48=4 28 2:=24Pecahan 24dapat disederhanakan lagi seperti berikut.24=2 24 2::=12ACoba Dulu1. Tentukan 2 pecahan yang senilai dengan48.2. Tentukan FPB dan KPK dari bilangan berikut.a. 10 dan 15 b. 16 dan 483. Ubah 349ke pecahan biasa.4. Ubahlah128ke pecahan campuran.
  • 68. 67Apakah pecahan12dapat disederhanakan lagi? Pecahan12tidak bisadisederhanakan lagi. Alasannya, tidak ada bilangan lain selain 1 yang dapatmembagi habis 1 dan 2. Pecahan seperti ini disebut dalam bentuk palingsederhana. Bentuk paling sederhana dari pecahan48dapat pula dicaridengan cara berikut.Pertama, cari FPB dari pembilang dan penyebut.Faktor persekutuan terbesar dari 4 dan 8 adalah 4.Setelah itu, bagi pembilang dan penyebut dengan FPB.48=4 48 4:=12Hasilnya sama dengan hasil sebelumnya. Cara manakah yang menurutmulebih mudah? Berikan alasannya.Contoh 1:Tentukan bentuk paling sederhana dari pecahan 269.Jawab:Cara 1 : Ubah pecahan ke bentuk biasa.269=2 9 69+9=249FPB dari 24 dan 9 adalah 3.Oleh karena itu, bagi pembilang dan penyebut dengan 3.249=24 39 3:=83= 223diubah ke pecahan campuranJadi, bentuk paling sederhana dari 269adalah 223.Cara 2 : Sederhanakan bentuk pecahannya saja.Bentuk pecahan dari 269adalah69FPB dari 6 dan 9 adalah 3.69=6 39 3=23Jadi, bentuk paling sederhana dari 269adalah 223.
  • 69. 682. MembandingkandanMengurutkanPecahanTinggi badan Yuli 114m. Adapun tinggi badan Caca112m. Siapakah yang lebih tinggi? Untuk menentukansiapa yang tertinggi, kamu harus menentukan manayang lebih besar 114atau 112? Bagaimana caramembandingkan dua pecahan?Ayo, kerjakan di buku latihanmu.1. Sederhanakan pecahan berikut.a. 1228b. 1024c. 4575d. 1412e. 24122. Pecahan manakah yang dalam bentuk paling sederhana? Berikan alasannya.a. 28b. 418c.25d. 79e. 6133. Selesaikan soal berikut.a. Jelaskan dengan kata-katamu cara menyederhanakan pecahan742.b. Tuliskan 4 pecahan dalam bentuk paling sederhana.Ayo, Berlatih 1Aku Mau TahuKamu dapat menyederhanakan pecahan dengan menggunakan kalkulatorilmiah. Misalnya, kamu ingin menentukan bentuk paling sederhana dari 1015.Tekan berturut-turut =15ab/c10 maka akan tampak di layar2 3, ini artinya 23.Untukmenentukanbentukpalingsederhanadarisuatupecahancampuran,misalnya 269, tekan berturut=turut =6 9ab/cab/c2sehingga akan tampak dilayar 2 2 3, ini artinya 2 23.
  • 70. 69Ayo, pelajari uraian berikut.Di Kelas IV, kamu sudah mempelajari cara membandingkan pecahanberpenyebut sama. Jika penyebutnya sama, bandingkan saja pembilangnya.Pecahan dengan pembilang yang lebih besar, bernilai lebih besar.Contohnya,34>24karena 3 > 2Bagaimana jika penyebutnya tidak sama? Samakan dahulu penyebutkedua pecahan tersebut. Kemudian, gunakan cara sebelumnya.Ayo, pelajari contoh berikut.Contoh 2:Bandingkan pecahan14dan13manakah yang lebih besar?Jawab:Cara 1: Pertama, samakan penyebut kedua pecahan.Caranya dengan mengubah setiap penyebut ke KPK–nya. KPK dari 3 dan 4adalah 12. Oleh karena itu, ubah setiap pecahan sehingga berpenyebut 12.13=1 43 4=41214=1 34 3=312Sekarang, bandingkan412dan312. Oleh karena 4 > 3 maka412>312.Jadi, yang lebih besar adalah 13.Cara 2:13141 × 4 > 3 × 1 sehingga13>14Cara membandingkan pecahan berguna untuk mengurutkan pecahan. Ayo,amati contoh berikut.
  • 71. 70Contoh 3:Urutkanlah pecahan12,38, dan512dari yang terkecil.Jawab:Samakan penyebut dari ketiga pecahan tersebut dengan mencari KPK dari 2,8, dan 12. KPK dari 2, 8, dan 12 adalah 24. Selanjutnya, ubah ketiga pecahantersebut menjadi pecahan yang penyebutnya 24.12=1 122 12=122438=3 38 3=924512=5 212 2¥=10249 < 10 < 12 sehingga924<1024<1224atau38<512<12.Jadi, urutan pecahan dari yang terkecil adalah 38, 512, dan 12.Ayo, kerjakan di buku latihanmu.1. Beri tanda < , >, atau = dalam buku latihanmu.a. 37… 47b. 29… 210c. 1711… 16122. Urutkan pecahan berikut dari yang terkecil.a.112,812,712b. 75%,210,36c. 134, 118,15203. Selesaikan soal cerita berikut.a. Raka dapat menyelam sampai kedalaman 312m dari permukaan air laut.Putu dapat menyelam sampai kedalaman 346m dari permukaan air laut.Siapakah yang dapat menyelam lebih dalam?b. Data berikut menunjukkan jarak lempar tolak peluru beberapa siswa.Anita :34m, Rado : 125m, dan Cici :46m. Siapakah yang lemparannyaterjauh? Siapakah yang lemparannya terpendek?c. Dari lomba balap mobil diperoleh data berikut. Mobil A dapat mencapaigaris finish selama 512menit. Mobil B selama538menit dan mobil C selama 558menit.Tentukan urutan mobil yang pertama melaluigaris finish.Ayo, Berlatih 2
  • 72. 71Operasi Hitung pada PecahanDi Kelas IV dan V, kamu sudah mempelajari operasi hitung pada pecahan.Materi tersebut akan dipelajari kembali dan diperdalam pada bagian ini.1. PenjumlahandanPenguranganPecahanIbu Ramang seorang pemilik warung nasi. Suatuhari, ia membeli 3 liter minyak sayur. Sebanyak12literminyak sayur ia gunakan untuk menggoreng ikan dansebanyak34liter ia gunakan untuk menggoreng ayam.Berapaliterminyaksayuryang telahiagunakan?Berapasisa minyak yang ia miliki?Untuk menyelesaikan masalah ini, kamu harus bisa menjumlahkan danmengurangkan pecahan. Masih ingatkah kamu cara menjumlahkan danmengurangkan pecahan? Coba jelaskan dengan kata-katamu sendiri. Jika lupa,baca kembali buku Kelas IV dan V.Di Kelas IV dan V, kamu sudah mempelajari cara menjumlahkan danmengurangkan pecahan. Jika penyebut pecahan sama, untuk menjumlahkan(mengurangkan) pecahan tersebut, jumlahkan (kurangkan) pembilangnya saja.Adapun penyebutnya tetap.Contoh 1:Tentukanlah hasilnyaa. 3727+ b. 812512-Jawab:a.3727+ =3 27=57jumlahkan pembilangnya sajab.812512- =8 512=312=14disederhanakanJika penyebut pecahan tidak sama, samakan dahulu penyebutnya.Caranya dengan mengubah setiap penyebut pecahan menjadi KPK-nya.Contoh 2:Tentukanlah hasilnya.a.35+67b.45–38B
  • 73. 72Jawab:a. KPK dari 5 dan 7 adalah 35. Ubah setiap pecahan sehingga berpenyebut 35.35=3 75 7=2135dan67=6 57 5=303535+67=2135+3035=21 3035+=5135Cara lain:35+67=7 3 5 65 721 30355135+3=+=b.45–38=32401540- samakan penyebut=32 1540-= 1740aturan penguranganJika terdapat pecahan campuran, ubah dahulu ke pecahan biasa. Setelahitu, selesaikan sesuai cara yang telah diberikan.Contoh 3:Tentukanlah hasilnya 245–48.Jawab:Cara 1:245–48=145–48=11240–2040samakan penyebut=112 2040-=9240= 21240= 2310Cara 2:245–48= 245+ÊËÁÊÊËˈ¯˜ˆˆ¯¯–48= 2 +4548-ÊËÁÊÊËˈ¯˜ˆˆ¯¯sifat asosiatif= 2 +32402040-ÊËÁÊÊËˈ¯˜ˆˆ¯¯samakan penyebut
  • 74. 73= 2 +32 2040-ÊËÁÊÊËˈ¯˜ˆˆ¯¯= 2 +1240= 2 +310= 2310.Sekarang, selesaikan masalah di awal pembahasan. Amati kembalimasalah tersebut. Dari masalah tersebut diperoleh hal berikut.Diketahui:Banyak minyak mula-mula : 3 liter.Banyak minyak yang digunakan untuk menggoreng ikan12liter.Banyak minyak yang digunakan untuk menggoreng ayam34 liter.Ditanyakan:a. Banyak minyak yang telah digunakanb. Sisa minyak sayur.Pengerjaan:a. Banyak minyak yang telah digunakan adalah banyak minyak untukmenggoreng ikan dan banyak minyak untuk menggoreng ayam.=12+34=24+34=2 34=54= 114Jadi, banyak minyak sayur yang telah digunakan adalah 114liter.b. Sisa minyak sayur adalah banyak minyak mula-mula dikurangi banyakminyak yang telah digunakan.= 3 – 114=31–54tulis 3 sebagai pecahan31=124–54=12 54-=74= 134samakan penyebutJadi, minyak yang tersisa sebanyak 134liter.Ayo, Berlatih 3Ayo, kerjakan di buku latihanmu.1. Hitunglah penjumlahan berikut.a.27+47b.23+56c. 214+ 3412
  • 75. 742. Hitunglah pengurangan berikut.a.78–56b. 212–67c. 278– 124–3243. Selesaikan soal berikut.a. Berat semangka A adalah34kg. Berat semangka B adalah12kg. Berapa berat kedua semangka tersebut?b. Seorang ibu membeli 212meter kain. Sepanjang34m,ia gunakan untuk membuat baju anaknya. Berapa sisa kain yang ibumiliki?c. Untuk membuat kue donat, ibu memerlukan 112kg terigu. Untukmembuat kue bolu, ibu memerlukan 1 kg terigu. Berapa kg terigu yangharus ibu beli untuk membuat kedua kue?d. Tentukanlah keliling persegi panjang berikut.14cm12cm4. Soal terbuka.Jumlah 2 pecahan berpenyebut tidak sama adalah12. Carilah kedua pecahantersebut yang mungkin.2. PerkaliandanPembagianPecahanDi Kelas V, kamu telah mempelajari perkalian pecahan. Masih ingatkahkamu dengan cara mengalikan pecahan? Ayo, sebutkan dengan kata-katamusendiri. Apakah hasilnya sama dengan aturan berikut?Untuk pecahanabdancd, hasil kali keduanya diperoleh denganmengalikan pembilang dengan pembilang dan penyebut denganpenyebut.ab×cd=a cb d¥, b ≠ 0, d ≠ 0BA
  • 76. 75Contoh 1:Tentukanlaha. 4 ×35b.26×34c.45× 112Jawab:a. 4 ×35=41×35=4 31 5=125= 2 25b.26×34=2 36 4=2 32 36 46 41 12 2 =1 12 2=14c.45× 112=45×32=4 35 2=1210=65= 115Sekarang, coba jelaskan dengan kata-katamu cara membagi pecahan.Samakah hasilnya dengan aturan berikut?Untuk pecahanabdancd, pembagianabolehcdsama artinya denganperkalianabdengan lawan daricd, yaitudc.ab:cd=ab×dcContoh 2:Tentukanlaha. 2 :15b.13: 10 c. 123:49Jawab:a. 2 :15= 2 :15=21:15tulis 2 ke bentuk pecahan=21×51=2 51 1aturan perkalian=101= 10b.13: 10 =13:101ubah 10 ke bentuk pecahan=13×110aturan pembagian=1 13 10=130
  • 77. 76c. 123:49=53:49ubah ke pecahan biasa=53×94aturan pembagian=5 993 4331 aturan perkalian=5 31 4=154= 3 34.Contoh 3:Di kamar Santi terdapat foto dengan ukuranseperti di samping. Berapa m2luas kertas yangdiperlukan untuk mencetak foto tersebut?Jawab:Diketahui:Fotoberbentukpersegipanjang.Panjang foto=12mdan lebar foto =34m.Ditanyakan: Luas kertas untuk mencetak fototersebut?Pengerjaan:Fotoberbentukpersegipanjang.Luaskertasuntukmencetakfototersebutsamadengan luas persegipanjang tersebut.Luas persegipanjang = panjang × lebar=12×34=1 32 4=38Jadi, luas kertas yang diperlukan untuk mencetak foto tersebut38m2.12m34mAyo, Berlatih 4Ayo, kerjakan di buku latihanmu.1. Hitunglah hasil perkalian berikut.a. 5 ×13b.59×36c. 149× 212d.53× 247× 2122. Hitunglah hasil pembagian berikut.a. 3 :13b.26:49c. 2112: 148d.49: 147:13
  • 78. 773. Selesaikan soal cerita berikut.a. Panjang dan lebar suatu persegipanjang berturut-turut 923cm dan 612cm.Berapa cm2luas persegipanjang tersebut.b. Ibu Noni mempunyai 223kg kue. Semua kue tersebut akan dibagikankepada 4 orang. Jika setiap anak mendapat bagian yang sama, berapakilogram kue yang diperoleh setiap anak Ibu Noni?c. Sebuahlemarikayuberbentukbalokdenganpanjang125m,lebar45,dantinggi137m.Tentukanvolumelemariitu.id. Beratsatubuahdurianadalah112kg.Berapakahberat7durianberukuransama?Usia Ayah 4 kali usia Joko dan usia Ibu34kali usia Ayah. Joko juga mempunyaiPaman yang usianya 2 kali usia Joko ditambah 3 tahun. Adapun sepupunyaberusia 112kali usia Joko. Jika usia Joko lebih dari 7 tahun, tentukan usia Ayah,Ibu,pamandansepupuJokotersebut.(Jawabanbisaberbeda-beda).No. Usia Joko Usia Ayah Usia Ibu Usia Paman Usia Sepupu1.2.3.………………………………………Aku Pasti Bisa3. MenentukanNilaiPecahandariSuatuBilanganatauKuantitasTertentuGinanjar mempunyai 40 kelereng. Sebanyak25dari kelereng-nya itu berwarna merah. Berapa banyak kelereng Ginanjar yangberwarna merah? Untuk menjawab soal tersebut, kamu harusmenentukan25dari 40. Bagaimana caranya?
  • 79. 78Agarkamumengetahuicaramenentukannilaipecahandarisuatubilangan,pelajari contoh berikut.Contoh:Hitunglah:a.14dari 12 b. 60% dari 25Jawab:a.14dari 12 sama artinya dengan14× 12 =1 124=124= 3Jadi,14dari 12 adalah 3.b. Ubah terlebih dahulu 60% menjadi pecahan biasa60% =60100=60 20100 20::=3560% dari 25 sama artinya dengan35dari 25 atau35× 25 =3 255755= = 15Jadi, 60% dari 25 adalah 15. 35dari 25 adalah 1514dari 12 adalah 3Ayo, Berlatih 5Ayo, kerjakan di buku latihanmu.1. Hitunglah.a.12dari 20 c.18dari 72 e.411dari 220b.25dari 50 d. 75% dari 72 f. 70% dari 4202. Selesaikan soal cerita berikut.a. Umur ayah 36 tahun, sedangkan umur Susan13dari umur ayah. Berapatahunkah umur Susan?b. Luas sebidang tanah 150 m2. Sebanyak23dari tanah tersebut ditanamisingkong, sedangkan sisanya ditanami jagung.1) Berapa meter persegi tanah yang ditanami singkong?2) Berapa meter persegi tanah yang ditanami jagung?
  • 80. 79c. Ruli mempunyai uang sebanyak Rp5.000,00. Sebanyak75100dari uangnyadibelikan buku, sedangkan sisanya ditabung. Berapa rupiah uang Ruliyang ditabung?Sebanyak512dari tamu yang hadir dalam suatu pesta pernikahan adalah laki-laki. Jika tamu perempuan 30 orang lebih banyak dari tamu laki-laki, tentukanbanyak seluruh tamu yang hadir pada pesta pernikahan tersebut.Aku Pasti Bisa4. OperasiHitungCampuranpadaPecahanSebelumnya, kamu telah mempelajari operasi hitung campuran padabilangan cacah. Aturan pengerjaan hitung campuran pada pecahan samadengan aturan pengerjaan hitung campuran pada bilangan cacah, yaitu sebagaiberikut.a. Perkalian atau pembagian dikerjakan lebih dahulu. Kemudian, baru me-ngerjakan penjumlahan atau pengurangan.b. Jika dalam soal ada tanda kurung, pengerjaan hitung dalam tandakurung harus dikerjakan lebih dahulu.Contoh:Hitunglah.a. 124+312× 134b. 215×18224+ÊËÁÊÊËˈ¯˜ˆˆ¯¯Jawab:a. 124+312× 134=6431274+ ¥ Ubah ke pecahan biasa=64+3 712 4¥ÊËÁÊÊËˈ¯˜ˆˆ¯¯=64+2148=7248+2148KPK dari 4 dan 48 adalah 48=9348= 14548Ubah ke pecahan campuranuntuk menghitung 124+312× 134kerjakan terlebih dahulu perkalian,kemudian baru penjumlahan
  • 81. 80Jadi, 124+312× 134= 11516.b. 215×18224+ÊËÁÊÊËˈ¯˜ˆˆ¯¯=115×18104+ÊËÁÊÊËˈ¯˜ˆˆ¯¯=115×18208+ÊËÁÊÊËˈ¯˜ˆˆ¯¯=115×218= 11 215 8¥ =23140= 53140Jadi, 215×18224+ÊËÁÊÊËˈ¯˜ˆˆ¯¯= 53140.Ayo, kerjakan di buku latihanmu.1. Hitunglaha. 22449134+ ¥ e.47125414+¥1b. 24756126: - f. 2194242112: -ÊËÁÊÊËˈ¯˜ˆˆ¯¯c. 24971212- ¥ : g. 14658113214+¥ÊËÊÊËˈ¯˜ˆˆ¯¯:d.6614762116¥+1 - h.1218914241424-¥ 1ÊËÊÊËˈ¯˜ˆˆ¯¯+2. Selesaikan soal cerita berikut di buku latihanmu.a. Di Koperasi Unit Desa terdapat 312tonkacang kedelai dan 425ton gabah. Keduabarang tersebut akan dikirim ke KoperasiSukamajumenggunakansebuahtruk.Truktersebut memiliki daya angkut 12950ton.Agar kacang kedelai dan gabah dapat diangkut semuanya, berapa kalikahtruk tersebut harus mengangkut kacang kedelai dan gabah tersebut?Ayo, Berlatih 6untuk menghitung 215×18242+kerjakan terlebih dahulu yang adadalam tanda kurung,kemudian baru dikalikan dengan 215
  • 82. 81b. Ibu Siti mempunyai 234hektar sawah. Kemudian, Ibu Siti membelilagi sawah seluas 512hektar. Selanjutnya, semua sawah tersebut akandibagikan kepada 4 orang anaknya sehingga setiap anaknya mendapatbagian yang sama. Berapa hektar sawah yang diterima setiap anak IbuSiti?c. Seorang pedagang mempunyai 412keranjang buah-buahan. Kemudian,terjual sebanyak 314keranjang. Jika berat setiapkeranjang buah-buahan adalah 714kg, berapakilogram buah-buahan yang belum terjual?d. Togar mempunyai 5 gulung tali. Setiap talipanjangnya 314m. Sebanyak 212gulung talitersebut digunakan untuk mengikat pagar. Berapameter panjang tali yang masih tersisa?e. Hani mempunyai 114m pita. Kemudian, ia membeli212gulung pita lagi. Jika panjang setiap gulung pita325m, berapa meter panjang pita yangdimiliki Hani sekarang?f. Koperasi Unit Desa (KUD) Mandirimempunyai dua gudang beras. Keduagudang itu dapat menampung masing-masing 1235ton dan 19210ton. Beras darikedua gudang itu akan dibawa ke pasar dengan sebuah truk yang dayaangkutnya 21320ton. Agar beras dari kedua gudang habis, berapa kalikahtruk tersebut harus mengangkutnya?
  • 83. 82Pecahan DesimalDi Kelas V, kamu sudah belajar pecahan desimal beserta operasi hitungnya.Padababinikamuakanmempelajarilagipecahandesimal.Ayo,pelajaridenganbaik uraian berikut.1. MengubahPecahanBiasakeDesimaldanSebaliknyaKadang-kadang, kamu lebih mudah menggunakan pecahan desimaldaripada pecahan biasa. Contohnya untuk menghitung hasil dari 7 :34dengan menggunakan kalkulator biasa. Menghitunghasildari7:34akan lebihmudah menggunakan 7 : 0,75.Bagaimana cara mengubah pecahan biasa ke desimal? Di Kelas V, kamusudah mempelajarinya. Masih ingatkah kamu dengan cara tersebut?Jika penyebut pecahan merupakan kelipatan 10, tambahkan tanda komasebanyak kelipatan 10 dari kanan.Contoh 1:a.110ditulis 0,1 c.2100ditulis 0,02b.310ditulis 0,3 d.13100ditulis 0,13Bagaimana jika penyebutnya bukan kelipatan 10? Ubah dahulupenyebutnya sehingga berkelipatan 10, lalu lakukan cara sebelumnya.Contoh 2:a.12=1 52 5ubah penyebut menjadi kelipatan 10=510= 0,5b.14=1 254 25ubah penyebut menjadi kelipatan 10=25100= 0,25Kamu pun dapat mengubah pecahan ke desimal dengan cara membagipembilang dan penyebutnya.C
  • 84. 83Contohnya untuk menentukan pecahan desimal dari14dapat dilakukanseperti berikut.0,0,20,25444101010882202001 : 4 tidak bisatulis 0, (nol dan koma) di tempat hasil bagitambahkan 0 di belakang angka 110 : 4 = 2tulis 2 di belakang koma (hasil bagi)2 × 4 = 810 – 8 = 22 : 4 tidak bisatambahkan 0 di belakang angka 220 : 4 = 5tulis 5 di tempat hasil bagi5 × 4 = 2020 – 20 = 0 (pembagian selesai)Jadi, pecahan desimal untuk 14= 0,25.Cara manakah yang menurutmu lebih mudah? Apakah cara pertama dapatmengubah pecahan13ke desimal?Contoh 3:Ubahlah 134ke pecahan desimal.Jawab:Cara 1:134=74ubah ke pecahan biasa=7 254 25ubah penyebut menjadi kelipatan 10=175100= 1,75Cara 2:134= 1 +34Ubah34ke desimal dengan melakukan pembagian berikut.
  • 85. 840,754 302820200Jadi, 134= 1 +34= 1 + 0,75 = 1,75Untuk mengubah pecahan desimal ke biasa, tuliskan pecahan desimaldalam bentuk panjang. Setelah itu, sederhanakan.Contoh 4:Ubahlah pecahan berikut ke pecahan biasa.a. 0,9 b. 0,125 c. 2,625Jawab:a. 0,9 = 0 × 1 + 9 ×110tulis dalam bentuk panjang= 0 +910= 910.b. 0,125 = 0 × 1 + 2 ×110+ 5 ×1100tulis dalam bentuk panjang= 0 +210+5100=20100+5100samakan penyebut=25100= 14. sederhanakanc. 2,625 = 2 +610+2100+51000.= 2 +600 20 151000+ +.samakan penyebut= 2 +6251000.= 2 +58sederhanakan= 258
  • 86. 85Ayo, kerjakan di buku latihanmu.1. Ubahlah ke bentuk desimal.a.18c.1125e. 112b.720d.2250f. 2452. Ubahlah ke bentuk pecahan biasa.a. 0,7 c. 0,565 e. 1,4b. 0,225 d. 0,625 f. 3,875Ayo, Berlatih 712. PenjumlahandanPenguranganPecahanDesimalAyah membeli dua semangka. Semangka pertama beratnya 1,5 kg.Semangka kedua beratnya 2,75 kg. Berapa berat kedua semangka tersebut?Berapakahselisihberatkeduasemangkatersebut?Masalahiniberhubungandengan penjumlahan dan pengurangan desimal.Di Kelas V, kamu telah mempelajari hal ini. Padabagian ini, kamu akan memperdalamnya sampaipenjumlahandenganmenyimpandanpengurangandengan meminjam.Di Kelas V, kamu sudah belajar penjumlahan dan pengurangan pecahandesimal. Untuk menjumlahkan atau mengurangkan pecahan desimal,jumlahkan tiap angka sesuai nilai tempatnya. Amati contoh berikut.Contoh 1:Tentukanlah hasil daria. 2,57 + 0,25 b. 7,25 – 2,34Jawab:a. Cara 1:2,570,252,827 perseratus + 5 perseratus = 12 perseratustulis 2 di perseratus dan simpan 1 di persepuluh1 persepuluh + 5 persepuluh + 2 persepuluh = 8 persepuluh2 satuan + 0 satuan = 2 satuan
  • 87. 86Cara 2:2,57 + 0,25 =25710025100282100+ = = 2,82.Jadi, 2,57 + 0,25 = 2,82.Cara manakah yang menurutmu lebih mudah? Berikan alasannya.Jawab:b. Cara 1:7, 2 52, 3 44, 9 15 perseratus – 4 perseratus = 1 perseratustulis 1 di perseratus2 persepuluh – 3 persepuluh tidak bisa. Pinjam 1 dari satuansehingga 2 menjadi 12. Hasil dari 12 – 3 = 9. Tulis 9 di persepuluh7 satuan dipinjam 1 tinggal 6.6 – 2 = 4. Tulis 4 di satuanCara 2:7,25 – 2,34 =725100234100491100- = = 0,491.Jadi, 7,25 – 2,34 = 4,91.Cara manakah yang menurutmu lebih mudah? Berikan alasannya.Contoh 2:Sinta memiliki dua gulung pita.2,35 m 4,86 mBerapa meter panjang seluruh pita yang ia miliki?Jawab:Pita yang ia miliki merupakan jumlah kedua pita, yaitu 2,35 + 4,86.2 354 567 21,,,+Jadi, pita yang ia miliki sepanjang 7,21 m.
  • 88. 87Ayo, kerjakan di buku latihanmu.1. Hitunglah hasil penjumlahan berikut.a. 0,6 + 0,23 c. 4,37 + 2,53 e. 37,240 + 83,587b. 2,6 + 0,35 d. 2,35 + 4,83 f. 5,32 + 6,45 + 3,482. Hitunglah hasil pengurangan berikut.a . 0,9 – 0,25 c. 5,16 – 2,92 e. 93,65 – 39,796b. 2,67 – 1,18 d. 31,22 – 16,022 f. 69,77 – 24,99 – 8,283. Selesaikan soal cerita berikut.a. Anisa mempunyai 2 gulung pita yang panjangnya masing-masing 5,35 mdan 3,85 m. Berapa meter panjang pita Anisa seluruhnya?b. Berat sebuah truk beserta muatannya adalah 3.520,17 kg. Adapun, berattruknya saja 1.690,59 kg. Berapa kilogram berat muatan truk tersebut?c. Berat badan Badu 27,60 kg, sedangkan berat badan Budi 15,8 kg lebih beratdaripada Badu. Berapakah berat badan mereka berdua?d. Pada bulan Januari 2007, berat badan Dudu, Didi, dan Dodo berturut-turut57,65 kg; 49,96 kg; dan 53,30 kg. Akan tetapi, pada bulan Februari 2007,Dodo jatuh sakit. Berat badan Dodo turun 4,55 kg. Berapa kilogram jumlahberat badan mereka bertiga sekarang?3. PerkaliandanPembagianPecahanDesimalDi Kelas V, kamu telah mempelajari perkalian dan pembagian pecahandesimal. Coba jelaskan dengan kata-katamu caranya. Agar kamu lebihmemahaminya, pelajari contoh berikut.Contoh 1:Tentukanlah hasil daria. 12,3 × 0,49 = … b. 1,5 : 0,3 = …Jawab:a. Cara 1:12,3 × 0,49 = 12310×49100ubah ke bentuk pecahan biasa=12310×49100=123 4910 100¥¥aturan perkalian=60271000..= 6,027Ayo, Berlatih 8
  • 89. 88Cara 2:12 30 49110,,¥satu tempat desimaldua tempat desimalDengan mengabaikan tanda koma, kalikan kedua bilangan.123 × 49 = 6.027.Sekarang, tambahkan tanda koma sebanyak tempat desimal keduapecahan. Jumlah tempat desimal kedua pecahan adalah 1 + 2 = 3.6,027tiga tempat desimalJadi, 12,3 × 0,49 = 6,027.b. Cara 1:1,5 : 0,2 = 1510:210ubah ke bentuk pecahan biasa=1510:210=1510×102=15020=7510= 7,5 aturan pembagianCara 2:1,5 : 0 2, = 15 : 2bilangan pembagi dikalikan 10 supaya menjadi bilangan bulat 0,2 × 10 = 2oleh karena bilangan pembagi dikalikan 10,bilangan yang dibagi harus dikalikan juga dengan 101,5 × 10 = 15Selanjutnya, lakukan pembagian berikut.7,52 151410100Jadi, 1,5 : 0,2 = 7,5.Contoh 2:Jendela di kamar Andika berbentuk persegipanjang. Panjang jendela 1,5 m.Lebar jendela 0,75 m. Berapa m2luas kaca yang diperlukan untuk menutupijendela tersebut?
  • 90. 89Jawab:Diketahui:Jendela berbentuk persegipanjang.Panjang jendela = 1,5 mLebar jendela = 0,75 mDitanyakan: Luas kaca yang diperlukan?Pengerjaan:Amati sketsa jendela berikut.1,5 m0,75 mLuas kaca yang diperlukan adalah luas dari jendela tersebut.Jendela tersebut berbentuk persegipanjang. Oleh karena itu,luas jendela = panjang × lebar= 1,5 m × 0,75 m= 1,125 m2Jadi, luas kaca yang diperlukan untuk menutupi jendela adalah 1,125 m2.Tugas 1Ayo, lakukan tugas ini secara berkelompok (4 sampai 6 orang).Ukur luas benda-benda berbentuk persegipanjang yang ada di sekitarmu(paling sedikit 10 benda). Ubah satuan cm ke satuan m agar diperoleh pecahandesimal seperti pada tabel berikut.No. BendaPanjang(dalam cm)Lebar(dalam cm)Panjang(dalam m)Lebar(dalam m)Luas(dalam m2)Buku TulisMejaBelajar…25 cm150 cm……17,5 cm60 cm……0,25 m1,5 m……0,175 m0,6 m……0,25 × 0,175= 0,04375 m21,5×0,6=0,9m2……1.2.3.…Buatlah laporannya. Kemudian, ceritakan hasilnya di depan kelas.
  • 91. 90Ayo, kerjakan di buku latihanmu.1. Hitunglah perkalian berikut.a. 0,9 × 0,13 c. 4,29 × 3,21 e. 0,6 × 0,5 × 2,7b. 3,17 × 6,2 d. 8,05 × 6,30 f. 2,4 × 3,05 × 20,142. Hitunglah pembagian berikut.a. 0,1 : 0,2 c. 4,8 : 0,12 e. 1,05 : 8,75b. 1,3 : 0,2 d. 2,75 : 2,5 f. 3,75 : 0,0253. Selesaikan soal cerita berikut.a. Kaca jendela di kamar Tika berbentuk persegi-panjang dengan panjang 1,25 m dan lebar 0,63 m.Berapa meter persegi luas kaca jendela itu?b. Berat satu keranjang mangga 0,4 kuintal. Berapakuintal berat 12,5 keranjang mangga?c. Setiap 1 jam, seorang pembalap sepeda motordapat menempuh jarak 85,6 km. Berapa kilometerjarak yang ditempuh pembalap tersebut selama3,5 jam?d. Ani membuat baju untuk bonekanya. Setiap baju memerlukan 0,8 mkain. Berapa baju yang dapat dibuat dari 12 m kain?e. Pak Andi sedang membuat tiang bambu. Panjang setiap tiang1,75 m. Berapa banyak tiang yang dapat dibuat dari bambu yangpanjangnya 7 m?0,63 m1,25 mAyo, Berlatih 94. OperasiHitungCampuranpadaPecahanDesimalAturan pengerjaan hitung campuran pada pecahan desimal sama denganaturan pengerjaan hitung campuran pada bilangan cacah, yaitu sebagaiberikut.a. Perkalian atau pembagian dikerjakan lebih dahulu. Kemudian,mengerjakan penjumlahan atau pengurangan.b. Jika dalam soal ada tanda kurung, pengerjaan hitung dalam tandakurung harus dikerjakan lebih dahulu.Contoh:a. 2,45 – 0,15 : 0,6 = 2,45 – 0,25 kerjakan : dahulu sebelum –= 2,20 = 2,2Jadi, 2,45 – 0,15 : 0,6 = 2,2.b. 7,13 × (3,68 + 1,57) = 7,13 × 5,25 kerjakan dahulu yang ada pada tanda kurung= 37,4325Jadi, 7,13 × (3,68 + 1,57) = 37,4325.
  • 92. 91Ayo, kerjakan di buku latihanmu.1. Hitung operasi campuran pada pecahan desimal berikut.a. 0,75 + 1,43 × 5,16 f. 1,63 + 7,2 × 0,54 – 1,06b. 2,76 : 2,4 – 0,15 g. 3,08 : 2,2 + 1,04 × 5,6c. 4,33 – 4,68 : 3,6 h. 6,702 × (1,05 – 0,95) + 4,01d. 0,16 × (1,44 + 0,15) i. (0,062 + 1,04) × (2,2 – 0,754)e. (1,075 – 0,8) : 0,025 j. 3,64 : (7,852 : 3,02) – 1,42. Selesaikan soal cerita berikut.a. Seorang pedagang mempunyai 4 peti telur. Berat telur dalam setiap peti16,5 kg. Kemudian, dari setiap peti diambil masing-masing 3,75 kg telur.Berapa kilogram berat telur dari keempat peti tersebut sekarang?b. Handi mempunyai tali sepanjang 5,5 m. Sebanyak 2 meter dari tali tersebutdiberikan kepada Manda. Jika14bagiandarisisanyadiberikanlagikepada7 orang temannya (masing-masing sama panjang), berapa sentimeterpanjang tali yang diperoleh setiap temannya?c. Seorang pedagang mempunyai 412keranjang jeruk.Kemudian, terjual sebanyak14keranjang. Jika beratsetiap keranjang jeruk 714kg. Berapa kilogram jerukyang belum terjual?Ayo, Berlatih 10Pecahan sebagai Perbandingandan Skala1. PerbandinganantaraDuaKumpulanBendaPecahan dapat diartikan sebagai perbandingan banyak benda dari suatukumpulandenganbanyakbendadarikumpulanlain.Coba perhatikan gambar dua kumpulan stroberi berikut.P QP dengan banyak stroberipada gambar Q adalah 5 berbanding 3.Perbandingan itu dapat ditulis P : Q = 5 : 3 sama artinya denganPQ=53.D
  • 93. 92Ayo, tentukan perbandingan dua kumpulan benda berikut di buku latihanmu.1.A : B = … : … =. . .. . .B : A = … : … =. . .. . .2. C : D = … : … =. . .. . .D : C = … : … =. . .. . .3. F : E = … : … =. . .. . .E : F = … : … =. . .. . .A BAyo, Berlatih 11EFC D2. PerbandinganSatuKumpulanBendadenganJumlahatauSelisihdariDuaKumpulanBendaCoba perhatikan dua kumpulan pisang berikut.FEE : F = 6 : 5EE F=66 5=611FE F=66 5=61FE F=56 5=511FE F=56 5=51Banyak masalah dalam kehidupan sehari-hari yang menggunakan per-bandingan, seperti contoh berikut.Q dengan banyak stroberipada gambar P adalah 3 berbanding 5.Perbandingan itu dapat ditulis Q : P = 3 : 5 sama artinya denganQP=35.
  • 94. 93Ayo, kerjakan di buku latihanmu1. Isilah titik-titik dengan jawaban yang tepat.a.PRb.JK2. Selesaikan soal cerita berikut.a. Perbandingan uang Riska dan uang Madi adalah 1 : 5.Selisih uang mereka Rp4.000,00. Berapa rupiah uangmereka masing-masing?b. Jumlah pembilang dan penyebut sebuah pecahan 28.Pecahan tersebut apabila disederhanakan menjadi34.Tentukan pecahan tesebut.c. Uang Nina : uang Erik = 4 : 6. Uang Erik Rp4.000,00 lebihbanyak daripada uang Nina. Berapa rupiah uang mereka masing-masing?d. Selisih umur ayah dan kakak 24 tahun. Umur ayah : umur kakak = 7 : 4.Berapa tahun umur ayah dan umur kakak?PP R= =. . .. . .. . .. . .PP R= =. . .. . .. . .. . .Ayo, Berlatih 12Contoh:Perbandingan umur Nani berbanding umur sepupunyaadalah 3 berbanding 5. Jumlah umur mereka 48 tahun.Berapakah umur mereka masing-masing?Jawab:Diketahui: Umur Nani : umur sepupunya = 3 : 5Jumlah umur Nani dan sepupunya 48 tahun.Ditanyakan: Umur Nani dan umur sepupunya.Pengerjaan:Jumlah perbandingan umur Nani dan umur sepupunya adalah 3 + 5 = 8 sehinggaNani=38×48=18tahun.Umursepupunya=58× 48 = 30 tahun.Jadi, umurNani18tahundanumursepupunya 30tahun.JJ K= =. . .. . .. . .. . .JJ K= =. . .. . .. . .. . .
  • 95. 943. SkalaDiKelasVsemester2,kamutelahmempelajarikonsepskala.Skalaadalahperbandingan jarak yang bersesuaian pada peta dengan jarak sesungguhnya.Misalkan, S skala, M jarak pada peta, dan A jarak sesungguhnya makaSMA=Agar kamu lebih memahami tentang skala, pelajari contoh berikut.Contoh 1:Sebidangtanahberbentukpersegipanjang.Panjangnya2kmdanlebarnya1km.Gambarkan denah itu dengan skala 1 : 100.000.Jawab:Panjang pada denah =2100000200000100000km cm...= = 2 cmLebar pada denah =1100000100000100000km cm...= = 1 cmGambar denahnya dapat dilihat pada gambar.Contoh 2:Diketahui skala peta provinsi Bali 1 : 1.250.000. Jika jarak antara kotaDenpasar dan kota Negara pada peta tersebut 5,5 cm, berapakah jarak duakota tersebut sesungguhnya?Jawab:Skala peta 1 : 1.250.000. Artinya, 1 cm pada peta mewakili jarak 1.250.000 cm= 12,5 km pada jarak sesungguhnya.Jarak kota Denpasar dan Negara pada peta 5,5 cm. Artinya, jarak kedua kotasesungguhnya adalah 5,5 × 12,5 km = 68,75 km.Untuk mengingat kembali tentang skala, coba kerjakan soal berikutdalam buku latihanmu.1 cm2 cmAyo, kerjakan soal berikut di buku latihanmu.1. Kebun singkong Bu Yanti berbentuk persegipanjang. Panjangnya 100 m danlebarnya 80 m. Gambarlah denah itu dengan skala 1 : 2.000.2. Sebidang tanah berbentuk persesegipanjang mempunyai panjang 80 m danlebar 45 m. Jika pada denah, tanah tersebut digambarkan dengan panjang 16 cm,tentukan skala denah itu?Ayo, Berlatih 13
  • 96. 951. Aturan pengerjaan hitung campuran pada pecahan sama dengan aturanpengerjaan hitung campuran pada bilangan cacah.2. Skala adalah perbandingan jarak yang bersesuaian dengan peta denganjarak sesungguhnya.Coba kamu rangkum materi lainnya pada bab ini. Tulis di buku catatanmu.Ayo, MerangkumApakah Kamu Sudah Paham?Setelah kamu mempelajari materi pecahan, adakah yang belum kamu pahami?Bagian mana yang masih belum kamu pahami? Diskusikanlah bersama temandan gurumu.3. Jarak antara kota Pontianak dan Samarinda pada peta provinsi Kalimantanadalah 4,5 cm. Jika skala pada peta tersebut adalah 1 : 8.650.000, berapakahjarak sesungguhnya?4. Sebuah lapangan sepakbola berbentuk persegipanjang. Panjangnya 110 mdan lebarnya 65 m. Gambarlah denah itu dengan skala 1 : 2.200.Peta Penuntun BelajarPecahanMenyederhanakan danMengurutkan PecahanOperasi Hitungpada PecahanPecahanDesimalPecahan sebagaiPerbandingandan Skalamempelajari
  • 97. 96A. Ayo, isititik-titikberikutdenganjawabanyangbenar.1. Bentuk paling sederhana dari520adalah ....2. Urutkan pecahan13,15, dan12dari yang terkecil adalah ....3. Hasil dari 0,6 + 0,3 adalah ….4.4523+ = ...5. 11215+ = ...6.6815- = ...7. 2 ×18= ...8. 12546: = ...9.241228¥ + = ...10.1218914241424-¥ 1ÊËÊÊËˈ¯˜ˆˆ¯¯+ = ...B. Ayo, kerjakan soal-soal berikut ini.1. Jelaskan cara mengubah pecahanbiasa ke desimal dan sebaliknya.2. Jelaskancarauntukmelakukanpem-bagian pecahan desimal 1,25 : 0,05.3. Soal terbukaHasilkali dua pecahan biasa adalah46. Carilah dua pecahan tersebutyang mungkin.4. Banyak siswa di SD Tunas Harapanada 40 siswa. Adapun banyakguru di SD tersebut ada 80 orang.Berapa perbandingan banyak gurudan banyak siswa di SD tersebut?Diketahui perbandingan banyaksiswa dan banyak guru yang idealadalah 20 : 1. Apakah perbandinganbanyak siswa di SD tersebut sudahideal? Jelaskan.5. Jarak antara dua kota dalam petaadalah 2 cm. Skala peta tersebut1 : 250.000. Berapa jarak sebenarnyakedua kota tersebut?Uji Pemahaman Bab 6
  • 98. Jl.TohaJl.TohaJl. SoekarnoPT. LENJl.SukaatiJl.LuyuUJl.SriwijayaJl.PasirSumberDayaMineralSistem KoordinatDi Kelas V, kamu sudah belajar garis bilangan untuk bilangan bulat.Materi tersebut akan dikembangkan lagi pada bab ini sampai sistemkoordinat Cartesius. Selain itu, kamu juga akan mempelajari cara membacadan membuat denah. Materi tentang denah ini sangat bermanfaat dalamkehidupan sehari-hari.Misalnya, pada setiap undangan pernikahan atau khitanan selaludisertai denah lokasi tempat pernikahan tersebut berlangsung. Tujuannyauntuk mempermudah mencari tempat lokasi pernikahan. Bagaimana caramembaca dan membuat daerah itu?Mengingat pentingnya materi ini, pelajari dengan baik uraian pada bab ini.Apa yang kamu pelajari?Sumber: Dokumentasi PenerbitBab 797
  • 99. 98Membaca dan Membuat DenahTeman-teman Rubi hendak bermain ke rumahnya. Untuk memudahkanmencari rumahnya, Rubi membuat denah lokasi rumahnya seperti berikut.ACoba DuluGambarkan bilangan berikut pada garis bilangan.1. 3, 5, 7, 8 2. 14, 19, 20, 21Terletak di jalan apakah rumah Rubi? Terdapat apakah di sebelah kanandan kiri rumah Rubi? Terdapat apakah di seberang rumahnya?Amati denah dengan saksama. Rumah Rubi terletak di Jalan Anggrek. Disebelah kanan rumahnya ada mesjid. Di sebelah kirinya ada TK Insan Cerdik.Adapun di seberangnya terdapat rumah makan. Untuk mencapai rumahRubi, harus melewati Jalan Sudirman dahulu lalu masuk ke Jalan Anggrek.Contoh 1:Amati denah ruangan rumah Pak Pokiman berikut.Sumber: www.rumahdijual.info.comJalanMerdekaJalan SudirmanJalanMawarJalanAnggrekKantorDesaSDN1PasuruanMesjidRumahRubiTKInsanCerdikRumahMakan"Ampera"
  • 100. 99a. Berapa banyak kamar tidur di rumah tersebut?b. Ruangan apa yang terletak di sebelah kanan ruang makan?c. Di manakah posisi kamar mandi (WC) nya?Jawab:a. Dari denah tersebut tampak ada 2 kamar tidur.b. Ruangan yang terletak di sebelah kanan ruang makan adalah halamanbelakang.c. Di sebelah kanan kamar tidur.Ayo, lakukan tugas ini secara perseorangan.Buatlah denah letak rumahmu sejelas-jelasnya.Tampilkan hasilnya di depan kelas.Tugas 1Ayo, kerjakan di buku latihanmu.1. Amati denah lokasi rumah Cindi berikut.a. Terletak di jalan apakah rumah Cindi?b. Bangunan apa yang terletak di samping rumah Cindi?c. Di manakah letak SMP 1 Tenggaro?d. Kantor apakah yang letaknya berseberangan dengan kantor pos?e. Di manakah letak kantor Bank BBB?Ayo, Berlatih 1Kantor PolisiJalanMoh.HattaKantor DesaJalan Moh. YaminKantor POSBank BBBRumahCindiRumahWulanSMP 1 TenggaroPuskesmas Mandiri
  • 101. 100a. Terletak di kota mana lokasi pernikahan tersebut?b. Bangunan apa yang terletak di seberang lokasi pernikahan?c. Di jalan apa lokasi pernikahan tersebut?d. Hitung banyak pom bensin pada denah tersebut.e. Jelaskan harus melewati jalan apa saja untuk mencapai lokasi tersebutdari Tasik.3. Denah di samping adalah denah rumahSantia. Berapa banyakkah ruangan di rumahtersebut?b. Ruangan apa yang terletak di depan?c. Di manakah letak kamar tidurnya?d. Ruangan apa yang terletak di sebelahkamar mandi?4. Buatlah sketsa sekolahmu. Berikan hasilnya kepada teman sebangku untukdiperiksa dan diberi komentar.Sumber: www.rumahdijual.info.com2. Ibu memperoleh undangan pernikahan dari keluarga Bapak Hartono. Padaundangan terdapat lokasi pernikahan berikut.Jl. Cimanuk dari GarutJl.RSUJl. PasundanJl. CiledugNgamplangSubterminalAgrobisnisJl.PapandayanPom BensinCinistiPom BensinMunjulMesjidAl-IkhlasLOKASIPernikahanMaktalUJl. Banyongbongdari Tasik
  • 102. 101Letak tempat dudukmu dapat dinyatakan dengan baris dan kolom. Amatidenah tempat duduk berikut.Dari denah tersebut tampak siswa A terletak pada kolom ke-1 danbaris ke-1. Posisi siswa A dapat ditulis (1, 1).Siswa B terletak pada kolom ke-1 dan baris ke-4.Jadi, posisi siswa B adalah (1, 4).Siswa C terletak pada kolom ke-2 dan baris ke-2.Jadi, posisi siswa C adalah (2, 2).Di manakah posisi siswa D, E, F, G, dan H?Siapakah siswa yang posisinya (4, 5)?Siapakah siswa yang posisinya (3, 3)?Amati kembali denah tersebut. Posisi G adalah (3 1). Adapun posisi D adalah(1, 3). Kedua posisi siswa tersebut adalah berbeda. Dengan demikian, posisi(3, 1) tidak sama dengan posisi (1, 3). Apakah posisi (3, 2) dan (2, 3) samaletaknya?Selain menggunakan angka-angka, posisi benda dapat dinyatakan puladengan huruf dan angka. Amati contoh berikut.A F G KC JD HIEBLBaris keKolom ke1 2 3 412345MMengenal Sistem Koordinat1. Menentukan Koordinat Posisi Sebuah BendaCoba amati tempat dudukmu. Di manakah letak tempat dudukmu?Bagaimana caramu untuk menerangkan letak tempat dudukmu?B
  • 103. 102A B C D E F G H I J1234567CirebonBogorJakartaBandungAku Mau TahuRene Descartes adalah tokoh matematika yang kali pertamamengemukakan ide mengenai sistem koordinat Cartesius.Descartes memperkenalkannya pada pertengahan abad ke-17.Sumber: Ensiklopedi Matematika dan Peradaban ManusiaContoh 1:Dengan mengamati peta tersebut, kamu dapat mengetahui bahwa1. Kota Bandung terletak di posisi (G, 5);2. Kota Bogor terletak di posisi (E, 4);3. Kota Jakarta terletak di posisi (E, 3);4. Kota Cirebon terletak di posisi (J, 4).Tugas 2Ayo, lakukan tugas ini secara berkelompok (3 sampai 5 orang). Kerjakan dikertas berpetak.Carilah peta provinsimu, kemudian buatlah daftar koordinat tempat-tempatyang ada pada peta tersebut (paling sedikit 10 tempat). Buatlah tabelnyaseperti berikut.No. Nama Tempat Letak Tempat………………1.2.3.
  • 104. 103Ayo, Berlatih 2Ayo, kerjakan di buku latihanmu.Denah tempat duduk siswa Kelas VI SD Pancoran Mas sebagai berikut.1. Tentukan siswa yang menempati tempat duduk dengan koordinat berikut.a. (6, 1) d. (5, 2) g. (1, 4)b. (5, 1) e. (7, 5) h. (2, 3)c. (4, 3) f. (8, 5) i. (3, 5)2. Tentukan posisi siswa berikut.a. Lia c. Oci e. Kekeb. Ketut d. Lulu f. FransAmati peta Provinsi Jawa Timur berikut.1 2 3 4 5 6 7 81.2.3.4.5.No.MartaAmaraLindaRosaHanaUcokFransGintingDeharWiroVionaAyoaKekeKarinaVeraEkoAlungSaidHutaZidanAndarErikaBaniOciSantiMadeAplesBaraKahimKetutJerisaLilingLiaYeniLuluRuhutErikKandiSoniFadel12345678Keterangan: Kota GunungA B C D E F G H I J K L MPamekasanBojonegoroMadiunKediriGunungKeludBlitarMalangGunungMahameru Banyuwangi3. Tentukan letak koordinat kota atau gunung berikut.a. Kota Madiun d. Kota Pamekasanb. Kota Banyuwangi e. Kota Bojonegoroc. Gunung Kelud f. Gunung Mahameru4. Tentukan nama kota atau gunung yang terletak pada lokasi berikut.a. (D, 5) c. (H, 5) e. (D, 3)b. (E, 5) d. (D, 6) f. (L, 6)
  • 105. 1042. Menentukan Letak Titik pada Sistem KoordinatCartesiusDi Kelas V, kamu sudah mempelajari caramenentukan letak titik (yang menyatakanbilangan) pada garis bilangan. Pada bagian ini,kamu akan mempelajari cara menentukan letaktitik pada bidang datar (koordinat).AmatibidangdatarpadaGambar7.1.Bidangdatar berikut ini disebut bidang koordinatCartesius. Pada bidang ini terdapat garis tegaky (disebut sumbu-y) dan garis mendatar x(disebutsumbu-x).Keduagarisiniberpotongandi satu titik, yaitu titik O. Titik O ini disebut titikpusat koordinat.Sekarang, amati bidang koordinat padaGambar 7.2. Pada bidang tersebut terdapatbeberapa titik. Bagaimana cara menentukanletaknya? Letak setiap titik bidang koordinatditentukan oleh jarak titik tersebut ke setiapsumbunya. Pada Gambar 7.2, titik A terletak 3satuan di sebelah kanan sumbu y dan 2 satuan diatas sumbu x. Letak titik tersebut dapat dinyatakandengan (3, 2). Pasangan bilangan (2, 6) menyatakantitik B karena titik B terletak 2 satuan di kanansumbuydan6satuandiatassumbux.Berapakahletak titik C ?Pada uraian sebelumnya, letak sebuah titik dinyatakan oleh pasanganbilangan (x, y), huruf x disebut absis dan y disebut ordinat. Untuk titik A (3, 2),absisnya 3 dan ordinatnya 2.Ayo, Berlatih 3Ayo, kerjakan di buku latihanmu.1. Amati bidang koordinat Cartesius berikut.Tentukan koordinat setiap titik berikuta. Titik A terletak di koordinat (… , …)b. Titik B terletak di koordinat (… , …)c. Titik C terletak di koordinat (… , …)d. Titik D terletak di koordinat (… , …)e. Titik E terletak di koordinat (… , …)f. Titik F terletak di koordinat (… , …)01234561 2 3 4 5 6xy7891011127 8 9 101112CAFBGDHEJIGambar 7.1Bidang Koordinat Cartesiusyx1234561 2 3 4 5O 6Gambar 7.2CBx1234561O 654323 satuan ke kanan2 satuan ke atasA
  • 106. 105AFBDEGxy1234561 2 3 4 5 6 70D Cg. Titik G terletak di koordinat (… , …)h. Titik H terletak di koordinat (… , …)i. Titik I terletak di koordinat (… , …)j. Titik J terletak di koordinat (… , …)2. Perhatikan bidang koordinat Cartesius disamping. Kemudian, jawab dengan benar.a. Titik A ( … , … )b. Titik B ( … , … )c. Titik … (2, 3)d. Titik … (4, 3)e. Titik F ( … , … )f. Titik … (5, 3)g. Titik G ( … , … )3. Gambarkan titik A(4, 1), B(6, 3), C(7, 1), dan D(4, 0) pada bidang koordinatCartesius.4. PQRS merupakan persegipanjang dengan P(2, 0), Q(3, 0), dan R(3, 3).a. Gambar titik-titik tersebut pada bidang koordinat Cartesius.b. Gambar titik S sehingga PQRS menjadi persegipanjang.c. Tentukan koordinat titik S.d. Tentukan keliling persegipanjang PQRS.e. Tentukan luas persegipanjang PQRS.5. Diketahui titik A(1, 3), B(2, 3), dan C(5, 3).a. Gambar titik-titik tersebut pada bidang koordinat Cartesius.b. Gambar titik D sehingga ABCD menjadi jajargenjang.c. Tentukan koordinat titik D.d. Tentukan keliling jajarangenjang ABCD.e. Tentukan luas jajarangenjang ABCD.Tulislah di buku catatanmu rangkuman materi yang telah kamu pelajari padabab ini.Ayo, MerangkumApakah Kamu Sudah Paham?Setelah kamu mempelajari materi sistem koordinat, adakah yang belum kamupahami? Bagian mana yang masih belum kamu pahami? Diskusikanlah bersamateman dan gurumu.
  • 107. 106Peta Penuntun BelajarSistem KoordinatMembaca dan Membuat DenahmempelajariMengenal Sistem Koordinat CartesiusA. Ayo, isi titik-titik berikut denganjawaban yang benar.Gunakan denah berikut untuk menjawabsoal nomor 1–5.Pabrik TahuJl. SudirmanJl.MelatiRumahDikdikRumahAjengKantor PosSD MutiaraPOMBensinSawah1. Di sebelah kanan rumah Dikdikadalah rumah ....2. Kantor pos terletak di jalan ....3. Pabrik tahu terletak di jalan ....Uji Pemahaman Bab 74. Bangunan di sebelah kiri kantorpos adalah ....5. Banyak rumah pada denah tersebutada ....6. KoordinatsebuahtitikadalahA(3,4).Absis dari titik A adalah ....7. Soal terbukaDua koordinat titik yang memilikiabsis dan ordinat yang sama adalah... dan ….8. Sebuah titik terletak 4 satuan disebelah kanan sumbu-y dan 5satuan di sebelah atas sumbu-x.Koordinat titik tersebut adalah ....9. GaristegakpadakoordinatCartesiusdisebut ....10. Koordinat titik potong sumbu-xdan sumbu-y adalah ....B. Ayo, kerjakan soal-soal berikut ini.1. Diketahui koordinat titik-titik sudutsegitiga ABC adalah A(–2, 2), B(2, 2),dan C(2, 5). Luas segitiga ABC adalah....2. Koordinat titik-titik sudut persegi-panjang ABCD adalah A(–5, 2), B(3, 2),dan C(3, 7). Koordinat titik sudut Dadalah ....3. Buatlah denah tempat duduk diruang kelasmu.4. Buatlah denah sekolahmu.5. Jelaskan cara membuat sebuahdenah.
  • 108. Pengolahan DataDi semester 1, kamu sudah belajar cara menyajikan data dalam bentuktabel. Data dari tabel tersebut dapat disajikan ke dalam berbagai bentukdiagram. Sekarang, akan dipelajari cara menyajikan data dalam bentukdiagram. Kamu juga akan mempelajari rata-rata hitung, modus, dan nilaitertinggi dan terendah dari sekumpulan data.Manfaatmempelajarimateriiniditunjukkanpadapermasalahanberikut.Ibu Nirma seorang guru Olahraga. Pada suatu hari ia mengadakanpenimbanganbadansiswaKelasVISDPurnama.Darihasilpenimbanganbadantersebut, diperoleh data (dalam kilogram) sebagai berikut.36 38 41 44 46 38 38 44 41 4638 40 46 38 38 38 41 44 46 4436 36 38 38 41 38 41 46 38 46Dari data tersebut, dapatkah kamu menentukan berapa berat badantertinggi dan berat badan yang paling banyak muncul?Jika kamu mempelajari bab ini dengan baik maka kamu akan dapatmenyelesaikan permasalahan tersebut.Apa yang kamu pelajari?Bab 8107
  • 109. 108Membaca dan Menyajikan Data1. MembacadanMenyajikanDatadalamBentukTabelUntuk mengingat kembali cara membaca dan menyajikan data dalambentuk tabel, pelajari contoh berikut.Contoh 1:Pada suatu hari, Bu Guru mengadakan penimbangan badanterhadap 40 siswa Kelas VI. Dari hasil penimbangan badantesebut, diperoleh data (dalam kilogram) sebagai berikut.30 28 32 31 30 30 33 32 35 2728 29 27 29 30 31 31 33 34 3430 30 31 29 32 33 34 36 38 3837 37 30 30 31 30 30 32 28 29Data yang telah terkumpul diolah dengan cara mengelompokkan beratbadan setiap siswa. Untuk mempermudah pengelompokan tersebut, dibuattabelnya seperti berikut.ACoba Dulu1. Tentukanlah jumlahnya.a. 4 + 5 + 6 + 7 + 8 + 9 + 10 b. 11 + 13 + 10 + 9 + 8 + 122. Ubah pecahan berikut ke dalam bentuk desimal.a.12b.34c.253. Urutkan bilangan berikut dari yang terkecil.a. 11, 9, 7, 5, 4 b. 23, 14, 15, 16, 17No. Berat Badan (kg) Turus Banyak Siswa1.2.3.4.5.6.7.8.9.10.11.12.272829303132333435363738IIIIIIIIIIIII IIIIIIIIIIIIIIIIIIIIIIII234105433112240Jumlah
  • 110. 109Dari tabel tersebut, diketahui ada 2 orang siswa yang berat badannya 27 kg,ada 3 orang yang berat badannya 28 kg, dan seterusnya.Contoh 2:BuNirmaseorangguruolahraga.Padasuatuhari,iamengadakanpengukurantinggi badan siswa Kelas VI SD Purnama. Dari hasil pengukuran tinggi badantersebut, diperoleh data (dalam centimeter) sebagai beikut.136 138 141 144 146 138 138 144 141 146138 144 146 138 138 138 141 144 146 144136 136 138 138 141 138 141 146 138 146a. Berapa banyak data yang diperoleh?b. Susun data tersebut dalam bentuk tabel.c. Berapa centimeter tinggi badan siswa yang paling banyak?d. Berapa persen banyak siswa yang tinggi badannya 136 cm?Jawab:a. Banyak data 30.b. Tabel tinggi badan siswa Kelas VI SD Purnama sebagai berikut.No. Tinggi Badan (cm) Turus Banyak Siswa1.2.3.4.5.136 cm138 cm141 cm144 cm146 cmIIIIIII IIII IIIIIIIIIIIII I311556c. Tinggi badan siswa yang paling banyak adalah 38 cm, yaitu ada 11 orang.d. Siswa yang tinggi badannya 136 cm ada 3 orang.Artinya, persentase siswa yang tinggi badannya 136 cm adalah330× 100% = 10%.Ayo, Berlatih 1Ayo, kerjakan di buku latihanmu.1. Data luas wilayah dan jumlah penduduk desa-desa di sebuah Kecamatanadalah sebagai berikut.No. Nama Desa Luas (km2) Banyak Penduduk (jiwa)1.2.3.4.SuburMakmurTertibTertib145236150232432385251403a. Desa manakah yang paling banyak penduduknya?Berapa banyak penduduknya?b. Desa manakah yang paling luas wilayahnya? Berapa luasnya?c. Desa manakah yang memiliki kepadatan penduduk paling tinggi?
  • 111. 1102. Nilai Matematika 40 siswa Kelas VI SD Alfarabiadalah sebagai berikut.2 siswa nilainya 4513 siswa nilainya 5517 siswa nilainya 654 siswa nilainya 704 siswa nilainya 80a. Susun data tersebut dalam bentuk tabel seperti berikut.No. Nilai Matematika Turus Banyak Siswa1.2.3.4.5.4555657080IIIIII IIII IIIIIII IIII IIII IIIIIIIIII………………Jumlahb. Berapa persen banyak siswa yang nilai Matematikanya tertinggi?c. Berapa persen banyak siswa yang nilai Matematikanya terendah?3. Dalam rangka mencari calon pemain voli dan basket dari 20 orang siswa,dikumpulkan data melalui pengukuran tinggi badan dalam satuan sentimetersebagai berikut.140 143 146 143 140 139 140 140 143 143139 143 140 140 146 142 146 146 146 146a. Susun data tersebut dalam bentuk tabel.b. Berapa sentimeter tinggi badan siswa yang paling banyak?c. Berapa sentimeter tinggi badan siswa yang paling pendek?d. Berapa orang siswa yang paling pendek?e. Berapa persen banyak siswa yang tinggi badannya 143 cm?2. MembacadanMenyajikanDatadalamBentukDiagramGambarData dapat disajikan dalam bentuk gambar untuk menarik perhatianpembaca. Akan tetapi, cara seperti ini kurang akurat untuk menampilkanjumlah eksak data. Cara ini secara cepat memberikan perbandinganbeberapa kategori pada data. Untuk jelasnya, pelajari contoh berikut.Contoh 1:Diagram gambar (Piktogram) berikut menampilkan keuntungan yangdiperoleh sebuah perusahaan. Satu gambar Rp menampilkan keuntungansebesar Rp1.000.000,00.
  • 112. 111Tahun Keuntungan yang diperoleh ( Rp = Rp1.000.000,00)1995 Rp Rp Rp Rp Rp Rp1996 Rp Rp Rp Rp Rp Rp1997 Rp Rp Rp Rp Rp1998 Rp Rp Rp Rp Rp1999 Rp Rp Rp Rp Rp Rp Rpa. Berapa keuntungan perusahaan pada tahun 1996 dan 1997?b. Pada tahun berapa keuntungan perusahaan paling sedikit?Jawab:a. Pada tahun 1996 ada 6 Rp . Satu Rp menampilkan satu juta. Jadi, ke-untungan pada tahun 1996 adalah 6 × Rp1.000.000,00 = Rp6.000.000,00.Pada tahun 1997 kira-kira ada 4,5 gambar Rp . Jadi, keuntungan per-usahaan tersebut kira-kira 4,5 × Rp1.000.000,00 = Rp4.500.000,00.b. Keuntungan paling sedikit terjadi pada tahun 1997.DalampiktogrampadaContoh1terdapatgambar Rp .Gambar1 Rp senilaidengan Rp1.000.000,00. Kalimat tersebut merupakan skala dari piktogramyang dimaksud. Skala sangat penting untuk ditampilkan dalam sebuah pikto-gram. Jika tidak terdapat skala, piktogram sulit untuk dipahami.Contoh 2:Hasil survei olahraga yang disukai di SDPelita Kita ditampilkan pada tabel di-samping. Setiap siswa hanya memilihsatu jenis olahraga.Tampilkan tabel tersebut dalam suatupiktogram.Jawab:Pertama, tentukan 1 gambar akan me-wakili berapa data. Misalkan, 1 gambarmenyatakan 20 orang. Jenis olahraga bulutangkis dipilih oleh 130 orang,berarti ada13020= 6,5 gambar . Oleh karena itu, buat gambar sebanyak6,5 di piktogram. Coba tentukan untuk jenis olahraga yang lain. Jika kamumenghitungnya dengan benar. Piktogram dari data tersebut adalah sebagaiberikut.Jenis Olahraga Banyak SiswaBulutangkis 130Basket 180Renang 85Sepakbola 210Tenis 110Jumlah ...Tabel Pilihan Olahraga Siswa
  • 113. 112Jenis Olahraga Banyak Siswa ( = 20 orang)BulutangkisBasketRenangSepakbolaTenisJumlah ....Tabel Pilihan Olahraga SiswaJika yang memilih bulutangkis ada 123 orang, bagaimana menampilkannyadalam bentuk piktogram? Ada berapa banyak gambar ?Ayo, kerjakan di buku latihanmu.1. Piktogram berikut menampilkan banyak mobil yang dijual dari tahun 1999–2003 di suatu negara.Ayo, Berlatih 2Tahun Banyak Mobil (setiap = 40.000 mobil)19992000200120022003a. Pada tahun berapa jumlah mobil yang dijual paling banyak?b. Perkirakan banyak mobil yang dijual setiap tahun.c. Jika pajak kendaraan setiap mobil Rp400.000,00, berapa rupiah uang yangdikumpulkan pemerintah pada tahun 1999?2. Tampilkan data berikut dalam piktogram.a.b.Nama Perumahan Jumlah WargaCempaka Putih 1.200Bumi Parahyangan 800Griya Asri 600Pinus Cakra 720Batununggal Indah 860Sekolah Banyak SiswaSD Karya Sari 850SD Budi Asih 750SD Pelita Jaya 985SD Buleleng 1.120Banyaky k Mobil (setiap 40.0ap =ap
  • 114. 1133. MembacadanMenyajikanDatadalamBentukDiagramBatanga. Membaca Data dalam Bentuk Diagram BatangPernahkahkamumelihatdiagram seperti padaGambar8.1.?Diagramyangtampakpadahalamanberikut ini disebut diagram batang. Biasanya,diagram seperti itu ada di ruang tata usahasekolahmuataudiruangkepalasekolah.Diagram batang di samping menunjukkanbanyak siswa SD Permata pada tahun 2007untuk setiap Kelas. Berapakah jumlah siswaKelas III?1020304050607080I II III IV V VI0BanyaknyaSiswaKelasGambar 8. 1Banyaknya Siswa SD PermataTahun 2007Amati diagram tersebut dengan baik. Dari diagram batang padaGambar 8.1, diperoleh hal-hal sebagai berikut.a. Banyak siswa Kelas I adalah 50 orang, ditunjukkan dengan batang yangpertama.b. Banyaknya siswa Kelas II adalah 40 orang, ditunjukkan dengan batang yangkedua.c. KelasyangterbanyaksiswanyaadalahKelasVI,yaitu80orang,sedangkankelas yang paling sedikit siswanya adalah Kelas II, yaitu 40 orang.Apalagiyangdapatkamubacadaridiagramtersebut?Berapakahjumlahseluruh siswa di SD Permata tersebut?Ayo, Berlatih 3Ayo, kerjakan di buku latihanmu.1. Hasil ulangan Bahasa Indonesia siswaKelas VI SD Melati disajikan dalamdiagram batang berikut.a. Tentukanlah banyak siswa yangnilainya 5, 6, 8, dan 10.b. Berapakah nilai yang paling banyakdiperoleh siswa?c. Berapa siswa yang memperolehnilai lebih besar dari 8?d. Tentukan jumlah seluruh siswaKelas VI di SD Melati tersebut.123456784 5 6BanyaknyaSiswaNilai9107 8 9 10
  • 115. 1142. Ibu Farida menyajikan data jumlah telur yang dihasilkan peternakannya dalamdiagram berikut.100200300400500600700800JanuariFebruariMaretBanyaknyaTelur(Butir)Bulan9001000April Mei Junia. Pada bulan apa jumlah telur yang dihasilkan paling banyak?b. Pada bulan apa jumlah telur yang dihasilkan paling sedikit?c. Pada bulan apa saja jumlah telur yang dihasilkan sama banyak?d. Pada bulan apa saja jumlah telur yang dihasilkan lebih banyak dari bulanMei?3. Diagram batang berikut menyajikan data tinggi badan 5 siswa Kelas VI SDHarapan.100110120130140150160Made Togar YantiTinggiBadan(cm)Nama SiswaAndi Meria. Siswa yang paling tinggi adalah …, yaitu … cm.b. Made tingginya ... cm lebih pendek daripada Andi.c. Meri mempunyai tinggi badan yang sama dengan …, yaitu … cm.d. Terdapat ... orang siswa yang tingginya kurang dari 135 cm.
  • 116. 1155Liter10WadahA015202530WadahBWadahCWadahD5Liter10WadahA015202530WadahBWadahCWadahDAku Pasti BisaDiagram batang di sebelah kiri menampilkan banyak air yang dapat ditampungsetiap wadah. Adapun di sebelah kanan menampilkan volume setiap wadah.a. Berapakah jumlah volume seluruh wadah?b. Wadah manakah yang isinya penuh?c. Berapa liter air yang harus ditambahkan agar setiap wadah tersebut terisipenuh?Wadah A ditambah ... liter air. Wadah C ditambah ... liter air.Wadah B ditambah ... liter air. Wadah D ditambah ... liter air.b. Menyajikan Data dalam Bentuk Diagram BatangUntuk mengetahui cara menyajikan data ke dalam bentuk diagram batang,pelajari contoh berikut.Contoh 3:Untuk mengetahui warna kaos yang akan dibuat, Pak Bansar menyurveisiswanya. Hasilnya tampak pada tabel berikut.Warna Kaos Turus FrekuensiMerah 8Biru 4Kuning 12Hitam 5Jumlah 29Buatlah diagram batangnya.
  • 117. 116Jawab:1) Pertama buat sumbu koordinat pada kertas berpetak. Beri judul untukdiagram batang tersebut. Beri pula nama pada sumbu vertikal danhorizontal.2) Tentukan skala sumbu vertikal dan horizontal.3) Gambar batang pertama dengan tinggi sama dengan 8 siswa. Beri namadi bawah batang tersebut merah.4) Buatlah jarak antara batang pertama dan batang berikutnya samadengan lebar batang.5) Ulangi langkah 3 dan 4 untuk setiap warna kaos lainnya. Hasilnya tampakseperti berikut.Warna KaosWarna Kaos yang Disenangi SiswaBanyakSiswa24681012O Merah Biru Kuning HitamAku Mau TahuDiagram batang dalam Contoh 3 dapat pula disajikan seperti berikut.Banyak Siswa2 4 6 8 10 12WarnaKaosMerahBiruKuningHitam
  • 118. 117Contoh 4:Banyak peserta lomba mental aritmatika selama empat tahun tampakseperti pada tabel berikut.No. Tahun Banyak Peserta1.2.3.4.200420052006200721284249140JumlahSajikan data tersebut dalam diagram batang.Jawab:Diagram batang yang akan dibuat dapatkamu pelajari sebagai berikut.Pada sumbu mendatar, diletakkan nama darianggota data, yaitu tahun.Pada sumbu tegak, diletakkan skala untukbanyak (frekuensi) setiap anggota data. Dalamhal ini, yaitu banyak peserta. Setiap batangmerupakan daerah persegipanjang yang alas-nya sama panjang. Adapun tingginya sesuaidenganbanyak(frekuensi)setiapanggotadata.Misalnya, pada tahun 2004, banyak peserta ada21, tinggi persegipanjangnya berada pada 21.10BanyakPeserta20200403040502005 2006 2007TahunAyo, Berlatih 4Ayo, kerjakan di buku latihanmu.1. Data berikut menunjukkan banyak siswa yang lulus dari SDN I Karangnunggaldari tahun 2004 – 2007.Tahun Banyak siswayang lulus200420052006200740455035Sajikan data tersebut dalam bentuk diagram batang.Dari diagram batang tersebut, tentukanlah:a. pada tahun berapa, jumlah siswa yang lulusterbanyak;b. pada tahun berapa, jumlah siswa yang luluspaling sedikit;c. berapa banyak siswa yang lulus dari tahun 2004sampai 2007?
  • 119. 1184. MembacadanMenyajikanDatadalamBentukDiagramGarisa. Membaca Data dalam Bentuk Diagram GarisPernahkah kamu melihat diagramseperti bentuk diagram tersebut?DiagraminibiasanyaterdapatdalamKartu Menuju Sehat (KMS). Diagramtersebut disebut .KMS digunakan untuk melihatpertumbuhan balita. Selain itu, kartuini juga digunakan untuk melihat ke-adaan gizi balita.2. Banyak pengunjung yang datang ke Kebun Binatang ABC adalah sebagai berikut.Bulan Banyak PengunjungJanuariFebruariMaretMeiAprilJuni100120150110130140Bulan Banyak PengunjungJuliAgustusSeptemberOktoberNovemberDesember200160110130120220Sajikan data tersebut dalam bentuk diagram batang. Kemudian, tentukanlah:a. pada bulan apa banyak pengunjung di Kebun Binatang tersebut terbanyak;b. berapa banyak pengunjung pada waktu liburan sekolah?Gambar 8. 2Hasil penimbangan badan bayi sejak lahirsampai usia 1 tahun (12 bulan)712344 5 6Berat(kg)Usia (bulan)57 8 9 1032106711 12Tugas 1Ayo, lakukan tugas ini secara berkelompok (4 sampai 6 orang).Carilah informasi mengenai berat badan teman-teman sekelasmu. Kemudian,buatlah diagram batang dari data yang telah kamu peroleh. Kemukakan hasilnyasecara singkat di depan kelas bergiliran dengan kelompok lain.
  • 120. 119Bagaimana cara membaca diagram tersebut? Amati diagram ini dengan baik.Ayo, Berlatih 5Ayo, kerjakan di buku latihanmu.1. Suhu badan seorang pasien yang dipantau setiap jam di sebuah rumah sakitditunjukkan dalam diagram garis berikut.3435SuhuBadan(˚C)Pukul01.0003637383902.00 03.00 04.00 05.00 06.00 07.00 08.004041a. Berapa suhu badan pasien pukul 02.00, 05.00, dan 08.00?b. Kapan suhu badan pasien paling tinggi? Berapa derajat suhunya?c. Kapan suhu badan paling rendah? Berapa derajat suhunya?Sumber:http://kmpk.forum-posyandu.org12344 5 6Berat(kg)Usia (bulan)57 8 9 1032106711 12Hasil penimbangan badan bayi sejak lahir sampaiusia 1 tahun (12 bulan)Dari diagram garis tersebut, dapat diperoleh hal-hal berikut.a. Pada waktu lahir, berat badan bayi 2,5 kg.b. Pada usia 1 bulan, berat badan bayi 3 kg.c. Pada usia 2 bulan, berat badan bayi 3,5 kg.d. Setelah 1 tahun, berat badan bayi bertambah 6 kg – 2,5 kg = 3,5 kg.e. Pada usia 3–4 bulan dan 8–9 bulan, berat badan bayi tidak bertambah.f. Pada usia 12 bulan, berat badan bayi mengalami penurunan dari bulansebelumnya, yaitu seberat 6,5 kg – 6 kg = 0,5 kg.Jadi, bayi tersebut mempunyai berat badan tertinggi pada usia 11 bulan,yaitu 6,5 kg. Adapun berat badan bayi terendah terjadi pada waktu lahir,yaitu 2,5 kg.
  • 121. 1202. Diagram garis berikut menunjukkan banyak siswa yang lulus dari tahun 1997sampai dengan tahun 2006 di SD Bhineka.5101520BanyakSiswaTahun2519970303540455055601998 1999 2000 2001 2002 2003 2004 2005 2006a. Banyak siswa yang lulus tahun 1997 adalah ... orang.b. Banyak siswa yang lulus tahun 1999 adalah ... orang.c. Banyak siswa yang lulus tahun 2003 adalah ... orang.d. Pada tahun berapa, banyak siswa yang lulus sama dengan tahun 2003?e. Berapa selisih banyak siswa yang lulus pada tahun 1997 dan 2001?f. Pada tahun berapa saja, banyak siswa yang lulus lebih dari 45 orang?g. Pada tahun berapa saja, banyak siswa yang lulus kurang dari 35 orang?h. Tentukanlah jumlah siswa yang lulus dari tahun 1997 sampai dengantahun 2006.3. Diagram garis berikut menunjukkan banyak pembaca majalah anak "XYZ"selama 6 bulan pertama.1234BanyakPembaca(dalamribuan)Bulan5Januari06789FebruariMaret April Mei Junia. Berapajumlahorangpem-bacaselama3bulanpertama?b. Pada bulan apakah terjadi kenaikan banyak pembaca terbesar?c. Pada bulan apa saja terjadi penurunan banyak pembaca terbesar?
  • 122. 121b. Menyajikan Data dalam Bentuk Diagram GarisAmatikembalidatapadaContoh3.Untukmenyajikandatatersebutdalamdiagram garis, amati uraian berikut.Pertama, buatlah sumbu mendatar dan tegak. Pada sumbu mendatarletakkan tahun. Kemudian, pada sumbu tegak letakkan banyak peserta.Buatlah titik yang menghubungkan antara tahun dan banyak peserta.Misalnya tahun 2004 titiknya berada pada 21 karena banyak peserta ada 21.Lanjutkanmembuattitik-titikuntuktahunselanjutnya.Terakhir,hubungkantitik-titik ini dengan garis lurus. Hasilnya tampak seperti berikut.1020BanyakPesertaTahun200403040502005 2006 2007Dengan hanya mengamati diagram garistersebut, kamu dapat melihat perkembanganjumlah peserta dari tahun ke tahun.Dari diagram tersebut, tampak bahwa terjadikenaikan jumlah peserta pada setiap tahunnya.Ayo, kerjakan di buku latihanmu.1. Nilai tukar uang dolar terhadap rupiah selama 6 bulan pertama tahun 2007adalah sebagai berikut.Januari : 1 dolar = Rp9.920,00 April : 1 dolar = Rp9.630,00Februari: 1 dolar = Rp9.800,00 Mei : 1 dolar = Rp9.510,00Maret : 1 dolar = Rp9.720,00 Juni : 1 dolar = Rp9.400,00Sajikan data tersebut dalam diagram garis. Kemudian, tentukan:a. pada bulan berapakah nilai tukar dolar paling tinggi;b. pada bulan berapakah nilai tukar dolar paling rendah;c. berapa selisih nilai tukar dolar pada bulan Januari dan Juni?d. menurutmu, bagamana nilai tukar dolar pada bulan Juli? Akankah naikatau turun? Jelaskan.Ayo, Berlatih 6Tugas 2Ayo, lakukan tugas ini secara berkelompok (4 sampai 6 orang).Carilah informasi di buku atau tanya seseorang cara menyajikan diagram garisdengan program Microsoft Excel. Peragakan hasilnya.
  • 123. 1225. MembacadanMenyajikanDatadalamBentukDiagramLingkarana. Membaca Data dalam Bentuk Diagram LingkaranSuatu data dapat juga ditampilkan dengan diagram lingkaran. Di koranatau majalah, diagram seperti ini sering digunakan.Diagraminidisebutdiagramlingkarankarenabentuknyaberupalingkaran.Diagram lingkaran berikut menunjukkan pekerjaan orangtua dari 40 siswadi SD Sukamaju.2. Data suhu badan pasien pada jam tertentu tampak pada tabel berikut.Jam Suhu Badan ( ˚C )13.0013.0015.0040˚C38˚C40˚CJam Suhu Badan ( ˚C )41˚C38˚C26˚ C16.0017.0018.00Sajikan data tersebut dalam bentuk diagram garis.Dari diagram tersebut, tentukanlah:a. pada jam berapa suhu badan pasien naik;b. pada jam berapa suhu badan pasien turun;c. apakah suhu badan pasien pada pukul 19.00 akan turun atau naik? Berikanalasannya.Pekerjaan Orangtua dari 40siswa SD SukamajuPetani42,5%Wiraswasta7,5%Pedagang30%PegawaiNegeri20%Bagaimanakah cara membaca diagram lingkaran tersebut?Amati diagram lingkaran tersebut dengan baik.Dari diagram tersebut, diperoleh hal-hal berikut.a. Banyak orangtua siswa yang menjadi pedagang adalah30% × 40 =30100× 40 =30 40100¥=1200100.= 12 orang.b. Banyak orangtua siswa yang menjadi wiraswasta adalah7,5% × 40 = 7 5100,× 40 =7 5 40100, ¥=300100= 3 orang.c. Banyak orangtua siswa yang menjadi petani adalah42,5% × 40 =42 5100,× 40 =42 5 40100,=1700100.= 17 orang.
  • 124. 123Ayo, kerjakan di buku latihanmu.1. Diagram berikut menunjukkan hasil panen seorang petani.Hasil panen seluruhnya diketahui sebanyak 80 kuintal.a. Hasil panen padi sebanyak … kuintal.b. Hasil panen jagung sebanyak … kuintal.c. Hasil panen pisang sebanyak … kuintal.d. Selisih antara hasil panen singkong dan pisangadalah … kuintal.e. Hasil panen yang paling banyak adalah ….f. Hasil panen yang lebih dari 15 kuintal, yaitu… dan ….Ayo, Berlatih 7pisang10%kedelai15%padi35%singkong17,5%jagung22,5%d. Banyak orangtua siswa yang menjadi pegawai negeri adalah20% × 40 =20100× 40 =20 40100¥=800100= 8 orang.e. Pekerjaan orangtua siswa yang paling banyak adalah petani, yaitu 17orang. Adapun pekerjaan orangtua siswa yang paling sedikit adalahwiraswasta, yaitu 3 orang.2. Diagram berikut menunjukkan warna yang disukai 40 siswa Kelas VI.a. Banyak siswa yang menyukai warna orangeadalah … orang.b. Banyak siswa yang menyukai warna biruadalah … orang.c. Warna yang paling sedikit disukai siswaadalah warna ….d. Selisih banyak siswa yang menyukai warnamerah dan hijau adalah … orang.e. Warna-warni yang disukai lebih dari 6 orangadalah ….hijau15%abu-abu10%orangebiru25% merah30%b. Menyajikan Data dalam Bentuk Diagram LingkaranAmati kembali data pada Contoh 4. Bagaimana cara untuk menyajikandata tersebut dalam bentuk diagram lingkaran.Pertama, buat sebuah lingkaran dengan jangka. Kedua, tentukan besarsudut pusat pada lingkaran. Hal ini menggambarkan banyak peserta setiaptahunnya. Kemudian, tentukan pula persentasenya.21140× 360°= 54°Persentasenya21140× 100% = 15%
  • 125. 124Ayo, kerjakan di buku latihanmu.1. Berikut ini tabel pengeluaran rumah tangga keluarga Pak Situmorang selamabulan September 2006.No. Jenis Pengeluaran Banyaknya (dalam rupiah)a.b.c.d.e.MakanUang SekolahTransportasiTabunganLain-lain300.000100.00075.00050.00075.000600.000JumlahTahun200630%Tahun200520%Tahun200735%Tahun200415%Ayo, Berlatih 8Aku Mau TahuIlmu yang berhubungan dengan pengumpulan data, penyajian data dalambentukdiagram,danpengolahandatadikenaldenganilmustatistika.Sekarang,ilmu statistika telah berkembang pesat. Ilmu ini banyak digunakan dalamberbagai bidang, seperti teknik, kedokteran, biologi, dan geologi.28140× 360°= 72°Persentasenya28140× 100% = 20%42140× 360°= 108°Persentasenya42140× 100% = 30%49140× 360°= 126°Persentasenya49140× 100% = 35%Setelah itu, gambarkan sudut pusat tersebutpada lingkaran. Misalnya, untuk tahun 2004, buatsudut pusat sebesar 54˚ dengan busur derajat.Lanjutkan untuk tahun lainnya. Hasilnya tampakseperti gambar di samping.
  • 126. 1252. Banyak penduduk suatu daerah menurut pekerjaannya disajikan dalam tabelberikut.No. Pekerjaan Banyak penduduka.b.c.d.e.Pegawai NegeriBuruhNelayanPegawai SwastaPetani7 juta5 juta4 juta3 juta1 juta20 jutaJumlahMenentukan Nilai Tertinggi, NilaiTerendah, Rata-rata, dan Modus1. MengurutkanDataDi kelas sebelumnya, kamu sudah belajar cara mengurutkan bilangan.Coba kamu urutkan bilangan 11, 7, 6, 9, 10 dari yang terkecil.Untuk memudahkan pengolahan, data diurutkan dari yang terkecil.Data yang paling kecil disebut nilai terendah. Adapun data yang paling besardisebut nilai tertinggi.Contoh 1:Urutkan data nilai ulangan matematika beberapa siswa berikut. Tentukanpula nilai terendah dan tertingginya.7, 6, 4, 5, 9, 10Jawab:Urutkan data dari yang terkecil adalah4 , 5, 6, 7, 9, 10nilai terendah nilai tertinggiBTugas 3Ayo, lakukan tugas ini secara berpasangan (2 orang).Salinlah diagram batang, diagram garis, atau diagram lingkaran yang ada dikantor kelurahan/desa terdekat. Berikan penjelasan mengenai data pada diagramtersebut.Buatlah laporannya dan kumpulkan. Kemudian, jelaskan secara lisan di depankelasmu.
  • 127. 126Nilai terkecil ulangan matematika tersebut adalah 4.Nilai tertinggi ulangan matematika tersebut adalah 10.Contoh 2:Hasil pengukuran lompat jauh beberapa siswa adalah sebagai berikut.Intan : 1,2 m Lala : 1,17 mRudi : 1,54 m Dadi : 1,49 mCici : 1,36 m Zia : 1,10 mSiapakah yang lompatannya terjauh? Siapakah yang lompatannya ter-pendek?Jawab:Urutkan data tersebut dari yang terkecil. Hasilnya sebagai berikut.1,10; 1,17; 1,2; 1,36; 1,49; 1,54Nilai terendah adalah 1,10, yaitu hasil lompatan Zia.Jadi, orang dengan lompatan terpendek adalah Zia.Nilai tertinggi adalah 1,54, yaitu hasil lompatan Rudi.Jadi, orang dengan lompatan terjauh adalah Rudi.Ayo, kerjakan di buku latihanmu.1. Urutkan data hasil ulangan bahasa Indonesia berikut dari yang terendah.a. 4, 8, 9, 10, 6, 7 c. 36, 49, 56, 48, 79, 68b. 5, 6, 5, 7, 8, 4, 9 d. 88, 66, 56, 76, 48, 962. Selesaikan soal berikut.a. Hasil ulangan Bahasa Inggris beberapa siswa adalah sebagai berikut.Riani : 8, Indri : 7, Candy : 8, Rifka : 6, Bondan : 9, Luna : 10, Arif : 7.Siapakah yang nilainya tertinggi?Siapakah yang nilainya terendah?b. Berat badan 10 siswa Kelas VI A adalah sebagai berikut.Nurdin : 45,5 kg; Rere : 41,7 kg; Ajeung : 50,48 kg; Anton : 61,43 kg;Wendi : 36,78 kg; Badu : 41,68 kg; Sandi : 61,34 kg; Susi 36,87 kg;Cucu : 42,6 kg; Ramang : 45,67 kg.Urutkan data tersebut dari yang terendah.Siapakah yang berat badannya terendah?Siapakah yang berat badannya tertinggi?Ayo, Berlatih 92. MenentukanRata-rataHitungAmati buku rapormu. Selain terdapat nilaimu, pada buku rapormuterdapat pula nilai rata-rata kelas. Bagaimana cara mencari nilai ini?Rata-rata dari sekumpulan data dapat diperoleh dengan rumus berikut.Rata-rata =Jumlah semua nilai databanyak data
  • 128. 127Contoh 1:Tentukanlah rata-rata hitung dari data 11, 12, 15, 16, 19, 12, 14, 13.Jawab:Cara 1:Jumlah data = 11 + 12 + 15 + 16 + 19 + 12 + 14 + 13 = 112banyak data = 8Rata-rata =Jumlah databanyak data=1128= 14Jadi, rata-ratanya 14.Cara 2:Urutkan dahulu data dari yang terkecil11, 12, 12, 13, 14, 15, 16, 19Rata-rata =+ + + + + +8( )1 11 ( )2 12 ( )1 13 ( )1 14 ( )1 15 ( )1 16 ( )1 19=1128= 14Jadi, rata-rata data tersebut adalah 14.Contoh 2:Berikut adalah data hasil ulangan Matematika Kelas VIB.7 orang mendapat nilai 68 orang mendapat nilai 75 orang mendapat nilai 85 orang mendapat nilai 9Susunlah data tersebut dalam tabel. Kemudian, tentukan rata-ratanya.Jawab:Nilai Banyak Siswa Jumlah Nilai Data6 7 6 × 7 = 427 8 7 × 8 = 568 5 8 × 5 = 409 5 9 × 5 = 45Jumlah 30 183Rata-rata =jumluu ahnilai daa atabanyakyy siswaww=18330= 6,1Jadi, rata-rata nilai ulangan Matematika di kelas tersebut adalah 6,1.Contoh 3:Nilai ulangan harian pelajaran Matematika yang diperolehRiani adalah 7, 6, 5, 8, 9.Nilai pada rapor merupakan rata-rata dari nilai ulangan harian. Berapakahnilai Matematika Riani pada rapor?
  • 129. 128Ayo, kerjakan di buku latihanmu.1. Tentukanlah rata-rata dari data berikut.a. 5, 6, 7, 9, 8 c. 15, 32, 46, 79, 28, 35, 55, 90b. 2, 4, 6, 9, 9, 10, 92. Keluarga Pak Budi terdiri atas bapak, ibu, dan dua anak. Mereka semuaadalah pekerja dengan penghasilan per bulan. Penghasilan mereka berturut-turut adalah Rp1.800.000,00; Rp1.000.000,00; Rp850.000,00; dan Rp550.000,00.Berapakah penghasilan rata-rata keluarga Pak Budi?3. Data nilai Sains dari 10 siswa putri adalah sebagai berikut.90 85 85 80 70 90 80 65 90 70a. Berapakah nilai rata-rata Sains dari 10 siswa putri tersebut?b. Berapakah nilai yang paling sering mereka dapatkan?4. Rata-rata nilai olahraga 10 siswa putra adalah 80. Jika nilai olahraga Badudigabung dengan seluruh siswa putra tersebut, rata-ratanya menjadi 85. Berapa-kah nilai olahraga Badu?Ayo, Berlatih 10Jawab:Nilai pada rapor = rata-rata dari data tersebut=Jumlah databanyak data=7 6 5 8 95+ +5 85=355= 7Jadi, nilai Matematika Riani di rapor adalah 7.3. MenentukanModusSediakan sebuah dadu dan tempat kocokannya. Kocok dadu tersebut,kemudianlemparkan.Catatmatadaduyangkeluar.Lakukanhalinisebanyak15 kali. Misalnya dari 15 kali lemparan diperoleh data berikut.1, 3, 2, 5, 6, 4, 3, 1, 5, 6, 2, 4, 1, 1, 1.Amati hasil pelemparan mata dadu tersebut. Berapa kali mata dadu 2muncul (keluar)? Mata dadu apakah yang paling banyak muncul?Dari data tersebut tampak mata dadu 1 muncul 5 kali, mata dadu 2muncul 2 kali, mata dadu 3 muncul 2 kali, mata dadu 6 muncul 2 kali.Darihasilinitampakmatadadu1palingbanyakmuncul.Datayangpalingbanyak muncul disebut modus. Jadi, modus dari data tersebut adalah 1.Modus adalah data yang paling banyak munculContoh:Tentukan modus dari data berikut.a. 2, 3, 4, 5, 5, 6, 6, 7, 8, 8, 8, 9 c. 42, 29, 11, 27, 28b. 12, 18, 5, 17, 3, 5, 2, 10, 12
  • 130. 1291. Data terbesar disebut nilai tertinggi dan data terkecil disebut nilaiterendah.2. Rata-rata dari sekumpulan data dapat diperoleh dengan rumus berikut.Rata-rata =Jumlah semua nilai databanyak data3. Modus ialah data yang paling banyak muncul.Adakah materi lain dalam buku ini yang dapat kamu rangkum? Cobalahkamu tuliskan di buku latihanmu.Ayo, MerangkumJawab:a. Amati setiap data tersebut dan tandai nilai-nilai yang berulang.Kemudian, pilih nilai yang paling banyak berulang (muncul)2, 3, 4, 5 , 5 , 6 , 6 , 7, 8 , 8 , 8 , 9Angka 5 dan 6 muncul 2 kali. Angka 8 muncul 3 kaliJadi, modus dari data tersebut adalah 8.b. 12, 18, 5 , 17, 3, 5 , 2, 10, 12Angka 5 muncul 2 kali. Angka 12 muncul 2 kaliJadi, modus dari data tersebut adalah 5 dan 12.c. 42, 29, 11, 27, 28Setiap data tersebut tidak ada yang berulang.Jadi, data tersebut tidak memiliki modus.Ayo, kerjakan di buku latihanmu.1. Tentukanlah modus dari data berikut.a. 7, 8, 6, 4, 3, 2, 1, 7, 6, 7 c. 1, 2, 3, 4, 5, 6, 6, 5, 4, 6, 5, 3b. 23, 26, 27, 21, 22, 24, 26, 25, 26, 26 d. 78, 79, 40, 41, 48, 492. Selesaikan soal berikut.a. Seorang pemilik toko mencatat nomor sepatu yang terjual pada bulanJanuari sebagai berikut.33, 32, 31, 29, 28, 27, 31, 32, 33, 34, 35, 36, 37, 3839, 40, 41, 42, 33, 32, 33, 34, 33, 36, 33, 42, 33.Sepatu dengan nomor berapa yang paling banyak terjual?Sepatu dengan nomor berapa yang kurang laku?Sepatu dengan nomor berapakah yang harus diperbanyak persediaannyaoleh pemilik toko?b. Modus dari 10 data ulangan matematika ada 7. Buatlah ke-10 data tersebutyang mungkin.c. Buatlah 10 data apa saja yang memiliki 1 modus.d. Buatlah 15 data apa saja yang tidak memiliki modus.Ayo, Berlatih 11
  • 131. 130Peta Penuntun BelajarPengolahanDataMembaca danMenyajikanDataUkuran Datamempelajariterdiri atasTabelDiagramBatangDiagramGarisDiagramLingkaranterdiri atasDataTertinggiDataTerendahRata-rata ModusMateri Pokok : Pengolahan DataCatatlah harga nilai tukar dolar selama 1 bulan tertentu (misal Juli). Kamu dapatmemperolehnya di televisi atau koran. Kemudian, buatlah diagram garisnya.Dari diagram garis yang kamu peroleh, tentukanlah:a. Pada hari apakah nilai tukar dolar terendah?b. Bagaimana kecenderungan nilai tukar dolar, apakah semakin naik ataumenurun?c. Menurutmu, apakah nilai tukar dolar untuk bulan berikutnya menurunatau naik? Berikan laporannya.Proyek Siswa Semester 2Apakah Kamu Sudah Paham?Setelah kamu mempelajari materi pengolahan data, adakah yang belumkamu pahami? Bagian mana yang masih belum kamu pahami? Diskusikanlahbersama teman dan gurumu.
  • 132. 131A. Ayo, isititik-titikberikutdenganjawabanyangbenar.1. Pada diagram batang, tinggi batangmenunjukkan ....Gunakan diagram berikut untuk men-jawab soal nomor 2–5.33SuhuBadan°C3410.003511.00 12.0013.003637WaktuSuhu Badan Pasien2. Suhu badan pasien pada pukul11.00 adalah ....Uji Pemahaman Bab 83. Pada pukul ... suhu badan pasientertinggi.4. Suhu badan pasien 34°C terjadipada pukul ....5. Buatlahdiagrambatangdaridiagramgaris tersebut.6. Nilai terendah dari 4, 7, 7, 9, 8, 3, 2, 6,4 berikut adalah ....7. Nilai tertinggi dari data 11, 13, 15,11, 14, 18, 19, 11, 12, 21 adalah ....8. Modus dari data berikut adalah ....2, 2, 3, 4, 5, 7, 8, 4, 9, 10, 49. Rata-rata dari data 2, 4, 6, 8, 10, 12adalah ....10. Modus dari data 3, 7, 6, 3, 7, 5, 5, 10adalah ….B. Ayo, kerjakan soal-soal berikut ini.1. Jelaskanlah cara menyajikan datadalam bentuk diagram batang.2. Jelaskanlah cara menyajikan datadalam bentuk diagram garis.3. Jelaskanlah cara menyajikan datadalam bentuk diagram lingkaran.4. Soal terbukaBuatlah data yang rata-ratanya 14.
  • 133. 132A. Ayo, kerjakan di buku latihanmu.1. Bentuk paling sederhana daripecahan2575adalah ….2. Pecahan yang lebih besar dari12dan lebih kecil dari34adalah ….3. Urutan pecahan13,18, dan15dariyang terkecil adalah ….4. Bentuk desimal dari pecahan35adalah ….5. Nilai suatu pecahan desimal adalah0,125. Jika ditulis dalam bentukpecahan biasa adalah ….6. Banyak siswa di Kelas VI ada 40.Banyak siswa laki-lakinya14darijumlah seluruh siswa. Banyak siswaperempuan di kelas tersebut ada ….7.23+58= …8. 112×48= ...9. 0,3 × 0,27 = ...Uji Pemahaman Semester 210.34: 118= …11. 6,625 : 0,025 = …12.25+ 0,4 ×20100= …13. Pada sebuah peta tertera skala1 : 200.000. Arti dari skala tersebutadalah ….14. Diketahui data berikut.5, 6, 7, 7, 6, 6, 8, 8, 5, 6Nilai rata-rata dan modus dari datatersebut adalah … dan ….15. Berikut ini adalah data jenis-jenisolahraga yang disukai oleh 40 siswaKelas VI SD Bungaran.SenamRenang10%Voli20%Sepakbola25%Basket30%Banyaksiswayangmenyukaisenamada … siswa.B. Ayo, selesaikan soal dibawah ini.1. Jelaskan dengan kata-katamu caramengurutkan pecahan dari yangterkecil.2. Gambarkantitik-titikberikutdalamkoordinat Cartesius.a. A (3, 6) c. C (6, 7)b. B (4, 8) d. D (4, 4)3. Banyak penduduk berdasarkanjenis pekerjaannya di suatu daerahsebagai berikut.No. Pekerjaan Banyaknya1.2.3.petanipedagangkaryawan204060120Jumlaha. Sajikan data tersebut dalamdiagram lingkaran.b. Sajikan data tersebut dalamdiagram batang.
  • 134. 133A. Ayo, pilih salah satu jawaban yangpaling tepat.1. 425 × (–12) – 40 : 5 = ...2. FPB dan KPK dari 24, 36, dan 48adalah ….3. Petugas siskamling berada di 3 posronda. Mereka memukul kentongansecara bersamaan pada pukul 19.30.Selanjutnya, petugas pos rondaA memukul kentongan setiap 15menit. Pos ronda B setiap 30 menitdan pos ronda C setiap 45 menit.Mereka memukul kentongan secarabersamaan untuk kedua kalinyapada pukul ....4. Sebuah bak mandi berbentuk kubusdengan volume 1.331 dm3. Panjangsisi bak mandi tersebut adalah ....5. 3,2m3/detik+2.200L/detik=...L/detik6. Pada sebuah pesta disajikan 6 tabunges krim. Diameter tiap tabung 20 cmdan tingginya 0,5 m. Banyaknya eskrim yang disajikan adalah ... liter.7. Sepotong kayu berbentuk segitigasama sisi dengan luas alas 60 cmdan volume 4.500 cm3. Panjang kayutersebut adalah ....8. Luas sebidang kebun berbentukpersegi 3.025 m2. Keliling kebuntersebut ....9. Perbandingan kelereng Farhan dankelereng Adit adalah 3 : 7. Jika jumlahkelereng mereka 40 butir makajumlah kelereng Adit adalah ... butir.10. Jarak Jakarta Bandung pada peta10 cm, jarak sesungguhnya 180 km.Skala peta adalah ....11. 116538+ = ...12. Astridmembeli4,2meterkainpolos,212meter kain motif bunga dan34meter kain motif kotak. Setelahdigunakan sisa kainnya menjadi0,7 meter. Kain yang digunakan ...meter.13. Perhatikan tabel data hasil penim-bangan berat badan berikut.No BanyaknyaSiswaBerat Badan(kg)1. 6 502. 8 403. 12 254. 24 20Rata-rata berat badan siswa … kg.14. Tentukan modus dari data berikut.a. 2, 4, 6, 9, 9, 10, 9b. 15, 32, 46, 79, 28, 35, 55, 9015. Diagram batang berikut menunjuk-kan banyaknya siswa perempuanKelas I sampai dengan VI.51015202530I II III IV V VISelisih jumlah siswa perempuanKelas IV dan Kelas VI adalah …siswa.Uji Pemahaman Akhir Tahun
  • 135. 134B. Ayo, kerjakan soal-soal berikut ini.1. Sebuah tempat sampah berbentukkubus dengan sisi 1 m. Ellyas inginmembuangdus-dusyangberbentukkubus dengan sisi 25 cm. Tentukanjumlah dus yang dapat dimasukkandalam tempat sampah tersebut.2. Sebuah bus sedang diisi bensindengan menggunakan selang. Ji-ka waktu yang diperlukan untukmengisi 80 L bensin adalah 2 menit,tentukan debit bensin pada selang.3. Umur Dewi 2 : 3 umur Yuni. Jumlahumur mereka 20 tahun. Berapaumur mereka masing-masing?4. Diketahui jarak antara Jakarta danBandungpada peta10cm.Jikajaraksesungguhnya 180 km, tentukanlahskala pada peta.5. Amir mempunyai 2 buah novel.Novel pertama terdiri atas 260halaman dan novel kedua terdiriatas 320 halaman. Iatelahmembaca25bagian dari novel pertama dan58bagian dari novel kedua. Tentukanjumlah halaman novel yang telah iabaca.6. Tentukan luas bangun berikut.6 cm12 cm11 cm10 cm22 cm7. Umur Anisa berbanding umur Miki2 : 3, umur Miki berbanding umurFahri 2 : 5. Jika umur Miki 12 tahun,umur Anisa dan Fahri masing-masing adalah ....8. Tentukan luas bangun berikut.22 cm16 cm7 cm9. Data penjualan telur seorang pe-dagang selama satu minggu sebagaiberikut:No Hari Banyak telur (kg)1. Senin 802. Selasa 653. Rabu 1004. Kamis 755. Jumat 906. Sabtu 70Jumlah …a. Berapa rata-rata penjual telurtiap harinya?b. Gambar data tersebut dalamdiagram batang.10. Diagram berikut ini menunjukkanpersentase dari banyaknya siswayang mengikuti ekstrakurikuler disekolah.PramukaPaskibraPMR30%35%PKSJumlah siswa adalah 240 orang.Tentukan banyak siswa yang meng-ikuti tiap ekstrakurikuler.
  • 136. 135Kunci JawabanUji Pemahaman Bab 1 halaman 16A.1. 183. –2245. 77. 2439. 2.310B.3. 60 cm5. 1 Juli 2008Uji Pemahaman Bab 2 halaman 24A.1. dalam waktu 1 detik, air yang keluar atau mengaliradalah 5 L3. 32 L/detik5. Debit air pada pipa A7. 79. 6B.5. pipa BUji Pemahaman Bab 3 halaman 37A.1. 2 segitiga siku-siku dan 1 persegipanjang3. B5. 148 cm27. 88 cm9. 38,5 cm2B.1. 280 cm23. 336 cm2Uji Pemahaman Bab 4 halaman 47A.1.123. 1.548 cm35. 7 cm7. 8.792 cm39. 2.310 cm3= 2,31 literB.3. 15 cm5. 4 cmUji Pemahaman Bab 5 halaman 62A.1. Pencatatan langsung dan mengisi lembar isian3. 3 orang5. 64 siswa7. hitam9. unguB.1. a. 55 siswac. 13 orang5. a. 38 siswac. 2 orangUji Pemahaman Semester 1 halaman 64A.1. 8 dan –83. 45. 97. 10.750 cm29. 525 mL11. 5113. kuning15. kuningB.1. detik ke-203. 38,5 m2Uji Pemahaman Bab 6 halaman 96A.1.143. 0,95.17107.149.12B.5. 5 kmUji Pemahaman Bab 7 halaman 1061. Ajeng3. Sudirman5. 29. Sumbu vertikal/ordinatB.1. 6Uji Pemahaman Bab 8 halaman 131A.1. Banyak data3. 13.007. 219. 7Uji Pemahaman Semester 2 halaman 132A.1.133.18,15,135.18
  • 137. 136Bilangan bulat: bilangan yang terdiriatas bilangan cacah dan bilangannegatif ................................................. 1Debit: volume air yang mengalir dalamsatuan waktu ..................................... 17Denah: gambar yang menunjukkan letakkota, jalan, dan sebagainya ............ 98Diameter: garis yang membagi lingkaranmenjadi dua bagian sama besar .. 29Faktor: bilangan yang dapat membagihabis bilangan asli ........................ 12Faktorisasi prima: menguraikan bilanganmenjadi faktor-faktor prima .…... 12Luas: jumlah dari total permukaansuatu bangun atau benda ........... 25Peta: gambar atau lukisan pada kertasdan sebagainya yang menunjukkanletak tanah, laut, sungai, gunung,dan sebagainya ........................…... 94Rusuk: garis atau ruas garis yangmerupakan perpotongan dua sisibangun ruang .............................…... 7Turus: perhitungan jumlah denganmenggunakan tanda garis lurusatau miring ...................................... 55Daftar Istilah7.31241724=9. 0,08111. 26513. 1 cm pada gambar mewakili 200.000 cm padapeta15. 6Uji Pemahaman Akhir Tahun halaman 133A.1. –5.1083. 21.005. 5.4007. 150 cm9. 2811. 6132413. 2815. 11B.1. 64 dus3. Umur Dewi 8 tahun dan umur Yuni 12 tahun5. 304 halaman7. Umur Anisa 8 tahun dan umur Fahri 30 tahun9. a. 80 telur
  • 138. 137IndeksBBangun datar 25, 36DData 45, 46, 47, 48, 49, 51, 50, 52, 53, 54,55, 57, 58, 59, 61, 62, 63, 70, 97, 98, 99,107, 108, 109, 110, 113, 115, 117, 118,121, 122, 123, 125, 127, 128, 129, 130,134, 136Debit 15, 16, 17, 18, 19, 20, 21, 22, 23, 24,46, 56, 64, 120, 121, 135, 136Diagram batang 61, 113, 115, 130Diagram lingkaran 59, 122, 123, 125, 131,132JJari-jari 29, 30, 31, 32, 33, 34, 35, 43, 44,46KKeliling 29, 30, 31, 32, 33, 34, 38, 46, 48,64, 74, 133, 136Kubik 1, 7, 8, 46, 136Kubus 7, 8, 9, 10, 16, 21, 39, 64, 136LLingkaran 25, 29, 32, 34, 36, 39, 43, 59,61, 64, 107, 122, 123, 124, 125, 131,132, 136Luas 40, 41, 42, 43, 45, 47, 48, 64, 76, 77,88, 89, 90, 106MModus 107, 128, 129, 132PPangkat 1, 6, 8, 9, 10, 11, 16, 136Pecahan 30, 65, 66, 68, 69, 70, 71, 72, 73,74, 75, 76, 78, 79, 82, 83, 84, 85, 87,88, 90, 91, 93, 95, 96, 108, 132Peta 15, 24, 36, 47, 62, 64, 95, 130, 136Prisma 39, 40, 41, 47, 48, 64, 136
  • 139. 138BNSP. 2006. Standar Kompetensi dan Kompetensi Dasar 2006 Matematika SekolahDasar dan Madrasah Ibtidaiyah. Jakarta: Departemen Pendidikan Nasional.KengSeng,ThedanLooiChinKeong.2001.NewSyllabusDMathematics2.Singapura:Shinglee.Ling, Angela Tiu Ting. 2002. Primary Mathematics Intensive Practice. Singapura:Novel Learning Centre.McLeod, John K., et al 1990. Mathematics for Australian School Year 7. Melbourne:Mac millan.National Councils of Teachers of Mathematics. 2000. Principles and Standards forSchool Mathematics. Reston, VA: Author.Nelson, Bennet. 2004. Mathematics for Elementary Teachers. River Upper Saddle: McGraw Hill.Primalani, Varsha., et al. 2004. In Step Maths. Singapura: SNP Panpac.Sumber Lain:Dokumentasi Penerbithttp://farm1.static.flickr.comwww.rumahdijual.comhttp://egita-cakes.comwww.usaid.comwww.pikiran-rakyat.comwww.first-to-fly.comhttp://kmpk.forum-posyandu.orgDaftar Pustaka