LaTeX: More Than Just Academic Papers and Theses

Introduction Document Types Special Material Wrapping Up LTEX: More Than Just Academic Papers and Theses A L Lian Tze liantze@gmail.com http://liantze.penguinattack.org/ cbna Malaysian Open Source ConferenceL Lian Tze | /

Introduction Document Types Special Material Wrapping UpContents What are TEX, LTEX and Friends? A Document Types Special Material Wrapping UpL Lian Tze | /

Introduction Document Types Special Material Wrapping UpWhat are TEX and LTEX, and Friends? A TEX ASCII TeX, /tEx/, /tEk/ A computer typesetting system created by Donald Knuth for ‘the creation of beautiful books’ LTEX A ASCII LaTeX, /"leItEx/, /"leItEk/, /"lA:tEx/, /"lA:tEk/ A document preparation system by Leslie Lamport Binaries ��-TEX: additional primitives to TEX pdfTEX: additional PDF-related primitives XETEX: native UTF- input; can access system fonts LuaTEX: includes the Lua scripting engine Friends BIBTEX, MakeIndex, METAFONT, METAPOST, . . . http://www.ctan.org/what_is_tex.htmlL Lian Tze | /

Introduction Document Types Special Material Wrapping UpWhy?From http://www.ctan.org/what_is_tex.html Output Quality Freedom It has the best output. It’s free. It knows typesetting. It runs anywhere. Superior Engineering Popularity It’s fast. It’s the standard (in It’s stable. academia and science). It’s not rigid (extensible). Plain text input. Many output types.L Lian Tze | /

Introduction Document Types Special Material Wrapping UpWhere Would I Want to Use LTEX? A Documents with complex structures Lots of mathematics (or other speci c needs) When publishers require them Batch processing Back-end of other applicationsL Lian Tze | /

Introduction Document Types Special Material Wrapping UpHow Do I Use It? Write a plain text LTEX le (.tex) A Run it through pdflatex or xelatex → PDF output (or latex + dvips + ps2pdf for DVI + PS + PDF) Run bibtex and/or makeindex to process bibliographies, indices Re-run pdflatex to resolve references and pointersL Lian Tze | /

Introduction Document Types Special Material Wrapping UpExample .tex File documentclass[a4paper,11pt]{article} An Introductory Paper author{Lim Lian Tze} Lim Lian Tze title{An Introductory Paper} June 7, 2011 date{today} usepackage[english]{babel} Contents 1 Introduction 1 begin{document} 2 State of the Art 1 maketitle 2.1 Document Formats . . . . . . . . . . . . . . . . . . . . . . . . 1 tableofcontents Abstract pdflatex This paper introduces. . . begin{abstract} This paper introducesldots 1 Introduction end{abstract} We consider. . . section{Introduction} 2 State of the Art We considerldots We look at. . . 2.1 Document Formats section{State of the Art} There are many. . . We look atldots subsection{Document Formats} There are manyldots 1 end{document}L Lian Tze | /

Introduction Document Types Special Material Wrapping UpWhere Do I Get It? Windows MiKTEX, TEXLive Un*x, GNU/Linux TEXLive Mac OS X MacTEX (based on TEXLive) Installation Use your OS’ package manager (or download manually) Editors vi, emacs, Texmaker, TeXworks, . . . LTEX Packages Use MiKTEX or TEXLive’s package manager A Documentation (TEXLive) $ texdoc <package name> (MiKTEX) $ mthelp <package name>L Lian Tze | /

Introduction Document Types Special Material Wrapping UpEasy to Learn, Hard to Master Customising may not be straightforward (vs word processors) Intentionally so: Style guidelines should be followed strictly Publisher/organisation provides document class or style les Use these to take care of formatting and styling, focus on the content Fair enough. But where do I learn all the stu the TEXnicians and TEXperts do? (There is a learning curve)L Lian Tze | /

Introduction Document Types Special Material Wrapping UpGetting Help Many free tutorials and e-books on the Web (beware of obsolete ones!) Getting to Grips with LTEX. Andy Roberts. A http://www.andy-roberts.net/misc/latex/ LTEX: Beautiful Typesetting. Lim Lian Tze. A http://liantze.penguinattack.org/latextypesetting.html LTEX and Friends. M.R.C. van Dongen. A http://csweb.ucc.ie/~dongen/LaTeX-and-Friends.pdf The LTEX WikiBook. A http://en.wikibooks.org/wiki/LaTeX Questions? TEX FAQ. http://www.tex.ac.uk/cgi-bin/texfaq2html TEX.SX. http://tex.stackexchange.com/ comp.text.tex usenet group Malaysian LTEX User Group. http://latex-my.blogspot.com/ A Arrange for trainingL Lian Tze | /

Introduction Document Types Special Material Wrapping Up So, What Can LTEX Do? AL Lian Tze | /

Introduction Document Types Special Material Wrapping UpBasic Types Books Chapter 1 Heading on level 0 (chapter) Hello, here is some text without a meaning. This text should show, how a printed text will look like at this place. If you read this text, you will get no A Wonderful Read information. Really? Is there no information? Is there a difference between documentclass{book} A. Dummy this text and some nonsense like »Huardest gefburn«. Kjift – Never mind! A blind text like this gives you information about the selected font, how the letters are written and the impression of the look. This text should contain all letters of the alphabet and it should be written in of the original language. There is no need for a special contents, but the length of words should match 3rd June 2011 to the language. author{...} 1.1 Heading on level 1 (section) Hello, here is some text without a meaning. This text should show, how a printed text will look like at this place. If you read this text, you will get no information. Really? Is there no information? Is there a difference between this text and some nonsense like »Huardest gefburn«. Kjift – Never mind! title{...} A blind text like this gives you information about the selected font, how the letters are written and the impression of the look. This text should contain all letters of the alphabet and it should be written in of the original language. There is no need for a special contents, but the length of words should match to the language. 1.1.1 Heading on level 2 (subsection) Hello, here is some text without a meaning. This text should show, how a printed text will look like at this place. If you read this text, you will get no information. Really? Is there no information? Is there a difference between 3 begin{document} maketitle 4 CHAPTER 1. HEADING ON LEVEL 0 (CHAPTER) 1.2. LISTS 5 chapter{...} this text and some nonsense like »Huardest gefburn«. Kjift – Never mind! A blind text like this gives you information about the selected font, how the letters are written and the impression of the look. This text should contain Example for list (4*itemize) • First item in a list all letters of the alphabet and it should be written in of the original language. There is no need for a special contents, but the length of words should match – First item in a list to the language. ∗ First item in a list section{...} Heading on level 3 (subsubsection) Hello, here is some text without a meaning. This text should show, how a printed text will look like at this place. If you read this text, you will get no · First item in a list · Second item in a list ∗ Second item in a list information. Really? Is there no information? Is there a difference between – Second item in a list this text and some nonsense like »Huardest gefburn«. Kjift – Never mind! ... A blind text like this gives you information about the selected font, how the • Second item in a list letters are written and the impression of the look. This text should contain all letters of the alphabet and it should be written in of the original language. There is no need for a special contents, but the length of words should match 1.2.2 Example for list (enumerate) to the language. 1. First item in a list Heading on level 4 (paragraph) Hello, here is some text without a 2. Second item in a list subsection{...} meaning. This text should show, how a printed text will look like at this place. If you read this text, you will get no information. Really? Is there no information? Is there a difference between this text and some nonsense like »Huardest gefburn«. Kjift – Never mind! A blind text like this gives you information about the selected font, how the letters are written and the 3. Third item in a list 4. Fourth item in a list impression of the look. This text should contain all letters of the alphabet 5. Fifth item in a list and it should be written in of the original language. There is no need for a end{document} special contents, but the length of words should match to the language. 1.2 Lists Example for list (4*enumerate) 1. First item in a list 1.2.1 Example for list (itemize) (a) First item in a list i. First item in a list • First item in a list A. First item in a list • Second item in a list B. Second item in a list • Third item in a list ii. Second item in a list • Fourth item in a list (b) Second item in a list • Fifth item in a list 2. Second item in a listL Lian Tze | /

Introduction Document Types Special Material Wrapping UpBasic Types (cont’d) A blind text like this gives you information about the selected font, how the letters are written and the impression of the look. This text should contain all letters of the alphabet and it should be written in of the original language. A Wonderful Read There is no need for a special contents, but the length of words should match to the language. Articles A. Dummy 3rd June 2011 Heading on level 4 (paragraph) Hello, here is some text without a meaning. This text should show, how a printed text will look like at this place. If you read this text, you will get no information. Really? Is there no information? Is there a difference between this text and some nonsense like »Huardest gefburn«. Kjift – Never mind! A blind text like this gives 1 Heading on level 1 (section) you information about the selected font, how the letters are written and the impression of the look. This text should contain all letters of the alphabet Hello, here is some text without a meaning. This text should show, how a and it should be written in of the original language. There is no need for a printed text will look like at this place. If you read this text, you will get no special contents, but the length of words should match to the language. information. Really? Is there no information? Is there a difference between this text and some nonsense like »Huardest gefburn«. Kjift – Never mind! A blind text like this gives you information about the selected font, how the 2 Lists letters are written and the impression of the look. This text should contain documentclass{article} all letters of the alphabet and it should be written in of the original language. There is no need for a special contents, but the length of words should match to the language. 2.1 Example for list (itemize) • First item in a list • Second item in a list 1.1 Heading on level 2 (subsection) • Third item in a list Hello, here is some text without a meaning. This text should show, how a • Fourth item in a list author{...} printed text will look like at this place. If you read this text, you will get no information. Really? Is there no information? Is there a difference between this text and some nonsense like »Huardest gefburn«. Kjift – Never mind! A blind text like this gives you information about the selected font, how the letters are written and the impression of the look. This text should contain • Fifth item in a list 2.1.1 Example for list (4*itemize) • First item in a list all letters of the alphabet and it should be written in of the original language. There is no need for a special contents, but the length of words should match – First item in a list title{...} to the language. 1.1.1 Heading on level 3 (subsubsection) Hello, here is some text without a meaning. This text should show, how a ∗ First item in a list · First item in a list · Second item in a list ∗ Second item in a list printed text will look like at this place. If you read this text, you will get no – Second item in a list information. Really? Is there no information? Is there a difference between this text and some nonsense like »Huardest gefburn«. Kjift – Never mind! • Second item in a list 1 2 begin{document} maketitle 2.2 Example for list (enumerate) Second item in a list 1. First item in a list Second item in a list section{...} 2. Second item in a list 3. Third item in a list Second item in a list Second item in a list 4. Fourth item in a list 5. Fifth item in a list ... 2.2.1 Example for list (4*enumerate) 1. First item in a list (a) First item in a list i. First item in a list subsection{...} A. First item in a list B. Second item in a list ii. Second item in a list (b) Second item in a list 2. Second item in a list end{document} 2.3 Example for list (description) First item in a list Second item in a list Third item in a list Fourth item in a list Fifth item in a list 2.3.1 Example for list (4*description) First item in a list First item in a list First item in a list First item in a list 3 4L Lian Tze | /

Introduction Document Types Special Material Wrapping UpJournal and Conference Proceedings ArticlesIEEE ACM LLNCSdocumentclass{IEEEtran} documentclass{sig-alternate} documentclass{llncs} 1 A Wonderful Read A Wonderful Read A. Dummy A. Dummy A Wonderful Read Abstract—Hello, here is some text without a meaning. 1) Heading on level 3 (subsubsection): Hello, A. Dummy This text should show, how a printed text will look like here is some text without a meaning. This text at this place. If you read this text, you will get no should show, how a printed text will look like No Institute Given information. Really? Is there no information? Is there at this place. If you read this text, you will get a difference between this text and some nonsense like no information. Really? Is there no information? ABSTRACT show, how a printed text will look like at this place. If you read »Huardest gefburn«. Kjift – Never mind! A blind text like this text, you will get no information. Really? Is there no infor- this gives you information about the selected font, how the Is there a difference between this text and some Hello, here is some text without a meaning. This text should show, mation? Is there a difference between this text and some nonsense Abstract Hello, here is some text without a meaning. This text should how a printed text will look like at this place. If you read this letters are written and the impression of the look. This text nonsense like »Huardest gefburn«. Kjift – Never text, you will get no information. Really? Is there no informa- like »Huardest gefburn«. Kjift – Never mind! A blind text like this show, how a printed text will look like at this place. If you read this text, should contain all letters of the alphabet and it should be you will get no information. Really? Is there no information? Is there a mind! A blind text like this gives you information tion? Is there a difference between this text and some nonsense gives you information about the selected font, how the letters are written in of the original language. There is no need for written and the impression of the look. This text should contain difference between this text and some nonsense like »Huardest gefburn«. about the selected font, how the letters are written like »Huardest gefburn«. Kjift – Never mind! A blind text like this all letters of the alphabet and it should be written in of the original Kjift – Never mind! A blind text like this gives you information about a special contents, but the length of words should match gives you information about the selected font, how the letters are and the impression of the look. This text should language. There is no need for a special contents, but the length of the selected font, how the letters are written and the impression of the to the language. written and the impression of the look. This text should contain contain all letters of the alphabet and it should be all letters of the alphabet and it should be written in of the original words should match to the language. look. This text should contain all letters of the alphabet and it should be written in of the original language. There is no need for a special written in of the original language. There is no need language. There is no need for a special contents, but the length of words should match to the language. Heading on level 4 (paragraph). contents, but the length of words should match to the language. I. H EADING ON LEVEL 1 ( SECTION ) for a special contents, but the length of words should Hello, here is some text without a meaning. This text should match to the language. show, how a printed text will look like at this place. If you read Hello, here is some text without a meaning. This 1. Heading on level 1 (SECTION) this text, you will get no information. Really? Is there no infor- a) Heading on level 4 (paragraph): Hello, Hello, here is some text without a meaning. This text should mation? Is there a difference between this text and some nonsense text should show, how a printed text will look like here is some text without a meaning. This text show, how a printed text will look like at this place. If you read like »Huardest gefburn«. Kjift – Never mind! A blind text like this at this place. If you read this text, you will get should show, how a printed text will look like this text, you will get no information. Really? Is there no infor- gives you information about the selected font, how the letters are 1 Heading on level 1 (section) no information. Really? Is there no information? mation? Is there a difference between this text and some nonsense written and the impression of the look. This text should contain at this place. If you read this text, you will get Is there a difference between this text and some like »Huardest gefburn«. Kjift – Never mind! A blind text like this all letters of the alphabet and it should be written in of the original Hello, here is some text without a meaning. This text should show, no information. Really? Is there no information? gives you information about the selected font, how the letters are language. There is no need for a special contents, but the length of nonsense like »Huardest gefburn«. Kjift – Never Is there a difference between this text and some written and the impression of the look. This text should contain words should match to the language. how a printed text will look like at this place. If you read this text, mind! A blind text like this gives you information nonsense like »Huardest gefburn«. Kjift – Never all letters of the alphabet and it should be written in of the original you will get no information. Really? Is there no information? Is there language. There is no need for a special contents, but the length of a difference between this text and some nonsense like »Huardest about the selected font, how the letters are written mind! A blind text like this gives you information words should match to the language. 2. Lists and the impression of the look. This text should about the selected font, how the letters are written gefburn«. Kjift – Never mind! A blind text like this gives you infor- 1.1 Heading on level 2 (subsection) 2.1 Example for list (itemize) mation about the selected font, how the letters are written and the contain all letters of the alphabet and it should be and the impression of the look. This text should Hello, here is some text without a meaning. This text should impression of the look. This text should contain all letters of the al- written in of the original language. There is no need contain all letters of the alphabet and it should be show, how a printed text will look like at this place. If you read • First item in a list for a special contents, but the length of words should written in of the original language. There is no need this text, you will get no information. Really? Is there no infor- phabet and it should be written in of the original language. There is • Second item in a list match to the language. for a special contents, but the length of words should mation? Is there a difference between this text and some nonsense no need for a special contents, but the length of words should match like »Huardest gefburn«. Kjift – Never mind! A blind text like this • Third item in a list match to the language. gives you information about the selected font, how the letters are to the language. written and the impression of the look. This text should contain • Fourth item in a list A. Heading on level 2 (subsection) all letters of the alphabet and it should be written in of the original II. L ISTS language. There is no need for a special contents, but the length of • Fifth item in a list 1.1 Heading on level 2 (subsection) Hello, here is some text without a meaning. This words should match to the language. text should show, how a printed text will look like A. Example for list (itemize) 2.1.1 Example for list (4*itemize) Hello, here is some text without a meaning. This text should show, at this place. If you read this text, you will get 1.1.1 Heading on level 3 (subsubsection) how a printed text will look like at this place. If you read this text, • First item in a list Hello, here is some text without a meaning. This text should • First item in a list no information. Really? Is there no information? • Second item in a list you will get no information. Really? Is there no information? Is there Is there a difference between this text and some • Third item in a list – First item in a list a difference between this text and some nonsense like »Huardest nonsense like »Huardest gefburn«. Kjift – Never • Fourth item in a list ∗ First item in a list gefburn«. Kjift – Never mind! A blind text like this gives you infor- Permission to make digital or hard copies of all or part of this work for · First item in a list mind! A blind text like this gives you information • Fifth item in a list personal or classroom use is granted without fee provided that copies are mation about the selected font, how the letters are written and the about the selected font, how the letters are written not made or distributed for profit or commercial advantage and that copies · Second item in a list 1) Example for list (4*itemize): bear this notice and the full citation on the first page. To copy otherwise, to ∗ Second item in a list and the impression of the look. This text should republish, to post on servers or to redistribute to lists, requires prior specific • First item in a list – Second item in a list contain all letters of the alphabet and it should be permission and/or a fee. written in of the original language. There is no need – First item in a list MOSC 2011, July 3–5, 2011, Penang, Malaysia. • Second item in a list Copyright 2011 ACM 123-4-56789-012-3/11/0007 ...$10.00. for a special contents, but the length of words should ∗ First item in a list match to the language. · First item in a listL Lian Tze | /

Introduction Document Types Special Material Wrapping UpSome Goodies Quick language-switching with babel Automatic generation of cross-referencing labels: section{Introduction}label{sec:intro} ... We saw in section ref{sec:intro}... Automatic generation of lists: tableofcontents, listoffigures, listoftables Automatic generation of bibliographies and indices: cite{Knuth:1976}...bibliography{references.bib} ...the Linux kernelindex{Linux!kernel}... printindex Fully hyperlinked PDF with bookmarks: usepackage{hyperref} Inclusion of selected pages from other PDFs (while inserting new page headers/footers!) usepackage{pdfpages} includepdf[pages={1,3-5,8},pagecommand=thispagestyle{plain}]{file.pdf}L Lian Tze | /

Introduction Document Types Special Material Wrapping UpUniversity ThesesUniversiti Sains Malaysia documentclass{usmthesis} TABLE OF CONTENTS REFERENCES CHAPTER 1 Acknowledgements. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . ii WRITING YOUR THESIS WITH LATEX Table of Contents . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . iii INTRODUCTION: SAMPLES OF BASIC LTEX A COMMANDS Changsheng, X., Wang, J., Lu, L. and Zhang, Y. (2008). A novel framework for List of Tables . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . v semantic annotation and personalized retrieval of sports video, Multimedia, IEEE Transactions on 10(3): 421–436. List of Figures . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . vi D’Orazio, T., Leo, M., Spagnolo, P., Mazzeo, P. L., Mosca, N., Nitti, M. and Distante, List of Plates . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . vii A. (2009). An investigation into the feasibility of real-time soccer offside detec- Hello and welcome, fellow Universiti Sains Malaysia (USM) research postgrad! The tion from a multiple camera system, IEEE TRANSACTIONS ON CIRCUITS AND List of Abbreviations . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . viii SYSTEMS FOR VIDEO TECHNOLOGY 19(12): 1804–1818. usmthesis package and template files were written in the hope that they may help by List of Symbols . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . ix D’Orazio, T., Leo, M., Spagnolo, P., Nitti, M., Mosca, N. and Distante, A. (2009). you prepare your research thesis using L TEX, based on the Institut Pengajian Siswazah A A visual system for real time detection of goal events during soccer matches, Abstrak . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . x Computer Vision and Image Understanding 113(5): 622–632. Computer Vision (IPS) requirements (IPS, 2007). Please note that this version is based on the new Abstract . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . xi Based Analysis in Sport Environments. URL: http://www.sciencedirect.com/science/article/B6WCX-4S50K9H- guidelines, in force 17 Dec 2007 onwards. (Song, Cai, Lyu and Cai, 2002) 1/2/fe82b213b3ec28e07aef15882eb37538 CHAPTER 1 – INTRODUCTION: SAMPLES OF BASIC L TEX A IPS (2007). A Guide to the Preparation, Submission and Examination of Theses, In- COMMANDS LIM LIAN TZE L TEX is powerful and produces beautiful documents. However, there is definitely A stitute of Graduate Studies, Universiti Sains Malaysia, Penang, Malaysia. 1.1 Some Simple Command Usages . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1 a learning curve to it – one that is worth the effort. If you find any errors in these Lim, L. T. (2009). L TEX: Beautiful typesetting, [Online]. [Accessed January 22, 2011]. A 1.2 Special Characters . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3 Available from World Wide Web: http://liantze.googlepages.com/latextypesetting. templates or documents, or have any suggestions or feedback, do e-mail me about it 1.3 Useful Resources . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 4 Mittelbach, F., Goossens, M., Braams, J., Carlisle, D. and Rowley, C. (2004). The (liantze@gmail.com). The author cannot always guarantee prompt response, how- LTEX Companion, Addison-Wesley Series on Tools and Techniques for Computer A Typesetting, 2nd edn, Addison-Wesley, Boston, MA, USA. CHAPTER 2 – CITATIONS AND BIBLIOGRAPHY ever. © Oetiker, T., Partl, H., Hyna, I. and Schlegl, E. (2006). The Not So Short Introduction Thesis submitted in fulfilment of the requirements 2.1 The *.bib File . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 5 to LTEX 2ε , 4.2 edn. A for the degree of MiKTEX, my recommended L TEX A distribution for Windows, is available on the Roberts, A. (2005). Getting to grips with L TEX, [Online]. [Accessed January 22, A 2.2 Citations using the natbib package . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 6 Master of Science CSPC’07 CD. A step-by-step installation walkthrough is available at (Lim, 2009). 2011]. Available from World Wide Web: http://www.andy-roberts.net/misc/latex/ 2.2.1 Author-Year System . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 6 index.html. 2.2.2 Numeric System. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 7 Song, J. Q., Cai, M., Lyu, M. R. and Cai, S. J. (2002). A new approach for line recognition in large-size images using hough transform, Proceedings of the 16th 1.1 Some Simple Command Usages International Conference on Pattern Recognition., Vol. 1, pp. 33–36. CHAPTER 3 – FIGURES, TABLES, EQUATIONS, ALGORITHMS, ETC There are plenty of free L TEX tutorials online, some of which are listed in the bibli- A 3.1 Inserting Figures . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 9 December 2007 ographies or available at http://e-office.cs.usm.my. This sample thesis includes some 3.2 Inserting Plates . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 12 3.3 Inserting Tables . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 12 examples to do some common tasks. We start with some examples for lists (both bul- iii 1 24L Lian Tze | /

Introduction Document Types Special Material Wrapping UpUniversity Theses (cont’d)Multimedia University documentclass{mmuthesis} TABLE OF CONTENTS CHAPTER 1 REFERENCES THE MMUTHESIS LTEX DOCUMENT A COPYRIGHT PAGE ii INTRODUCTION, BACKGROUND STORY, MOTIVATIONS [1] Audibert, L. (2004). Word sense disambiguation criteria: a systematic study. In 20th international conference on computational linguistics (coling 2004) (pp. 910–916). Geneva, CLASS DECLARATION iii Switzerland: COLING. ACKNOWLEDGEMENTS iv [2] Budanitsky, A., & Hirst, G. (2006). Evaluating WordNet-based measures of lexical semantic 1.1 First Test and I need a really long title, please do oblige me won’t you? Just relatedness. Computational Linguistics, 32(1), 13–47. DEDICATION v a few more words and yes we’re there Lorem ipsum dolor sit amet, consectetuer adipiscing elit. Ut purus elit, vestibu- ABSTRACT vi lum ut, placerat ac, adipiscing vitae, felis. Curabitur dictum gravida mauris. Nam arcu BY TABLE OF CONTENTS vii libero, nonummy eget, consectetuer id, vulputate a, magna. Donec vehicula augue LIM LIAN TZE eu neque. Pellentesque habitant morbi tristique senectus et netus et malesuada fames LIST OF TABLES viii ac turpis egestas. Mauris ut leo. Cras viverra metus rhoncus sem. Nulla et lectus B.Sc. (Hons), University of Warwick, United Kingdom vestibulum urna fringilla ultrices. Phasellus eu tellus sit amet tortor gravida placerat. LIST OF FIGURES ix M.Sc., Universiti Sains Malaysia, Malaysia Integer sapien est, iaculis in, pretium quis, viverra ac, nunc. Praesent eget sem vel leo PREFACE x ultrices bibendum. Aenean faucibus. Morbi dolor nulla, malesuada eu, pulvinar at, mollis ac, nulla. Curabitur auctor semper nulla. Donec varius orci eget risus. Duis CHAPTER 1: INTRODUCTION, BACKGROUND STORY, MOTIVATIONS 1 nibh mi, congue eu, accumsan eleifend, sagittis quis, diam. Duis eget orci sit amet orci 1.1 First Test and I need a really long title, please do oblige me won’t you? dignissim rutrum. Just a few more words and yes we’re there 1 Nam dui ligula, fringilla a, euismod sodales, sollicitudin vel, wisi. Morbi auctor THESIS SUBMITTED IN FULFILMENT OF THE 1.1.1 Second Test 1 lorem non justo. Nam lacus libero, pretium at, lobortis vitae, ultricies et, tellus. Donec 1.2 Yeah 2 REQUIREMENT FOR THE DEGREE OF aliquet, tortor sed accumsan bibendum, erat ligula aliquet magna, vitae ornare odio CHAPTER 2: DUMMY CHAPTER 3 metus a mi. Morbi ac orci et nisl hendrerit mollis. Suspendisse ut massa. Cras nec ante. DOCTOR OF PHILOSOPHY APPENDIX A: MANUALS, TECHNICAL SPECIFICATIONS, Pellentesque a nulla. Cum sociis natoque penatibus et magnis dis parturient montes, (by Research) nascetur ridiculus mus. Aliquam tincidunt urna. Nulla ullamcorper vestibulum turpis. DOCUMENTATIONS, EXAMPLE SCENARIOS 4 in the Pellentesque cursus luctus mauris. APPENDIX B: TRY 5 Faculty of Information Technology Test 1 REFERENCES 6 Figure 1.1: First figure. OK? GLOSSARY 7 INDEX 8 1.1.1 Second Test Their (Audibert, 2004) requirements1 are really amazing2 (Budanitsky & Hirst, PUBLICATION LIST 9 MULTIMEDIA UNIVERSITY 2006). MALAYSIA 1 See here, how weird, how to fill out an entire line. See here, how weird, how to fill out an entire line. See here, how weird, how to fill out an entire line. See here, how weird, how to fill out an entire line. See here, how weird, how to fill out an entire line. April 2010 2 don’t you agree? vii 1 6L Lian Tze | /

Introduction Document Types Special Material Wrapping UpUniversity Theses (cont’d)Universiti Malaya documentclass{umalayathesis} TABLE OF CONTENTS CHAPTER 1 REFERENCES THE UMALAYATHESIS LTEX DOCUMENT CLASS A ABSTRACT ii INTRODUCTION, BACKGROUND STORY, MOTIVATIONS Audibert, L. (2004). Word sense disambiguation criteria: a systematic study. In 20th International Confer- ence on Computational Linguistics (COLING 2004) (pp. 910–916). Geneva, Switzerland: COLING. DECLARATION iii Budanitsky, A., & Hirst, G. (2006). Evaluating WordNet-based measures of lexical semantic relatedness. Computational Linguistics, 32(1), 13–47. ACKNOWLEDGEMENTS iv 1.1 First Test and I need a really long title, please do oblige me won’t you? Just a few more words and yes we’re there TABLE OF CONTENTS v Lorem ipsum dolor sit amet, consectetuer adipiscing elit. Ut purus elit, vestibulum LIST OF FIGURES vi ut, placerat ac, adipiscing vitae, felis. Curabitur dictum gravida mauris. Nam arcu libero, LIST OF TABLES vii nonummy eget, consectetuer id, vulputate a, magna. Donec vehicula augue eu neque. Pel- LIM LIAN TZE LIST OF SYMBOLS AND ACRONYMS viii lentesque habitant morbi tristique senectus et netus et malesuada fames ac turpis egestas. Mauris ut leo. Cras viverra metus rhoncus sem. Nulla et lectus vestibulum urna fringilla LIST OF APPENDICES ix ultrices. Phasellus eu tellus sit amet tortor gravida placerat. Integer sapien est, iaculis PREFACE x in, pretium quis, viverra ac, nunc. Praesent eget sem vel leo ultrices bibendum. Aenean CHAPTER 1: INTRODUCTION, BACKGROUND STORY, MOTIVATIONS 1 faucibus. Morbi dolor nulla, malesuada eu, pulvinar at, mollis ac, nulla. Curabitur auctor 1.1 First Test and I need a really long title, please do oblige me won’t you? Just a few more words and yes we’re there 1 semper nulla. Donec varius orci eget risus. Duis nibh mi, congue eu, accumsan eleifend, 1.1.1 Second Test 2 1.2 Yeah 2 sagittis quis, diam. Duis eget orci sit amet orci dignissim rutrum. THESIS SUBMITTED IN FULFILMENT CHAPTER 2: DUMMY CHAPTER 5 Nam dui ligula, fringilla a, euismod sodales, sollicitudin vel, wisi. Morbi auctor OF THE REQUIREMENTS lorem non justo. Nam lacus libero, pretium at, lobortis vitae, ultricies et, tellus. Donec FOR THE DEGREE OF DOCTOR OF PHILOSOPHY APPENDICES 6 aliquet, tortor sed accumsan bibendum, erat ligula aliquet magna, vitae ornare odio metus REFERENCES 9 a mi. Morbi ac orci et nisl hendrerit mollis. Suspendisse ut massa. Cras nec ante. Pellen- tesque a nulla. Cum sociis natoque penatibus et magnis dis parturient montes, nascetur ridiculus mus. Aliquam tincidunt urna. Nulla ullamcorper vestibulum turpis. Pellen- tesque cursus luctus mauris. INSTITUTE OF POSTGRADUATE STUDIES UNIVERSITY OF MALAYA KUALA LUMPUR 2010 Figure 1.1: First ﬁgure. OK? v 1 9L Lian Tze | /

Introduction Document Types Special Material Wrapping UpHighly Con gurable Documentsmemoir and KOMA-Script Classes Sectional headings Running headers and footers Good font, colour and illustration choices http://latex-my.blogspot.com/search/label/bookdesign Image: A simple network. Illustration by ©Svilen Mushkatov (http://www.sxc.hu/profile/svilen001). Grid@USM PWN Grid Computing Cluster Analyser PWN PWN Analyser Analyser PWN Analyser Remote Host The Development and Integration of Remote Host Lexicon Lexicon Lexicon Dispenser Dispenser Dispenser Grid Services and Applications CONTENTS Remote Host Lexicon Dispenser Project Overview Sense-Tagger Introduction 2 PWN Grid@USM: Developing & Integrating Grid Applications & Services 4 Syntactic Lexicon Analyser Remote Host Parser Dispenser SLB on Project Milestones 7 Grid@USM Project Expenditures 8 Figure 3: Blexisma2 agents are deployed on USM C G nodes using the Globus job submission toolkit. 2008/09 Report Sub-Projects Setting up USM C G 10 AP Chan Huah Yong, Ang Sin Keat, Tan Chin Min, Kheoh Hooi Leng, Cheng Wai Khuen, M. Muzzammil bin Mohd Salahudin Dynamic Replica Management in Data Grid Environment 14 AP Chan Huah Yong, Aloysius Indrayanto and Muhammad Muzzammil bin Mohd Salahudin Using Grid Technology to Create a Render-Farm for Blender 3D Animation 18 AP Phua Kia Ken and Zafri Muhammad Grid-enabled Blexisma2 23 Grid@USM: AP Tang Enya Kong, Lim Lian Tze, Ye Hong Hoe and Dr Didier Schwab B2B Standards Component Modeling 27 Dr Vincent Khoo Kay Teong, Ting Tin Tin, Rinki Yadav, Johnson Foong and Kor Chan Hock An Automated Java Testing Tool on the Grid 31 DEVELOPING & INTEGRATING (a) Different meanings of star in context (b) Different meanings of school in context Dr Kamal Zuhairi Zamli, Dr Nor Ashidi Mat Isa, Mohammed Issam Younis and Saidatul Khatimah binti Said iNet-Grid 35 Figure 4: SLB data generated by Blexisma2 agents used to determine most probable meanings of ambiguous lexical GRID APPLICATIONS & SERVICES Prof. Sureswaran Ramadass, AP Rahmat Budiarto, AP Chan Huah Yong and Dr Ahmed M. Manasrah item. A Web interface to the Sense-Tagger is available at http://utmkblex.usmgrid.myren.net.my:8080/Blexisma2Servlets/ Grid Application to Wave Front Propagation and Containment of Vector Borne Diseases 40 CVSenseTagger. Prof. Koh Hock Lye, Dr Teh Su Yean and Tan Kah Bee interested to improve its design to On the performance issues, we with Ontology-based Conceptual Project Activities a multilingual setting, where more may attempt several solutions for the Vectors. In Proceedings of the 5th In- Organised Events 46 complicated cross-lingual phenomena SLB bottleneck problem mentioned ternational Workshop on Natural Lan- will have to be considered. We also earlier: guage Processing and Cognitive Sci- Other Events 48 hope to improve the agent commu- ence (NLPCS’08). Barcelona, Spain; Publications 50 USM’S R&D SUSTAINABILITY for attaining and subsequently sus- Grid computing is by its na- nication mechanisms to reduce la- • hardware (RAM) upgrades, pp. 153–158. taining RU status is the creation ture highly distributed geographically, tency. Apart from creating more • further optimisation of PostgreSQL Edited by Bahari Belaton and Lim Lian Tze To attain the level of excellence as a of highly conducive research envi- consists of highly specialised equip- server settings, agents that implement different learn- Schwab, D. & Lim, L. T. (2008). Blex- research university (RU), USM in re- ronment and infrastructure. Grid ment (storage, grid engines and man- • database connection pooling, ing algorithms and heuristics, we are isma2: a Distributed Agent Frame- cent years has seriously engaged her- computing is an example of such agement tools), as well as expensive. • load balancing, Platform for Information & Communication Technology Research self in various efforts to formulate infrastructure, aiming at providing It is as such an ideal example of com- also planning agents responsible for other NLP tasks such as deep parsing, • parallelising queries. work for Constructing a Semantic Lexical Database based on Con- and chart her future research and excellent research facilities by en- mon, core computational resources Universiti Sains Malaysia development (R&D) directions. The suring good computational horse- to be created and pooled among as- detecting named entities, etc. In other words, we hope to have agents of var- ceptual Vectors. In Proceedings of the International Conference on pinnacle of these efforts was trans- power to support high impact do- piring researchers who require high ious responsibilities so that they can Distributed Frameworks & Applica- lated into a 2 year strategic plan “USM mains in the bio-sciences, physical performance resources. be ‘mixed-and-matched’ to construct PROJECT PUBLICATIONS tions 2008 (DFmA 2008). Penang, Research-Intensive University 2007– sciences, information and communi- new NLP applications, such as those Malaysia; pp. 102–110. 2009”. cation technology (ICT), Environment Lim, L. T. & Schwab, D. (2008). Lim- Equally important, USM needs a fo- mentioned in the introduction. ri its of Lexical Semantic Relatedness @ G d Note: The abbreviations Prof. and AP are used for Professor and Associate Professor respectively throughout this book. One of the crucial input elements sciences, Education, Arts and others. cused, holistic and dedicated effort S M U 4 26 GRID-ENABLED BLEXISMA2L Lian Tze | /

Introduction Document Types Special Material Wrapping UpPresentation Slides This presentation was made with LTEX! A Many possible classes: powerdot, beamer Intro documentclass{beamer} usetheme{Warsaw} A First Presentation Lim Lian Tze author ... June 3, 2011 begin{document} titleframe Lim Lian Tze A First Presentation Intro Some Background section{Intro} begin{frame} frametitle{Some Background} Once upon a time There were programmers ... end{frame} end{document} Lim Lian Tze A First PresentationL Lian Tze | /

Introduction Document Types Special Material Wrapping UpOversized Posters Many possible solutions: sciposter, flowfram, beamerposter Low-Cost Construction of a Multilingual Lexicon from Bilingual Lists Introduction Adding a New Language Bilingual MRDs are good resources for building (Example: Malay–English–Chinese + French) multilingual lexicons, but heterogeneous structures Construct also French–English–Malay triples Lowest common denominator: list of Add French members to existing M-E-C clusters with source language item→ target language item(s) common English & Malay members Proposal: Multilingual lexicon construction using only simple bilingual lists bengkeng documentclass{beamer} One-time Inverse Consultation [1] erce ferocious garang + (cruel, ferocious, garang) (féroce, erce, garang) ö Generates a bilingual lexicon for new language pair usepackage[orientation=portrait, → from existing bilingual lists JP–EN, EN–MS, MS–EN lexicons ⇒ JP–MS féroce bengkeng cruel ˓→ size=a0]{beamerposter} Japanese F English mark seal Malay tanda anjing laut erce garang stamp tera ferocious ö usetheme{...} imprint gauge Precision of 100 Random Translation Sets author ... % Meta−information score(‘tera’) = 2 × |E1 ∩ E2| |E1| + |E2| ∴F ‘tera’ is most likely valid =2× 2 3+4 = 0.57 . α= . α= . α= . Precision ↔ . . Merging Translation Triples into Sets . (Example: Malay–English–Chinese) β begin{document} Retain OTIC ‘middle’ language links For each ‘head’ language LI, discard triples with score . . . . Precision generally around 0.70–0.82; max 0.86 . . . . < αX or score2 < β X, where X = max score of all F1 and Rand Index of Selected Translation Sets begin{frame} triples containing that LI (garang, ö) . (garang, Ñ5 ) . Evaluating accuracy of sets with polysemous ‘middle’ language members, e.g. ‘plant’, ‘target’ ... % Poster contents goes here (garang, ferocious, ö) (garang, bold, Ñ5) (garang, erce, ö) Test Rand Index F1 Best accuracy when (garang, ÀÈ) . (garang, a5 ) . word min max min max α β (garang, jazzy, ÀÈ) (garang, bold, a5) ‘bank’ 0.417 0.611 0.588 0.632 0.6 0.4 end{frame} (garang, Æ) . (garang, bold, Æ) ‘plant’ ‘target’ ‘letter’ 0.818 0.927 0.821 1.000 0.709 0.818 0.809 0.902 0.724 0.913 1.000 0.792 0.6 0.4 0.8 0.2 0.2 0.2 end{document} Merge all triples with common bilingual pairs bengkeng Discussion and Conclusion Low thresholds (α, β ): more coverage; low precision (garang, ferocious, ö) → erce (garang, erce, ö) garang High thresholds: good precision; low coverage (bengkeng, erce, ö) ferocious α = 0.6, β = 0.2 gives good trade-o between ö coverage, precision and recall Results are encouraging for such simple input data! References Future plan: Integrate lexicon [1] F. Bond and K. Ogura. “Combining linguistic resources to create a into an MT system machine-tractable Japanese–Malay dictionary”. In: Language with WSD Resources and Evaluation 42 (2008), pp. 127–136. Lian Tze L Bali R M Enya Kong T liantze@gmail.com {ranaivo,enyakong}@mmu.edu.my NLP-SIG, Faculty of Information Technology, Multimedia University, MalaysiaL Lian Tze | /

Introduction Document Types Special Material Wrapping UpLea ets leaflet: arrange contents into pages on a foldable double-sided sheet Discussion References Low-Cost Construction of a Low thresholds (α, β): more coverage; low precision High thresholds: good precision; low coverage [] F. Bond and K. Ogura. “Combining linguistic resources to create a machine-tractable Japanese–Malay dictionary”. In: Multilingual Lexicon from α ≈ . , β ≈ . gives good trade-o between coverage, Language Resources and Evaluation ( ), pp. – . Bilingual Lists precision and recall [ ] P. Vossen. “EuroWordNet: A Multilingual Database of Results are encouraging for such simple input data! Autonomous and Language-speci c Wordnets Connected via Especially suitable for under-resourced language pairs an Inter-Lingual-Index”. In: Special Issue on Multilingual Lian Tze L Future plan: Integrate multilingual lexicon into an MT Databases, International Journal of Linguistics . ( ). Bali R -M system with WSD and user interaction features [ ] D. Tu ş, D. Cristeau, and S. Stamou. “BalkaNet: Aims, Enya Kong T Methods, Results and Perspectives – A General Overview”. Related Work In: Romanian Journal of Information Science and Technology Special Issue . ( ), pp. – . NLP-SIG, Faculty of Information Technology Many multilingual lexicon projects [ , ]) aligned with Multimedia University, Malaysia [ ] C. Fellbaum, ed. WordNet: An Electronic Lexical Database. Princeton WordNet [ ] Language, Speech, and Communication. Cambridge, Overly ne sense distinctions in Princeton WordNet Massachusetts: MIT Press, . Pan Lexicon [ ]: compute context vectors of words from monolingual corpora of di erent languages, then [ ] M. Sammer and S. Soderland. “Building a Introduction sense-distinguished multilingual lexicon from monolingual grouping into translation sets by matching context corpora and bilingual lexicons”. In: Proceedings of Machine Bilingual MRDs are good resources for building vectors via bilingual lexicons Translation Summit XI. Copenhagen, Denmark, , multilingual lexicons Sense distinctions derived from corpus evidence pp. – . But MRDs have heterogeneous contents and structures Produces many translation sets that contain [ ] K. Markó, S. Schulz, and U. Hahn. “Multilingual Lexical Not all contain rich information (gloss, domain) semantically related but not synonymous words, Acquisition by Bootstrapping Cognate Seed Lexicons”. In: (Especially so for under-resourced languages) e.g. ‘shoot’ and ‘bullet’ (lower precision) Proceedings of the International Conference on Recent Di erent structures (sense granularity, distinctions) precision based on evaluators’ opinions ( if Advances in Natural Language Processing (RANLP) . Lowest common denominator: list of source language item → target language item(s) inter-evaluator agreement is not required) Borovets, Bulgaria, . Does not handle multi-word expressions documentclass[foldmark,a4paper] Construct multilingual lexicon using only bilingual lists [ ] M. Lafourcade. “Automatically Populating Acception Lexical Markó, Schulz and Hahn [ ] use cognate mappings to Database through Bilingual Dictionaries and Conceptual derive new translation pairs, validate by processing Vectors”. In: Proceedings of PAPILLON- . Tokyo, Japan, One-time Inverse Consultation [1] parallel corpora (medical domain) Aug. . Complex terms indexed on the level of sub-words Generates a bilingual lexicon for a new language pair [ ] C. Boitet, M. Mangeot, and G. Sérasset. “ e PAPILLON e.g. ‘pseudo⊕hypo⊕para⊕thyroid⊕ism’ from existing bilingual lists {leaflet} project: Cooperatively Building a Multilingual Lexical accuracy for each language pair Database to Derive Open Source Dictionaries & Lexicons”. Given bilingual lexicons L –L , L –L , L –L , generate Requires large aligned thesaurus corpora (easier to In: Proceedings of the nd Workshop on NLP and XML bilingual lexicon L –L acquire for specialised domains?) (NLPXML’ ). Taipei, Taiwan, , pp. – . Example: JP–EN, EN–MS, MS–EN lexicons ⇒ JP–MS Cognate-based approach not applicable for language Japanese English Malay author ... % Meta−information pairs that are not closely related mark tanda Lafourcade [ ]: compute contextual vectors for Contact F seal anjing laut translation pairs based on gloss text and associated class stamp tera labels from semantic hierarchy; compare vectors from Lian Tze L liantze@gmail.com Bali R -M ranaivo@mmu.edu.my imprint di erent bilingual lexicons to detect synonymy gauge Resource requirements not available for all language Enya Kong T enyakong@mmu.edu.my E ∩E score(‘tera’) = × = × = . pairs, costly task of assigning class labels E + E + NLP-SIG, Faculty of Information Technology Multimedia University, Cyberjaya, Malaysia. http://fit.mmu.edu.my/sig/nlp/ ∴ ↔ F ‘tera’ is more likely to be valid begin{document} maketitle Merging Translation Triples into Sets Retain OTIC ‘middle’ language links For each ‘head’ language LI, lter only triples whose Algorithm : Generating trilingual translation chains forall the lexical items w h ∈ L do Wm ← translations of w h in L Precision of 100 Random Translation Sets . α= . α= . α= . forall the w m ∈ Wm do score exceed thresholds (See Algorithm ) Precision . W t ← translations of w m in L Merge all triples with common bilingual pairs section ... Malay–English–Chinese example: – – Kamus Inggeris–Melayu untuk Penterjemah XDict – CC-CEDICT forall the w t ∈ W t do Output a translation triple (w h , w m , w t ) Wm r ← translations of w t in L . . score(w h , w m , w t ) ← β ... % Lea et contents . . . . common words in w m r ∈ Wm r and w| (garang, ö ) . (garang, Ñ 5) . words in w m r ∈ Wm r (garang, ferocious, ö) Precision increases with threshold parameters α and β (garang, bold, Ñ5) (garang, erce, ö) w∈Wm Precision generally around . – . ; max . end ∑w∈Wm score(w h , w, w t ) (garang, a 5) . Most false positives are not ranked at top of the list (garang, À È) . (garang, bold, a5) score(w h , w t ) ← × Many errors caused by incorrect POS assignments (garang, jazzy, ÀÈ) Wm + Wm r end{document} (garang, Æ) . (garang, bold, Æ) end X ← maxw t ∈Wt score(w h , w t ) forall the distinct translation pairs (w h , w t ) do if score(w h , w t ) ≥ αX or (score(w h , w t )) ≥ βX F and Rand Index of Selected Translation Sets False positives will frequently arise when ‘middle’ language members are polysemous, e.g. ‘plant’, ‘target’ bengkeng then Evaluate accuracy of selected sets with polysemous (garang, ferocious, ö) Place w h ∈ L , w m ∈ L , w t ∈ L from all triples → erce ‘middle’ language members (garang, erce, ö) garang (w h , w ... , w t ) into same translation set Record score(w h , w t ) and score(w h , w m , w t ) Precision = (bengkeng, erce, ö) TP TP + FP ferocious ö else Discard all triples (w h , w ... , w t ) Recall = TP Adding More Languages // The sets are now grouped by TP + FN (w h , w t ) × Precision × Recall Construct L –L –L triples F = Add L members to existing L –L –L clusters with end Precision + Recall TP + TN RI = common L & L members end Example: Malay–English–Chinese + French, using end TP + FP + FN + TN ‘ready-made’ triples from FeM Merge all sets containing triples with same (w h , w m ) Merge all sets containing triples with same (w m , w t ) bengkeng Test Rand Index F Best accuracy when erce (cruel, ferocious, garang) word min max min max α β garang + (féroce, erce, garang) Algorithm : Adding L k+ to multilingual lexicon L of ‘bank’ . . . . . . {L , L , . . . , L k } ferocious ö ‘plant’ . . . . . . T ← translation triples of L k+ , L m , L n generated by ‘target’ . . . . . . → Algorithm where L m , L n ∈ {L , L , . . . , L k } ‘letter’ . . . . . . forall the (w L m , w L n , w L k+ ) ∈ T do féroce bengkeng cruel F and RI increases with α and β Add w L k+ to all entries in L that contains both w L m and But may decrease when they are too high and reject erce garang wLn valid members (false negatives) end ferocious öL Lian Tze | /

Introduction Document Types Special Material Wrapping UpFillable PDF Forms usepackage{hyperref} ... % various settings skipped TextField{Name:} TextField{Affiliation:} ChoiceMenu[radio=true] {Are you a:}{Student, Academic} Interest: CheckBox{Security} CheckBox{Systems} CheckBox{User space} TextField[multiline=true] {Comments:}L Lian Tze | /

Introduction Document Types Special Material Wrapping UpFillable PDF Forms (cont’d)Use with caution! poppler-based viewers (evince, xpdf, okular) Problem displaying and saving radio/check boxes correctly Saved forms can’t be opened by other viewers Adobe Reader Cannot save lled form as PDF unless Acrobat is installed Only as eld-and-value text le Can provide “Submit” button for submission to a URL Or print hard copy of lled form! PDF XChange Viewer Best freeware for lling and saving LTEX-created forms A Windows only Not OSSL Lian Tze | /

Introduction Document Types Special Material Wrapping UpFlash Cards documentclass[avery5388,frame] {flashcards} cardfrontstyle{headings} cardfrontfoot{Linux} S A digital representation of information that begin{document} Certi cate identi es you and is issued by Cas, which are often a trusted third party (TTP). begin{flashcard}[Security] {Certificate} L ... S end{flashcard} Access to an object is restricted based on the sensitivity of the object (de ned by the label MAC (Mandatory Access that is assigned), and granted through Control) authorization (Clearance) to access that level of begin{flashcard}[Security] data. {MAC ...} L ... end{flashcard} end{document}L Lian Tze | /

Introduction Document Types Special Material Wrapping UpExamination Questions documentclass{exam} ... begin{questions}printanswers 1. What is Paul McCartney’s middle name? (5) question[5] A. John B. Paul C. Ringo D. James What is Paul McCartneys middle name? begin{oneparchoices} 2. What was the Beatles’ rst single in 1962? (10) choice John CorrectChoice Paul choice Ringo choice James Solution: Love Me Do end{oneparchoices} 3. (a) What was George’s inspiration for ‘While (5) question[10] What was the Beatles first My Guitar Gently Weeps’? ˓→ single in 1962? begin{solution}Love Me Doend{solution} Solution: He opened a random book and saw the words “gently weep”. question (b) Who guest-performed for the song and why? (5) begin{parts} part[5] What was Georges inspiration for Solution: Eric Clapton; he wanted a ˓→ `While My Guitar Gently Weeps? spi y guitar solo. begin{solution} He opened a random book and saw the words ˓→ ` `gently weep. end{solution} ... end{questions}L Lian Tze | /

Introduction Document Types Special Material Wrapping UpMathematics ( ) relates the golden ratio and the Fibonacci series. √ Recall that the golden ratio, �� = ( + ). ∞ ∑︁ (− )n+ �� = + () n= Fn Fn+ eqref{eq:gratio} relates the golden ratio and the Fibonacci series. Recall that the golden ratio, $phi = frac{1}{2} (1 + sqrt{5})$. begin{equation}label{eq:gratio} phi = 1 + sum^{infty} _{n=1} frac{ (-1)^{n+1} }{ F_n F_{n+1} } end{equation}L Lian Tze | /

Introduction Document Types Special Material Wrapping UpChemical Equations and Molecules H O – – + OH + OH – + Zn −− −− ↽ −− −− ⇀ Zn(OH) ↓ −− −− [Zn(OH) ] ↽ −− −− ⇀ H C C + H+ + H+ amphoteres Hydroxid Hydroxozikat H H usepackage[version=3]{mhchem} % su cient for chemical equations usepackage{chemfig} % for −D molecule drawings ... ce{Zn^2+ <=>[ce{+ 2OH-}][ce{+ 2H+}] $underset{text{amphoteres Hydroxid}}{ce{Zn(OH)2 v}}$ <=> C[+2OH-][{+ 2H+}] $underset{text{Hydroxozikat}}{cf{[Zn(OH)4]^2-}}$ } chemfig{H-C(-[2]H)(-[6]H)-C(-[7]H)=[1]O}L Lian Tze | /

Introduction Document Types Special Material Wrapping UpLinguistics S( ) %*Wen liebt seine Mutter? NP VP Whom loves his mother Pron V NP ‘Who does his mother love?’ He kicked Det N( ) [[ NP He ] [ VP kicked [ NP the ball ]]] S the ball usepackage{linguex,qtree} ... exg. %*Wen liebt seine Mutter? Whom loves his mother `Who does his mother love? exi. [[NP He ] [VP kicked [NP the ball ]]]S Tree [ .S [.NP [.Pron He ] ] [.VP [.V kicked ] [.NP [.Det the ] [.N ball ] ˓→ ] ] ]L Lian Tze | /

Introduction Document Types Special Material Wrapping UpProgram Listings usepackage{listings,xcolor} ... begin{lstlisting} [language=C,columns=fullflexible, basicstyle=ttfamily, #include <stdio.h> keywordstyle=bfseriescolor{red}, commentstyle=sffamilycolor{green}, /∗ stringstyle=rmfamilycolor{orange}] | Prints "hello world" #include <stdio.h> ∗/ /* int main(void) | Prints "hello world" { */ printf("hello, worldn"); int main(void) return 0; { } printf("hello, worldn"); return 0; } end{lstlisting}L Lian Tze | /

Introduction Document Types Special Material Wrapping UpNetwork Protocols usepackage{bytefield} ... }︃ begin{bytefield}{16} Tag Mask bitheader{0,7,8,15} Header wordgroupr{Header} Source Destination bitbox{4}{Tag} & bitbox{12}{Mask} bitbox{8}{Source} & bitbox{8}{Destination} Data endwordgroupr wordbox{3}{Data} end{bytefield}L Lian Tze | /

Introduction Document Types Special Material Wrapping UpLife Sciences rst case (see text) ↓AQP1.PRO TLGLLLSCQISILRAVMYIIAQCVGAIVASAIL 112AQP2.PRO TVACLVGCHVSFLRAAFYVAAQLLGAVAGAAIL 104AQP3.PRO TFAMCFLAREPWIKLPIYTLAQTLGAFLGAGIV 112AQP4.PRO TVAMVCTRKISIAKSVFYITAQCLGAIIGAGIL 133AQP5.PRO TLALLIGNQISLLRAVFYVAAQLVGAIAGAGIL 105 ↑ second case (see text) usepackage{texshade} % for nucleotide and peptide alignments ... begin{texshade}{AQPpro.MSF} shadingmode{similar} threshold[80]{50} setends{1}{80..112} hideconsensus feature{top}{1}{93..93}{fill:$downarrow$}{first case (see text)} feature{bottom}{1}{98..98}{fill:$uparrow$}{second case (see text)} end{texshade}L Lian Tze | /

Introduction Document Types Special Material Wrapping UpCircuits and SI Units Ω A vx . × V lm F− S Ω Ω vx km/h, km/h and km/h B usepackage{siunitx} usepackage[siunitx]{circuitikz} ... begin{circuitikz} draw (0,0) node[anchor=east] {B} to[short, o-*] (1,0) to[R=20<ohm>, *-*] (1,2) to[R=10<ohm>, v=$v_x$] (3,2) -- (4,2) to[ cI=$frac{si{siemens}}{5} v_x$, *-*] (4,0) -- (3,0) to[R=5<ohm>, *-*] (3,2) (3,0) -- (1,0) (1,2) to[short, -o] (0,2) node[anchor=east]{A} ;end{circuitikz} SI{3.45d4}{squarevoltcubiclumenperfarad} SIlist[per-mode=symbol]{40;85;103}{kilometreperhour}L Lian Tze | /

Introduction Document Types Special Material Wrapping UpMeh, What Good is That? Can’t Use it Anywhere Else.Actually, you can. usepackage[active,tightpage]{preview} PreviewEnvironment{texshade} ... begin{texshade} ... end{texshade} Run pdflatex → cropped PDF containing only contents of texshade gs -otexshade.png -sDEVICE=png16m -r200 -dTextAlphaBits=4 -dGraphicAlphaBits=4 texshade.pdf Multiple environments → multi-page PDF Use -otexshade%02d.png to get texshade01.png, texshade02.png, . . .L Lian Tze | /

Introduction Document Types Special Material Wrapping UpBar Codes ISBN 978-3-86541-114-3 L E 2 8 H S 9 Z 9 781860 742712 9 783865 411143 usepackage{auto-pst-pdf} % Needed if running pd atex; must use option −shell−escape usepackage{pstricks,pst-barcode} ... begin{pspicture} psbarcode{MECARD:N:Malaysia Open Source Conference...}{eclevel=L}{qrcode} psbarcode{9781860742712}{includetext guardwhitespace}{ean13} psbarcode{978-3-86541-114}{includetext guardwhitespace}{isbn} psbarcode{LE28HS9Z}{includetext}{royalmail} psbarcode{^453^178^121^239}{columns=2 rows=10}{pdf417} end{pspicture}L Lian Tze | /

Introduction Document Types Special Material Wrapping UpGraph Plots − L Lmax − − − − Dof usepackage{pgfplots} ... begin{tikzpicture} begin{loglogaxis}[xlabel=Dof] addplot table[x=dof,y=L2]{datafile.dat}; addlegendentry{$L_2$}; addplot table[x=dof,y=Lmax]{datafile.dat}; addlegendentry{$L_text{max}$}; end{loglogaxis} end{tikzpicture}L Lian Tze | /

Introduction Document Types Special Material Wrapping UpSpreadsheets(Seriously, use a proper spreadsheet application for complex stu .) Year ending Mar Revenue . . . Cost of sales . . . Gross pro t . . . STautoround*{2} begin{spreadtab}{{tabular}{l rrr}} @Year ending Mar 31 & @2009 & @2008 & @2007 hline @Revenue & 14580.2 & 11900.4 & 8290.3 @Cost of sales & 6740.2 & 5650.1 & 4524.2 cline{2-4} @emph{Gross profit} & STcopy{>}{b2-b3} & & cline{2-4} end{spreadtab}L Lian Tze | /

Introduction Document Types Special Material Wrapping UpGantt Charts Preliminary Project % complete Objective Task A Task B Objective Task A Task B usepackage{pgfgantt} ... begin{tikzpicture} begin{ganttchart}[...settings...]{16} gantttitle{2010}{4} gantttitle{2011}{12} ganttbar[progress=100]{Preliminary Project}{1}{4} ganttlink[link mid=.4]{4}{2}{5}{4} ganttlink[link mid=.159]{4}{2}{5}{7} ganttgroup{Objective 1}{5}{16} ganttbar[progress=4]{Task A}{5}{10} ganttlinkedbar[progress=0]{Task B}{11}{16} ... end{ganttchart} end{tikzpicture}L Lian Tze | /

Introduction Document Types Special Material Wrapping UpChess games e e Nf Nc Bb a usepackage[skaknew]% rZblkans {skak,chessboard} ZpopZpop ... pZnZ0Z0Z newgame ZBZ0o0Z0 mainline{1. e4 e5 2. Nf3 Nc6 3. ˓→Bb5 a6} 0Z0ZPZ0Z chessboard[smallboard] Z0Z0ZNZ0 POPO0OPO SNAQJ0ZR a b c d e f g hL Lian Tze | /

Introduction Document Types Special Material Wrapping UpCrossword Puzzles Across: unit of measure Down: �� unit of * sectioning unit measure nonproportional font usepackage{cwpuzzle} Clue{2}{AST}{(ast)} ... Clue{5}{PART}{sectioning unit} begin{Puzzle}{5}{3} end{PuzzleClues} |* |* |[1]E|X |* |. begin{PuzzleClues}{ |[2]A|[3]S|T |* |[4]T|. textbf{Down:} } |* |[5]P|A |R |T |. Clue{1}{ETA}{(eta)} end{Puzzle} Clue{3}{SP}{unit of measure} begin{PuzzleClues}{ Clue{4}{TT}{nonproportional font} textbf{Across:} } end{PuzzleClues} Clue{1}{EX}{unit of measure}L Lian Tze | /

Introduction Document Types Special Material Wrapping UpSong Books with Guitar Tabs C G Am FCountry road, take me home, to the place I belong. C G F CWest Virginia, mountain momma, take me home, country road. usepackage{gchords,guitar} ... begin{guitar} newcommand{CMaj}{chord{t}{n,p3,p2,n,p1,n}{C}} newcommand{Amin}... Country [CMaj]road, take me [GMaj]home, ... end{guitar}L Lian Tze | /

Introduction Document Types Special Material Wrapping UpSummary LTEX A a document preparation system professional quality typesetting output Output artefacts Academic: papers, theses, books Dedicated document types Domain-speci c material Usage scenario Direct authoring Automatic generation (via scripts etc) As back-end of other applicationsL Lian Tze | /

Introduction Document Types Special Material Wrapping UpGetting Help Many free tutorials and e-books on the Web (beware of obsolete ones!) Getting to Grips with LTEX. Andy Roberts. A http://www.andy-roberts.net/misc/latex/ LTEX: Beautiful Typesetting. Lim Lian Tze. A http://liantze.penguinattack.org/latextypesetting.html LTEX and Friends. M.R.C. van Dongen. A http://csweb.ucc.ie/~dongen/LaTeX-and-Friends.pdf The LTEX WikiBook. A http://en.wikibooks.org/wiki/LaTeX Questions? TEX FAQ. http://www.tex.ac.uk/cgi-bin/texfaq2html TEX.SX. http://tex.stackexchange.com/ comp.text.tex usenet group Malaysian LTEX User Group. http://latex-my.blogspot.com/ A Arrange for trainingL Lian Tze | /

Introduction Document Types Special Material Wrapping UpThank You Questions? liantze@gmail.com http://latex-my.blogspot.comL Lian Tze | /

http://liantze.penguinattack.org	7380
http://texblog.net	6316
http://latex-my.blogspot.com	1485
http://www.chinatex.org	621
http://timothyandrewbarber.blogspot.com	180
url_unknown	81
http://www.cognitiones.de	68
http://localhost	53
http://www.schockwellenreiter.de	33
http://www.slideshare.net	32
http://localhost:8888	28
http://latex-my.blogspot.de	23
http://latex-my.blogspot.fr	22
http://cognitiones.kantel-chaos-team.de	17
http://latex-my.blogspot.in	15
http://latex-my.blogspot.com.br	13
http://translate.googleusercontent.com	13
http://latex-my.blogspot.ca	12
http://latex-my.blogspot.com.es	10
http://latex-my.blogspot.jp	10
http://latex-my.blogspot.it	9
http://timothyandrewbarber.blogspot.co.uk	9
http://latex-my.blogspot.com.au	9
http://latex-my.blogspot.mx	8
http://timothyandrewbarber.blogspot.com.br	6
http://feeds.feedburner.com	5
http://latex-my.blogspot.co.uk	5
http://timothyandrewbarber.blogspot.fr	5
http://timothyandrewbarber.blogspot.de	5
http://texblog.net.	4
http://timothyandrewbarber.blogspot.com.es	4
http://latex-my.blogspot.pt	3
http://www.latex-my.blogspot.com	3
http://liantze.penguinattack.org.sixxs.org	3
http://xianguo.com	3
http://www.jrvideo.se	2
http://deltawelle.de HTTP	2
http://linuxundich.de	2
http://www.lib4online.com	2
http://latex-my.blogspot.com.ar	2
http://latex-my.blogspot.se	2
http://cache.baidu.com	1
http://paper.li	1
http://timothyandrewbarber.blogspot.pt	1
http://webcache.googleusercontent.com	1
http://172.19.36.9	1
http://latex-my.blogspot.com.sixxs.org	1
http://timothyandrewbarber.blogspot.in	1
http://timothyandrewbarber.blogspot.se	1

LaTeX: More Than Just Academic Papers and Theses

by Lian Tze Lim on Jun 23, 2011

Accessibility

Categories

Tags

Upload Details

Usage Rights

49 Embeds 16,513

Statistics

LaTeX: More Than Just Academic Papers and Theses — Presentation Transcript