Your SlideShare is downloading. ×
KALBE Annual Report 2012
Upcoming SlideShare
Loading in...5
×

Thanks for flagging this SlideShare!

Oops! An error has occurred.

×

Introducing the official SlideShare app

Stunning, full-screen experience for iPhone and Android

Text the download link to your phone

Standard text messaging rates apply

KALBE Annual Report 2012

10,172
views

Published on

KALBE Annual Report 2012

KALBE Annual Report 2012

Published in: Investor Relations

0 Comments
2 Likes
Statistics
Notes
  • Be the first to comment

No Downloads
Views
Total Views
10,172
On Slideshare
0
From Embeds
0
Number of Embeds
2
Actions
Shares
0
Downloads
240
Comments
0
Likes
2
Embeds 0
No embeds

Report content
Flagged as inappropriate Flag as inappropriate
Flag as inappropriate

Select your reason for flagging this presentation as inappropriate.

Cancel
No notes for slide

Transcript

  • 1. IDX: KLBFwww.kalbe.co.idLAPORAN TAHUNAN 2012 ANNUAL REPORTLEBIH DEKAT DENGAN ANDACLOSER TO YOU
  • 2. Profil PerusahaanCompany Profile30 Informasi PerseroanCorporate Information32 Sekilas KALBE FARMAKALBE FARMA at a Glance34 Divisi UsahaBusiness Divisions36 Struktur OrganisasiOrganization Structure37 Struktur Kepemilikan Perseroandan Entitas AnakShareholding Structure of the Companyand Subsidiaries38 Visi, Misi, Moto dan NilaiVission, Mission, Motto and Values40 Profil Dewan KomisarisBoard of Commissioners Profile43 Profil DireksiBoard of Directors Profile46 Profil Komite AuditAudit Committee Profile47 Profil Komite NominasiNomination Committee Profile48 Profil Komite RemunerasiRemuneration Committee Profile49 Profil Komite Risiko UsahaBusiness Risk Committee Profile50 Profil Komite GCGGCG Committee Profile51 Profil Kepala Unit Audit InternalHead of Internal Audit Unit Profile51 Profil Sekretaris PerusahaanCorporate Secretary Profile52 Informasi Pemegang SahamShareholders Information56 Entitas AnakSubsidiaries58 Daftar PrinsipalPrincipals List60 Prestasi dan PenghargaanRecognition and Awards62 Jejak LangkahMilestones64 Peristiwa Penting 2012Event Highlights 201230Daftar IsiContents4 Strategi 20122012 Strategy6 Kinerja 20122012 Performance8 Ikhtisar KeuanganFinancial Highlights10 Ikhtisar SahamStock Highlights12 Laporan Dewan KomisarisReport from the Board ofCommissioners20 Laporan DireksiReport from the Board of Directors68Analisis dan Diskusi ManajemenManagement Discussion and Analysis228Tanggung Jawab SosialPerusahaanCorporate SocialResponsibilityTanggung Jawab Pelaporan TahunanResponsibility for Annual Reporting246
  • 3. Tata Kelola PerusahaanCorporate Governance168Analisis dan Diskusi ManajemenManagement Discussion and Analysis6870 Tinjauan IndustriIndustrial Review76 Tinjauan UsahaBusiness Review76 Portofolio Bisnis yang Disempurnakan Enhanced Business Portfolio80 Divisi Obat Resep Prescription Pharmaceuticals Division86 Divisi Produk Kesehatan Consumer Health Division92 Divisi Nutrisi Nutritionals Division96 Divisi Distribusi & Logistik Distribution & Logistics Division104 Tinjauan OperasionalOperational Review104 Riset dan Pengembangan Research and Development110 Pengelolaan Rantai Pasokan Supply Chain Management114 Sumber Daya Manusia Human ResourcesTata Kelola PerusahaanCorporate GovernanceReferensi Peraturan Bapepam-LK No.X.K.6Bapepam-LK Regulation No.X.K.6 Cross Reference168126 Teknologi Informasi Information Technology130 Pemasaran Marketing136 Tinjauan KeuanganFinancial Review136 Kinerja Keuangan di Tahun 2012 Financial Performance in 2012144 Laporan Posisi Keuangan Konsolidasian Consolidated Statements of FinancialPosition149 Likuiditas dan Struktur Permodalan Liquidity and Capital Structure150 Laporan Arus Kas Konsolidasian Consolidated Statements of Cash Flows151 Pemasaran Marketing152 Produksi Production152 Investasi Barang Modal Capital Expenditure153 Ikatan Material untuk Investasi BarangModal Material Ties for Investment of CapitalGoods Investment153 Kebijakan Dividen Dividend Policy153 Realisasi Penggunaan Dana HasilPenawaran Umum Usage of Proceeds from Rights Issue154 Transaksi Material dan Kejadian LuarBiasa Material Transactions and ExtraordinaryEvents154 Transaksi yang Mengandung BenturanKepentingan Material Transactions Containing Conflictof Interest154 Kejadian Setelah Tanggal Neraca Subsequent Event154 Perubahan Peraturan Perundang-undangan Changes in Laws and Regulations156 Perubahan Kebijakan Akuntansi Changes in Accounting Policies170 Prinsip dan Komitmen Terhadap TataKelola Perusahaan yang Baik (GCG)Principles and Commitment to GoodCorporate Governance (GCG)172 Inisiatif Peningkatan Praktik GCGSelama 2012GCG Practice Improvement Initiatives in2012173 Mekanisme GCGGCG Mechanism174 Rapat Umum Pemegang SahamGeneral Meeting of Shareholders180 Dewan KomisarisBoard of Commissioners185 DireksiBoard of Directors191 Komite-KomiteCommittees199 Audit Internal danPengendalian InternalInternal Audit and Internal Control204 Audit EksternalExternal Audit205 Manajemen RisikoRisk Management209 Aksi KorporasiCorporate Actions209 Sekretaris PerusahaanCorporate Secretary212 Hubungan InvestorInvestor Relations214 Akses Informasi dan Data PerseroanAccess to Corporate Information and Data215 Opsi SahamShare Option215 Perkara LitigasiLitigation217 Benturan KepentinganConflict of Interest217 Pemberian Dana untuk Kegiatan Politikdan SosialFunding for Political and Social Activities217 Komitmen pada KonsumenCommitment to Consumers218 Etika dan Sosialisasi Etika PerusahaanEthics and Socialization of the Company’sEthics219 Whistleblowing SystemWhistleblowing System221 Pengembangan GCG di Tahun 2013GCG Development in the Year 2013Laporan Keuangan KonsolidasiConsolidated Financial Statements249
  • 4. PT Kalbe Farma Tbk. • Laporan Tahunan 20122Performance HighlightsManagement ReportCompany ProfileManagement Discussion and AnalysisCorporate GovernanceCorporate Social ResponsibilityCloser to YouOver the years, Kalbe has built a reputation forits innovative culture and dedication to highquality and well-trusted healthcare products.Our product range has grown significantly, frompharmaceuticals, nutritions, to health foodsand beverages, medical devices and healthcareservices.OuroperationnetworkservestheentireIndonesian’s archipelago, with well establishedpresence in Southeast Asia and several Africancountries.In line with our mission of improving health fora better life, we continuously touch the lives ofour consumers, everyday as they walk the pathof their lives.3,000700Morinaga DuniaGenerasi PlatinumEventsZee ComputerCompetitionSeminar “How toLive with Cancer”Hydro CocoFun Bike!Participantsin 40 CitiesParticipantsin 11 Major CitiesParticipantsin 6 Major CitiesParticipants200,000 110,000
  • 5. PT Kalbe Farma Tbk. • 2012 Annual Report 3Lebih Dekat dengan AndaDari tahun ke tahun, Kalbe telah membangun reputasi sebagaiperusahaan yang inovatif, serta berdedikasi pada produk-produkkesehatan berkualitas dan terpercaya. Ragam produk kami telahberkembang secara signifikan, dari produk obat-obatan, nutrisi,suplemen, hingga makanan dan minuman kesehatan, alat-alatkesehatan dan layanan kesehatan. Jaringan operasional kamimelayani seluruh kepulauan Indonesia, serta juga hadir di kawasanAsia Tenggara dan beberapa negara di Afrika.Sejalan dengan misi kami meningkatkan kesehatan untukkehidupan yang lebih baik, kami terus berupaya menyentuhkehidupan setiap individu, setiap hari, dan sepanjang hidupmereka.
  • 6. PT Kalbe Farma Tbk. • Laporan Tahunan 20124Performance HighlightsManagement ReportCompany ProfileManagement Discussion and AnalysisCorporate GovernanceCorporate Social ResponsibilityMeningkatkan Efektivitas PemasaranIncreasing Marketing EffectivenessMeningkatkan efektivitas pemasaran dan penjualan, melaluibranding management, program pemasaran dan penjualan& distribusi yang terfokus dan terintegrasi sehingga dapatmemperluas ketersediaan dan visibility produk.Improving marketing and sales effectiveness, through brandingmanagement, focused and integrated marketing and selling &distribution to spread product availability and visibilityStrategi 20122012 StrategyMemperkuat Portofolio BisnisStrengthening Business PortfolioMemperkuat portofolio bisnis melalui inovasi dalampengembangan produk baru, business model baru danmerger & acquisitions.Strengthening its business portfolio, through innovation inproduct development, new business model and mergers &acquisitions.PT Kalbe Farma Tbk. • Laporan Tahunan 20124
  • 7. PT Kalbe Farma Tbk. • 2012 Annual Report 5Memperluas dan Memperdalam Penetrasi PasarWidening and Deepening Market PenetrationMemperluas dan memperdalam penetrasi pasar melalui penunjukan 84 sub-distributor tambahan diIndonesia pada tahun 2012.Widening and deepening market penetration through appointment of 84 additional sub-distributors inIndonesia in 2012.PembelajaranTerus MenerusContinuous LearningMemastikan pelaksanaan yang primamelalui pembelajaran yang terus menerussehingga menghasilkan orang-orangKalbe yang kolaboratif, tegas, passionate,kompeten dan berjiwa Panca SradhaKalbe.Ensuring excellence in execution throughcontinuous learning to create Kalbepersonnel who are collaborative,assertive,passionate, competent and embody thespirit of Panca Sradha Kalbe.PePeKalimantanSulawesiJakartaSurabayaPapuaSumatraRDC JakartaRDC SurabayaCabang | BranchesSub-DistributorsPT Kalbe Farma Tbk. • 2012 Annual Report 5
  • 8. PT Kalbe Farma Tbk. • Laporan Tahunan 20126Performance HighlightsManagement ReportCompany ProfileManagement Discussion and AnalysisCorporate GovernanceCorporate Social ResponsibilityPT Kalbe Farma Tbk. (“Kalbe” atau “Perseroan”) menutup tahun 2012 dengan kinerja yang positif,membukukan peningkatan penjualan bersih sebesar 25,0% mencapai Rp13.636 miliar di akhir tahun.Divisi Obat Resep meraih penjualan bersih sebesar Rp3.288 miliar, sedangkan Divisi Produk Kesehatan,Nutrisi serta Divisi Distribusi dan Logistik membukukan penjualan bersih masing-masing sebesar Rp2.149miliar, Rp3.012 miliar dan Rp5.188 miliar. Laba tahun berjalan tumbuh 17,0% dari Rp1.482 miliar di tahun2011 menjadi Rp1.734 miliar di tahun 2012, serta membukukan peningkatan nilai pemegang saham yangberkelanjutan dengan laba per saham dasar mencapai Rp37,0 tahun 2012 dari Rp31,7 di tahun sebelumnyasetelah memperhitungkan pengaruh pemecahan saham.Tahun 2012 juga tahun yang penuh pencapaian bagi Kalbe, seiring keberhasilan Perseroan dalammeningkatkan kapasitas produksi dan distribusinya melalui inisiatif organik maupun anorganik, dengan totalbelanja modal mencapai Rp783 miliar di akhir tahun. Kegiatan pemasaran langsung ke konsumen berhasilmenjaring partisipasi yang luas, dengan lebih dari 500.000 peserta di tahun 2012.Karyawan kami telah membuktikan semangat sosialnya dengan dukungan aktif pada program-programtanggung jawab sosial Kalbe dengan melibatkan sekitar 2.350 karyawan sebagai relawan selama tahun2012.Pencapaian tahun 2012 telah memperkuat posisi strategis Kalbe untuk memanfaatkan berbagai peluang diIndonesia serta mendukung upaya Perseroan untuk terus mengembangkan usahanya dalam membangunkehadirannya di pasar regional.PT Kalbe Farma Tbk. (“Kalbe” or “the Company”) closed 2012 with solid performance, booking a record netsales increase of 25.0% to Rp13,636 Billion by the end of the year. The Prescription Pharmaceuticals Divisionrecorded net sales of Rp3,288 billion, while Kalbe’s Consumer Health, Nutritionals as well as Distribution andLogistics Divisions delivered Rp2,149 billion, Rp3,012 billion and Rp5,188 billion net sales respectively. Incomefor the year grew by 17.0%, from Rp1,482 billion to Rp1,734 billion in 2012, generating steady enhancementsto shareholders’ value with earnings per share booked at Rp37.0 in 2012 from Rp31.7 a year earlier after takinginto account the effect of the Company’s stock split.Last year was also a remarkable year for Kalbe as the Company continued to increase its manufacturing anddistribution capacities through organic and inorganic initiatives, with total capital expenditure spending of Rp783billion during the year. Our direct-to-consumer activities have successfully attracted widespread participation,with over 500,000 participants in 2012.Last but not least, our employees have manifested a high degree of volunteerism by actively supporting Kalbe’ssocial responsibility programs, with roughly 2,350 employees participation as volunteers in 2012 alone.The set of performance delivered in 2012 puts Kalbe at a better strategic position to capture the abundance ofopportunities Indonesia has to offer, and allow the Company to continue expanding its horizon to build strongerpresence in the regional market.Kinerja 20122012 Performance
  • 9. PT Kalbe Farma Tbk. • 2012 Annual Report 7Penjualan Bersih Divisi Obat ResepPrescription Pharmaceuticals Division Net SalesPenjualan Bersih Divisi Produk KesehatanConsumer Health Division Net SalesPenjualan Bersih Divisi NutrisiNutritionals Division Net SalesPenjualan Bersih Divisi Distribusi & LogistikDistribution & Logistics Division Net SalesTriliun TrillionTriliun TrillionTriliun TrillionTriliun TrillionPenjualan BersihNet SalesRp TriliunRp Trillion25.0%Pertumbuhan penjualanbersih di tahun 2012Net sales growth in 2012berpartisipasi dalam pemeriksaankesehatan gratis “SahabatPuskesmas” di 33 kota di Indonesiaparticipated in free health consultation“Sahabat Puskesmas” in 33 citiesacross Indonesiaambil bagian dalam kegiatan-kegiatan pemasaran langsung kepadakonsumenparticipated in Direct-to-Consumeractivities7.99.110.210.913.62008 2009 2010 2011 2012Aktivitas Pemasaran Langsung kepada KonsumenDirect-to-Consumer Marketing ActivitiesTanggung Jawab SosialCorporate Social Responsibilities18.4%16.7%24.5%34.0%2,350employeesover500,000participantsRp 3.29Rp 2.15Rp 3.01Rp 5.19
  • 10. PT Kalbe Farma Tbk. • Laporan Tahunan 20128Performance HighlightsManagement ReportCompany ProfileManagement Discussion and AnalysisCorporate GovernanceCorporate Social ResponsibilityIkhtisar KeuanganFinancial HighlightsDalam jutaan Rupiah, kecuali dinyatakan lain 2012 2011 2010 2009 2008 In million of Rupiah, unless otherwise statedLaporan Laba Rugi KomprehensifKonsolidasianConsolidated Statements ofComprehensive IncomePenjualan Bersih 13,636,405 10,911,860 10,226,789 9,087,348 7,877,366 Net SalesLaba Kotor 6,533,434 5,551,173 5,166,386 4,511,940 3,803,640 Gross ProfitLaba Sebelum Beban Pajak 2,308,017 1,987,259 1,770,435 1,471,072 1,178,022 Income Before TaxLaba Tahun Berjalan 1,775,099 1,522,957 1,343,799 1,049,667 825,504 Income for the YearLaba Tahun Berjalan yang Dapat DiatribusikanKepada:Income for the Year Attributable to:Pemilik Entitas Induk 1,733,928 1,482,237 1,286,330 929,004 706,822 Equity Holders of the Parent CompanyKepentingan Non-pengendali 41,171 40,720 57,469 120,663 118,682 Non-controlling InterestLaba Komprehensif Tahun Berjalan* 1,772,035 1,539,721 1,346,098 n/a n/a Comprehensive Income for the Year*Laba Komprehensif Tahun Berjalan* yang DapatDiatribusikan Kepada:Comprehensive Income for the Year* Attributable to:Pemilik Entitas Induk 1,730,864 1,498,877 1,288,629 n/a n/a Equity Holders of the Parent CompanyKepentingan Non-pengendali 41,171 40,844 57,469 n/a n/a Non-controlling InterestRata-rata Tertimbang Jumlah Saham yang Beredar(dalam jutaan saham)46,875 9,375 9,374 9,577 9,755 Weighted Average Number of Shares Outstanding(in million of shares)Laba Bersih per Saham (Rp)** 37 158 137 97 72 Earnings per Share (Rp)*** Penyajian Laba Komprehensif Tahun Berjalan berdasarkan Pernyataan Standar Akuntansi (PSAK) No. 1 (Revisi 2009) yang mulai diterapkan tanggal 1 Januari 2011 Presentation of Comprehensive Income for the Year based on the Statement of Financial Acccounting Standards (PSAK) No. 1 (Revised 2009) adopted on January 1, 2011** Pemecahan nilai nominal saham pada bulan Oktober 2012 Stock split in October 2012Laporan Posisi KeuanganKonsolidasianConsolidated Statements of FinancialPositionJumlah Aset 9,417,957 8,274,554 7,032,497 6,482,447 5,703,832 Total AssetsInvestasi pada Entitas Asosiasi 48,951 53,708 48,429 37,404 -901 Investment in Associated EntitiesJumlah Aset Lancar 6,441,711 5,956,123 5,037,270 4,701,893 4,168,055 Current AssetsJumlah Liabilitas 2,046,314 1,758,619 1,260,361 1,691,512 1,358,990 Total LiabilitiesPinjaman 204,625 140,706 25,344 340,678 405,504 Total DebtsJumlah Liabilitas Lancar 1,891,618 1,630,589 1,146,489 1,574,137 1,250,372 Current LiabilitiesModal Kerja Bersih 4,550,093 4,325,535 3,890,781 3,127,756 2,917,683 Net Working CapitalJumlah Ekuitas* 7,371,643 6,515,935 5,771,917 4,790,672 3,622,399 Total Equity** Sesuai dengan PSAK No. 1 (Revisi 2009) yang mulai diterapkan tanggal 1 Januari 2011, Kepentingan Non-pengendali pada tanggal 31 Desember 2010 dan 2009 telah direklasifikasi sebagaibagian dari Ekuitas Based on PSAK No. 1 (Revised 2009) effective January 1, 2011, Non-controlling Interest as of December 31, 2010 and 2009 has been reclassified as part of the EquityRasio-rasio Keuangan (%) Financial Ratios (%)Marjin Laba Kotor 47.91 50.87 50.52 49.65 48.29 Gross Profit MarginMarjin Laba Bersih 12.72 13.58 12.58 10.22 8.97 Net Income MarginRasio Laba terhadap Aset 18.41 17.91 18.29 14.33 12.39 Return on AssetsRasio Laba terhadap Ekuitas 23.52 22.75 22.29 19.39 19.51 Return on EquityRasio Lancar 340.54 365.27 439.36 298.70 333.35 Current RatioRasio Pinjaman terhadap Aset 2.17 1.70 0.36 5.26 7.11 Debt to Assets RatioRasio Pinjaman terhadap Ekuitas 2.77 2.15 0.44 7.10 11.19 Debt to Equity RatioAngka-angka pada seluruh tabel dan grafik dalam Laporan Tahunan ini menggunakan notasi Bahasa InggrisNumerical notations in all tables and graphs in this Annual Report are in English
  • 11. PT Kalbe Farma Tbk. • 2012 Annual Report 97,8779,08710,22710,91213,6362008 2009 2010 2011 2012Penjualan Bersih (Rp miliar)Net Sales (Rp billion)3,8044,5125,1665,5516,5332008 2009 2010 2011 2012Laba Kotor (Rp miliar)Gross Profit (Rp billion)19.5119.3922.29 22.7523.522008 2009 2010 2011 2012Rasio Laba terhadap Ekuitas (%)Return on Equity Ratio (%)7079291,2861,4821,7342008 2009 2010 2011 2012Laba Bersih (Rp miliar)Net Income (Rp billion)11.197.100.442.152.772008 2009 2010 2011 2012Rasio Pinjaman terhadap Ekuitas (%)Debt to Equity Ratio (%)141927322008 2009 2010 2011 2012Laba Bersih Per Saham (Rp)*Earnings Per Share (Rp)*37* Disesuaikan dengan jumlah lembar saham setelah pemecahan nilai nominal saham (stock split) pada tahun 2012.Adjusted to number of shares after stock split in 2012.
  • 12. PT Kalbe Farma Tbk. • Laporan Tahunan 201210Performance HighlightsManagement ReportCompany ProfileManagement Discussion and AnalysisCorporate GovernanceCorporate Social ResponsibilityIkhtisar SahamStock HighlightsGrafik Harga Saham dalam 10 Tahun Terakhir* 10-year Historical Stock Price Chart*Kalbe di Bursa Efek Indonesia Kalbe on the Indonesia Stock ExchangeHarga Saham Stock Price (Rp) Volume Perdagangan Transaction Volume (Unit)Jan400,000,000 1,200350,000,000 1,050300,000,000 900250,000,000 750200,000,000 600150,000,000 450100,000,000 30050,000,000 1500 0Feb Mar Apr May Jun Jul Aug Sep Oct Nov DecPemecahan Nilai Nominal SahamPerseroan melakukan pemecahan nilai nominal saham denganrasio 1:5 dari Rp50 menjadi Rp10 pada tanggal 2 Oktober2012. Jumlah saham meningkat dari 10.156.014.422 menjadi50.780.072.110 setelah pemecahan nilai nominal saham.Stock SplitThe Company conducted a 1:5 stock split from Rp50 per share toRp10 per share in October 2012. The number of shares increasedfrom 10,156,014,422 to 50,780,072,110 adter the stock split.1,2001,00080060040020002003100 110198238 25280260650 6801,0602004 2005 2006 2007 2008 2009 2010 2011 2012Harga Saham Stock Price (Rp)* Disesuaikan dengan jumlah lembar saham setelah pemecahan nilai nominal saham (stock split) pada tahun 2012.Adjusted to number of shares after stock split in 2012.
  • 13. PT Kalbe Farma Tbk. • 2012 Annual Report 11Kinerja Saham Tahun 2012 Stock Performance 2012 BulanTertinggiHighest (Rp)TerendahLowest (Rp)PenutupanClosing (Rp)Volume Rata-rata TransaksiAverage Trading VolumeMonthJanuari 730 675 705 26,900,119 JanuaryFebruari 720 680 700 39,684,881 FebruaryMaret 710 675 710 53,917,976 MarchApril 810 680 805 108,070,500 AprilMei 805 750 775 87,132,023 MayJuni 800 740 755 69,600,833 JuneJuli 780 735 765 72,197,500 JulyAgustus 800 750 775 64,228,158 AugustSeptember 940 780 940 64,931,500 SeptemberOktober 1,050 875 970 43,932,591 OctoberNovember 1,040 960 1,030 67,046,774 NovemberDesember 1,150 980 1,060 78,838,695 DecemberKronologis Pencatatan ObligasiChronological Bonds OverviewTanggal PenerbitanListing DateJumlah (Rp)Amount (Rp)Bunga / Jangka WaktuInterest / PeriodTanggal Jatuh TempoMaturity DateObligasi Kalbe Farma June 28, 2006 Rp300,000,000,000 13,625% p.a. / 3 years June 28, 2009 Kalbe Farma BondsHarga Saham, Volume Perdagangan dan Nilai Kapitalisasi Pasar per Triwulan 2011 - 2012 2011-2012 Quarterly Share Price, Trading Volume and Market Capitalization 2011 2012Q1 Q2 Q3 Q4 Q1 Q2 Q3 Q4Tertinggi (Rp) 680 745 745 720 730 810 940 1,150 Highest (Rp)Terendah (Rp) 490 645 530 595 675 680 735 875 Lowest (Rp)Penutupan (Rp) 680 675 650 680 710 755 940 1,060 Closing (Rp)Volume Rata-rataTransaksi Harian(saham)82,048,468 64,639,057 63,633,833 30,883,672 40,167,659 87,948,387 67,332,951 62,109,150 Average Daily TradingVolume (shares)Kapitalisasi Pasar(dalam jutaan rupiah)34,530,449 34,276,549 33,007,047 34,530,449 36,053,851 38,338,954 47,733,268 53,826,876 Market Capitalization(in million of Rupiah)Catatan | Note:Disesuaikan dengan dampak pemecahan nilai nominal saham (stock split) pada tahun 2012.Adjusted for the impact of stock split in 2012.
  • 14. Performance HighlightsManagement ReportCompany ProfileManagement Discussion and AnalysisCorporate GovernanceCorporate Social ResponsibilityPT Kalbe Farma Tbk. • Laporan Tahunan 201212Laporan Dewan KomisarisReport from the Board of CommissionersJohannes SetijonoPresiden KomisarisPresident CommissionerPerformance HighlightsManagement ReportCompany ProfileManagement Discussion and AnalysisCorporate GovernanceCorporate Social ResponsibilityPT Kalbe Farma Tbk. • Laporan Tahunan 201212
  • 15. PT Kalbe Farma Tbk. • 2012 Annual Report 13Yang Terhormat Para Pemegang Saham,Menengok ke belakang, tahun 2012 merupakan tahun penuhtantangan bagi ekonomi dunia, yang ditandai dengan masihberlanjutnyaperlambatanekonomi,terutamadiEropadanAmerikaSerikat. Di semester kedua tahun 2012, perlambatan ekonomidunia mulai mempengaruhi pertumbuhan di Cina dan India, duapasar negara berkembang terbesar dan pendorong pertumbuhanekonomi dunia, yang berakibat meningkatnya tekanan padaekspor komoditas Indonesia. Kekhawatiran penurunan eksporIndonesia, serta terus meningkatnya permintaan mata uang asinguntuk memenuhi kebutuhan impor, telah mendorong terjadinyapelemahan nilai Rupiah, yang mengalami depresiasi sebesar6,6% menjadi senilai Rp9.670 per 1 US$ di akhir tahun, dengandisertai dengan gejolak yang cukup berarti.Namun demikian, momentum pertumbuhan Indonesia terusberlanjut di tahun 2012, bukti ketangguhan dari ekonomidomestik. Indonesia menutup tahun 2012 dengan pertumbuhanekonomi sebesar 6,2%, sedikit lebih rendah dari pencapaiantahun sebelumnya sebesar 6,5%. Kinerja ini terutama didukungoleh terus meningkatnya permintaan domestik, rekor peningkataninvestasi baru dan pertumbuhan belanja pemerintah. Inflasidi tahun 2012 tetap terjaga di tingkat 4,3%, yang memberikandukungan positif untuk meraih kondisi makro ekonomi yangkondusif.Respected Shareholders,As we look back, 2012 was quite a challenging year for theglobal economy, marked with prolonged economy slowdown,particularly in Europe and the United States. During the secondterm of the year, we also experienced signs that the worldeconomic slowdown has dampened growth in China and India,two of the world’s largest emerging markets and growth drivers,which put increased pressure to Indonesia’s commodity exports.Concerns over Indonesia’s lower exports, coupled with ever-risingdemand for foreign exchange to finance import requirements,have triggered the weakening of Rupiah, which depreciated by6.6% to close at Rp9,670 per 1 US$ by the end of the year withsome notable volatility.However, Indonesia’s growth momentum continued in 2012,reflecting the resilience of the domestic economy. Indonesiaclosed the year with a growth rate of 6.2%, just slightly lower thanthe previous year’s figure of 6.5%. This performance was mainlyattributed to ongoing strong domestic demand, all-time highinflux of new investments and growth in government spending.Inflation in 2012 remained under control at 4.3%, providing furtherpositive support to the conducive macro environment.“Along with delivering strong financial results, theyear 2012 was marked with a set of capabilitybuilding initiatives to ensure Kalbe’s sustainablegrowth for the long term.”“Selain berhasil meraih kinerja keuanganyang solid, tahun 2012 juga ditandaidengan berbagai inisiatif peningkatankapabilitas untuk memastikankeberlanjutan pertumbuhan Kalbe dalamjangka panjang.”
  • 16. Performance HighlightsManagement ReportCompany ProfileManagement Discussion and AnalysisCorporate GovernanceCorporate Social ResponsibilityPT Kalbe Farma Tbk. • Laporan Tahunan 201214Kami menilai bahwa kestabilan kondisi ekonomi domestik telahmenjadi landasan bagi kinerja yang menggembirakan di industrifarmasi dan produk konsumen kesehatan Indonesia tahun 2012.Pertumbuhan ekonomi Indonesia yang berkelanjutan dalambeberapa tahun terakhir telah menciptakan golongan ekonomikelas menengah yang besar dengan pendapatan yang terusmeningkat. Didukung peningkatan daya beli konsumen danmasih relatif rendahnya penetrasi sektor kesehatan, industri iniberhasil meraih pertumbuhan sebesar 15,9% di tahun 2012.Tingkat pertumbuhan ini diprediksi akan meningkat seiringrencana Pemerintah untuk melaksanakan jaminan kesehatannasional tahun 2014, yang diantisipasi secara positif oleh industrifarmasi. Kami percaya bahwa dengan adanya asuransi kesehatannasional, pelayanan kesehatan yang sangat dibutuhkan akandiperoleh masyarakat Indonesia secara lebih luas, terutama untukmereka yang berasal dari golongan ekonomi lemah.Namun demikian, kami mengamati terjadinya peningkatanvolatilitas kurs nilai tukar Rupiah pada tahun 2012. Gejolak nilaimata uang yang terjadi akhir-akhir in menjadi faktor yang perludiperhatikan dengan seksama, mengingat kondisi strukturalindustri farmasi yang masih tinggi tingkat ketergantungannyapada impor bahan baku.Evaluasi Kinerja 2012Didukung oleh kondisi ekonomi yang menguntungkan, Kalbeberhasil meraih kinerja yang menggembirakan di tahun 2012,dengan pertumbuhan penjualan sebesar 25,0% mencapaiRp13.636 miliar di akhir tahun. Laba bersih Setelah Pajakmeningkat menjadi Rp1.734 miliar, 17,0% lebih tinggi dibandingpencapaian tahun 2011 sebesar Rp1.482 miliar. Laba bersih persaham meningkat menjadi Rp37 dibandingkan Rp32 di tahunsebelumnya.Para pemegang saham telah menyetujui pembayaran dividensebesar Rp95 per saham, atau ekuivalen dengan total sebesarRp891 miliar untuk tahun buku 2011, yang telah dibayarkanpada tanggal 17 Juli 2012. Rapat Umum Pemegang Saham LuarBiasa di tahun 2012 juga telah menyetujui pemecahan saham1:5 dari Rp50 menjadi Rp10 per saham untuk meningkatkanpartisipasi investor ritel. Dividen untuk tahun buku 2012 akandiputuskan pada Rapat Umum Pemegang Saham Tahunan yangdiselenggarakan pada bulan Mei 2013.Selain berhasil meraih kinerja keuangan yang solid, tahun 2012juga ditandai dengan berbagai inisiatif peningkatan kapabilitasuntuk memastikan keberlanjutan pertumbuhan Kalbe dalamjangka panjang.We noted how the overall stable domestic economic environmentunderpinned a year of strong performance for Indonesia’spharmaceuticals and consumer health industry. Indonesia’scontinuous economic growth in recent years has created amassive middle income population with rising disposableincome. Backed by rising consumer purchasing power and thestill relatively low healthcare penetration, the industry registered a15.9 % y-o-y growth in 2012. This growth is expected to acceleratewith the Government’s plan to implement the mandated universalhealthcare by 2014, generating positive anticipation withinthe industry. We believe that through this national healthcareinsurance system, the much-needed healthcare service will bemade available for more Indonesians, especially those from thelower income group.Nevertheless, we observed the growing volatility of the Rupiahexchange rate in 2012. Recent exchange rate volatility is a factorthat needs to be closely monitored, given the structural conditionof the pharmaceuticals industry that still relies on import foralmost all of its raw materials.2012 Performance ReviewWith the favorable operating environment, Kalbe achieved a strongperformance in 2012, booking a record sales increase of 25.0%to Rp13,636 billion by the end of the year. Net profit after tax roseto Rp1,734 billion, which is 17.0% higher versus Rp1,482 billionachieved in 2011. Earnings per share grew to Rp37 compared toRp32 in the previous year.Shareholders had approved the payment of dividend of Rp95per share, or equivalent to Rp891 billion in total for financialyear 2011, which was paid on July 17, 2012. The ExtraordinaryGeneral Meeting of Shareholders held in 2012 has also approveda 1:5 stocksplit from Rp50 to Rp10 per share to encourage moreparticipation from retail investors. The dividend for financialyear 2012 will be determined at the Annual General Meeting ofShareholders in May 2013.Along with delivering strong financial results, the year 2012 wasmarked with a set of capability building initiatives to ensureKalbe’s sustainable growth for the long term.
  • 17. PT Kalbe Farma Tbk. • 2012 Annual Report 15Guna mengantisipasi pertumbuhan usaha di masa mendatang,makin tumbuhnya permintaan dari masyarakat menengahIndonesia, serta pelaksanaan jaminan kesehatan nasional,manajemen telah meningkatkan nilai belanja modalnya menjadisebesar Rp783 miliar, jauh meningkat dari nilai di tahunsebelumnya sebesar Rp469 miliar.Direksi melanjutkan berbagai inisiatif untuk mempersiapkanKalbe dalam menyambut pelaksanaan asuransi kesehatan secaranasional pada tahun 2014. Belanja modal digunakan, antara lain,untuk meningkatkan kapasitas manufaktur melalui renovasi danpembangunan fasilitas baru, serta untuk memperluas jaringandistribusi Kalbe agar dapat menjangkau area pemasaran barudan meningkatkan ketersediaan produk di seluruh Indonesia.Fasilitasproduksibaru,yangkhususdibangununtukmemproduksiobat generik tanpa merek, telah mulai beroperasi di bulan Februari2012 sebagai persiapan untuk mengantisipasi pelaksanaansistem jaminan kesehatan nasional pada tahun 2014. Kami jugaberinisiatif memperkuat portofolio produk Kalbe melalui akuisisiPT Hale International, produsen minuman jus buah, serta aliansiuntuk membentuk PT Kalbe Milko Indonesia, untuk memproduksiproduk susu dalam bentuk cair.Sepanjang tahun 2012, Klinik Mitrasana, bidang usaha layanankesehatan Kalbe yang menawarkan layanan kesehatan satuatap, juga berhasil meraih kemajuan menggembirakan. Kamiterus melakukan penyempurnaan model bisnis agar dapatmemformulasikan produk dan layanan yang terbaik bagi segmentersebut. Mengingat besarnya peluang di sektor layanankesehatan, kami telah merencanakan untuk secara bertahapmemperkuat kehadiran Kalbe di pasar ini.Kegiatan penelitian dan pengembangan selalu menjadi bagiandari keunggulan Kalbe, mengingat kegiatan penelitian adalahfaktor penentu agar dapat bersaing di industri farmasi yangberbasis pengetahuan serta juga di sektor produk konsumenyang cepat berubah. Inovasi terus menjadi faktor pendorongyang mendukung pertumbuhan yang berkelanjutan.Di bidang produk kesehatan dan nutrisi, perluasan portofolioproduk dilaksanakan melalui pengembangan produk secaraorganik dan peluncuran produk yang dilaksanakan secaraseksama, guna menciptakan nilai tambah berupa manfaatkesehatan dan kenyamanan bagi konsumen. Di sektor obat resep,kami terus didukung oleh tim penelitian dan pengembangan yangberjumlah lebih dari 100 staf, untuk mengeksekusi strategi Kalbemenjadi perusahaan farmasi pertama yang meluncurkan versigenerik dari produk-produk yang habis masa patennya. Kami jugaterus membangun kompetensi di bidang kegiatan riset mutakhirTo anticipate future business growth, strong demand fromIndonesia’s growing middle class as well as the universalhealthcare implementation, management has raised its capitalexpenditure spending to Rp783 billion, a significant increase fromRp469 billion a year earlier.The Board of Directors continued the initiatives to prepare Kalbe towelcome the implementation of the national healthcare insurancesystem in 2014. Investment spending was used, among others,to raise manufacturing capacity by upgrading and adding newplants, as well as to expand Kalbe’s distribution network thatwill allow the Company to reach new market areas and improveproduct availability across the country.Our new production facility, dedicated for unbranded genericdrugs, has commenced operation in February 2012, providing uswith a considerable headway in the preparation of the nationalhealthcare insurance system roll-out in 2014. We took theinitiatives to strengthen our product portfolio with the acquisitionof PT Hale International, a fruit juice producer, and a joint ventureto establish PT Kalbe Milko Indonesia, set to introduce milk-based beverages in liquid format.The year 2012 also saw encouraging development in Kalbe’sretail health service venture, Mitrasana Clinics, an integratedclinic network providing healthcare service. We continued tofine tune the business model in the hope to formulate the bestproduct and service offering for the targeted segment. Given thehuge opportunity in the health service market, plans are alreadyin place to gradually develop the Company’s presence in thissector.Research and development activities have always been part ofKalbe’s leading edge, a key element to win in this knowledge-intensive pharmaceutical industry, and just as well in the fast-changing consumer sector. Innovation continued to be the maindriving force to support continuous growth.In the consumer health and nutritionals, product portfolioexpansion is conducted through organic product developmentand diligent product launching to always create value addedfor customers in terms of health benefits and convenience. Inthe prescription pharmaceuticals, we continue to rely on ourmore than 100-staff strong research and development team,to implement our strategy to become the first pharmaceuticalscompany to formulate the generic version of products enteringpatent expiration. We also strive to build our competence in moreadvanced research activities as an initiative to prepare for future
  • 18. Performance HighlightsManagement ReportCompany ProfileManagement Discussion and AnalysisCorporate GovernanceCorporate Social ResponsibilityPT Kalbe Farma Tbk. • Laporan Tahunan 201216sebagai bagian perseiapan untuk terapi masa depan. Melaluifokus pada kegiatan penelitian bioteknologi yang mutakhir,Perseroan terus mengembangkan produk-produk inovatif sertamenawarkan nilai tambah bagi konsumen. Pada tahun 2012,melalui salah satu anak perusahaan, Innogene Kalbiotech Pte.Ltd. (Innogene), Kalbe berhasil meraih penghargaan sebagai theFastest Growing Home Grown Company for Oncology Care dariFrost & Sullivan Asia Pacific, sebuah pengakuan internasionalatas upaya terus menerus kami untuk membangun hidup yanglebih baik.Pengembangan sumber daya manusia ditetapkan sebagaisalah satu prioritas penting oleh Direksi, suatu bukti bahwabagi Kalbe, sumber daya manusia adalah asetnya yang palingutama. Investasi pelatihan dan pengembangan terus berlanjut,bekerjasama dengan berbagai institusi pendidikan terkemuka,untuk menumbuhkan pemimpin-pemimpin masa depan Kalbe.Selain itu, Direksi telah bekerja keras untuk menanamkan nilai-nilai Panca Sradha Kalbe di seluruh organisasi, guna memastikankepatuhan pada standar etika profesional yang tertinggi olehseluruh jajaran karyawan Perseroan.Akhirnya, inisiatif usaha Kalbe di pasar internasional terus meraihhasil positif, terutama dengan memfokuskan pada potensi ekspordi pasar Asia Tenggara dan Afrika. Ke depan, kinerja yang telahdicapai akan menjadi landasan bagi cita-cita Kalbe untuk menjadiperusahaan kesehatan Indonesia terkemuka dengan kinerjausaha yang solid di pasar regional.Secara keseluruhan, Dewan Komisaris menyetujui danmendukung strategi yang ditempuh Direksi untuk mencapaipertumbuhan penjualan yang berkelanjutan baik secara organikmaupun anorganik. Kami mendukung inisiatif manajemen untukmengembangkan portofolio produk melalui peluncuran danpengembangan produk yang menawarkan manfaat kesehatandan kemudahan bagi konsumen.Pencapaian di tahun 2012 merupakan bukti keunggulan strategijangka panjang Kalbe, kemampuan eksekusi yang fokus danpenuh disiplin, serta keunggulan kepemimpinan dan kontribusiDireksi dan seluruh karyawan untuk mendorong Kalbe ke tingkatyang lebih tinggi. Dewan Komisaris berpendapat bahwa jajaranmanajemen telah berhasil meraih kinerja keseluruhan yang positifsejalan dengan inisiatif dan target strategis yang telah ditetapkanuntuk tahun 2012.therapy. With a focus on state-of-the-art biotechnology research,the Company continued to develop innovative products andcreate added value for the consumers. In 2012, through one of itssubsidiaries, Innogene Kalbiotech Pte. Ltd. (Innogene), Kalbe wasrecognized as the Fastest Growing Home Grown Company forOncology Care from Frost & Sullivan Asia Pacific, an internationalrecognition to our persistent scientific pursuit to build a betterlife.Human capital development is considered as one of the Boardof Directors’ top priorities, a clear testament of our recognitionthat people are Kalbe’s most important asset. Training anddevelopment investments continue in partnership with prominenteducation institutions to nurture Kalbe’s future leaders. Moreimportantly, the Board of Directors has put a lot of work to establishorganization-wide adoption of Panca Sradha Kalbe values,ensuring adherence to the highest standards of professionalethics by the entire workforce.Finally, Kalbe’s endeavor in the international market continuedto book positive results, targeting in particular export potentialsin Southeast Asia and Africa markets. Going forward, theperformance delivered will pave the way for Kalbe’s aspirationto become Indonesia’s premier healthcare company with strongbusiness presence in the regional market.Overall, the Board of Commissioners commend and support theBoard of Directors’ strategies to sustain revenue growth throughorganic and inorganic ways. We support the management’sinitiatives to expand product portfolio through diligent productlaunching and improvements to provide health benefits andconvenience to consumers.The achievements delivered in 2012, clearly confirm therobustness of Kalbe’s long-term strategy, our focused anddisciplined execution, as well as the leadership and contributionsof the Board of Directors and employees in advancing the standingof the Company to a new, higher level. It is to the opinion of theBoard of Commissioners that management has successfullydelivered an overall strong performance against the strategicinitiatives and targets set for 2012.
  • 19. PT Kalbe Farma Tbk. • 2012 Annual Report 17Tata Kelola Perusahaan dan Kegiatan DewanKomisarisSelain meraih kinerja keuangan dan pelaksanaan strategi untukpertumbuhan yang berkelanjutan, kami senantiasa memberikanperhatian pada aspek tata kelola perusahaan guna menjamintercapainya penciptaan nilai tambah yang berkelanjutan.Dewan Komisaris aktif terlibat dalam implementasi tata kelolaperusahaan. Melalui rapat-rapat Dewan Komisaris dan Komite,kami memastikan bahwa Perseroan mematuhi standar tertinggidi bidang kepatuhan, transparansi, akuntabilitas dan etikaprofesional.Di tahun 2012, Komite Audit telah secara resmi menerbitkanPiagam Komite Audit sesuai dengan ketentuan Bapepam-LK. Ditahun yang sama, Komite Audit juga menyelenggarakan rapat-rapat rutin dengan Unit Audit Internal guna mengawasi danmengevaluasi mekanisme kontrol internal Perseroan. Secaraperiodik, Komite Nominasi dan Komite Remunerasi melakukanpenelaahan dan penyempurnaan atas kebijakan nominasi danremunerasi Kalbe, untuk memastikan tercapainya keselarasandengan kebutuhan usaha Kalbe serta perkembangan terakhirdi industri farmasi. Komite Risiko Usaha bertanggung jawabmenangani risiko-risiko Perseroan dan memastikan tersedianyalandasan manajemen risiko yang solid. Akhirnya, Komite GCGterus memfokuskan pada pengawasan pelaksanaan tata kelolaperusahaan yang baik di seluruh organisasi.Total, sebanyak 4 rapat Dewan Komisaris dan 14 rapat komitetelah diselenggarakan di tahun 2012, frekuensi rapat yang cukupbagi kami untuk melakukan pengawasan menyeluruh atas kinerjaKalbe dan jajaran manajemennya. Laporan lengkap kegiatanDewan Komisaris dan Komite diuraikan lebih lanjut di bagian tatakelola perusahaan di dalam laporan tahunan ini.Perubahan ManajemenDi tahun 2012, Bapak Johanes Berchman Apik Ibrahim telahmengundurkan diri dari jabatannya sebagai Wakil PresidenDirektur Perseroan. Mewakili jajaran Dewan Komisaris, sayasampaikan ucapan terima kasih kepada Bapak JohanesBerchman Apik Ibrahim atas berbagai sumbangan pentingnyabagi Perseroan selama masa tugasnya.Terdapat beberapa perubahan pada susunan anggota Komite-komite di bawah Dewan Komisaris. Di akhir tahun 2012, KomiteNominasi dan Komite Remunerasi beranggotakan BapakJohannes Setijono sebagai ketua dan Ibu Bernadette Ruth IrawatiSetiady sebagai anggota Komite. Selain itu, susunan anggotaKomite Risiko Usaha kini terdiri atas Bapak Johannes Setijonosebagai ketua, serta Bapak Budi Dharma Wreksoatmodjo danBapak Vidjongtius sebagai angota Komite. Komite GCG kinidiketuai oleh Bapak Vidjongtius, dengan Bapak Johannes Setijonodan Bapak Budi Dharma Wreksoatmodjo sebagai penasihat.Corporate Governance and Board ofCommissioners ActivitiesIn addition to delivering financial strength and a sound strategyto maintain a steady growth, we continue to place a strongemphasis on good corporate governance to ensure sustainablevalue creation.The Board of Commissioners actively participate in theimplementation of good corporate governance. ThroughBoard and Committee meetings, we ensure that the Companyadheres to the highest standards of compliance, transparency,accountability and professional ethics.During the year, the Audit Committee has formally issued its AuditCommittee Charter in compliance with Bapepam-LK regulation.In 2012, the Committee also held regular meetings with theCompany’s Internal Audit Unit to monitor and evaluate Kalbe’sinternal control mechanism. The Nomination Committee andRemuneration Committee periodically review and revise Kalbe’snomination and remuneration policies to ensure alignment withKalbe’s business requirements and latest development in thepharmaceutical industry. Kalbe’s Business Risk Committee is incharge of addressing the Company’s risks and ensuring a properrisk management platform is in place within the Company. Finally,the GCG Committee continues to focus on overseeing GCGimplementation within the entire organization.A total of 4 Board of Commissioners’ meetings and 14 committeemeetings were held during 2012, a frequency that allows us toconduct thorough examination of the performance of Kalbe andits management team. A full account of the work of the Board andCommittees are fully described in the good corporate governancesection of this annual report.Board ChangesIn 2012, Johanes Berchman Apik Ibrahim has retired from hisposition as the Company’s Vice President Director. On behalf ofthe Board of Commissioners, I wish to thank Johanes BerchmanApik Ibrahim for his invaluable contribution to the Companyduring his tenure.There were also a few changes in the composition of the Boardof Commissioners’ Committees. By end of 2012, the NominationCommittee and Remuneration Committee comprise of JohannesSetijono as chairman and Bernadette Ruth Irawati Setiadyas member of the Committee. Meanwhile, the Business RiskCommittee now comprise of Johannes Setijono as chairman,with Budi Dharma Wreksoatmodjo and Vidjongtius as committeemembers. The GCG Committee is now led by Vidjongtius,with Johannes Setijono and Budi Dharma Wreksoatmodjo asadvisors.
  • 20. Performance HighlightsManagement ReportCompany ProfileManagement Discussion and AnalysisCorporate GovernanceCorporate Social ResponsibilityPT Kalbe Farma Tbk. • Laporan Tahunan 201218Johannes SetijonoPresiden Komisaris President CommissionerPandangan ke DepanKondisi makro ekonomi Indonesia yang positif diproyeksikanakan terus berlanjut di tahun 2013. Kondisi ekonomi dunia akanmembaik, di mana Cina dan Amerika Serikat telah memberikantanda-tandapemulihanyangpositif,dandapatmenjadipendukungpenting bagi kegiatan ekonomi global. Ke depan, prospek sektorkesehatan tetap sangat menjanjikan, terutama mengingat masihrendahnya tingkat pengeluaran untuk kebutuhan kesehatan diIndonesia.Dewan Komisaris telah melakukan penelaahan atas rencana usahaKalbe tahun 2013 yang diajukan oleh pihak manajemen. DewanKomisaris berpendapat, bahwa target-target pertumbuhan telahsejalan dengan prospek industri serta cita-cita Kalbe untuk terustumbuh dan mengembangkan pangsa pasarnya. Kami meyakinibahwa Direksi dapat kembali meraih kinerja yang positif di tahun-tahun mendatang.PenutupMewakili Dewan Komisaris, saya ingin menyampaikan ucapanterima kasih kepada seluruh pemangku kepentingan ataskerjasama dan kepercayaannya kepada kami. Kami jugasampaikan penghargaan kepada jajaran manajemen dan seluruhkaryawan, yang telah menunjukan dedikasinya kepada misi danvisi Perseroan. Penghargaan setinggi-tingginya kami sampaikankepada para konsumen setia kami, yang terus memberikankepercayaan kepada Kalbe. Bersama, kami berharap dapat terusmembangun hidup yang lebih baik.OutlookIndonesia’s positive operating environment is expected tocontinue in 2013. The global economy is definitely improving withChina and the U.S. showing encouraging recovery, giving someimportant support to global economic activity. In the long run,the outlook for the healthcare sector is very promising, especiallygiven the still relatively low healthcare spending in Indonesia.The Board of Commissioners has reviewed Kalbe’s businessplans for 2013 as formulated by management. In our opinion, thegrowth targets represent a fair indication of both the prospectsin the industry as well as our aspirations to grow and expand ourmarket share, and we are confident of the ability of the Directorsin achieving another excellent year going forward.ClosingOn behalf of the Board of Commissioners, I would like to thank allour stakeholders for their cooperation and confidence in us. Weapplaud the management and our employees who have showntremendous dedication to our mission and vision. But moreimportantly we recognize our loyal customers who continue toput their trust in Kalbe. Together, we hope to continue making adifference in building a better life.
  • 21. PT Kalbe Farma Tbk. • 2012 Annual Report 19Wahjudi PrakarsaKomisaris IndependenIndependent CommissionerFerdinand AryantoKomisarisCommissionerJohannes SetijonoPresiden KomisarisPresident CommissionerJozef Darmawan AngkasaKomisarisCommissionerFarid Anfasa MoeloekKomisaris IndependenIndependent CommissionerSantoso OenKomisarisCommissionerDuduk, kiri ke kananSeated, left to rightBerdiri, kiri ke kananStanding, left to right
  • 22. Performance HighlightsManagement ReportCompany ProfileManagement Discussion and AnalysisCorporate GovernanceCorporate Social ResponsibilityPT Kalbe Farma Tbk. • Laporan Tahunan 201220Performance HighlightsManagement ReportCompany ProfileManagement Discussion and AnalysisCorporate GovernanceCorporate Social ResponsibilityBernadette Ruth Irawati SetiadyPresiden DirekturPresident DirectorLaporan DireksiReport from the Board of DirectorsPT Kalbe Farma Tbk. • Laporan Tahunan 201220
  • 23. PT Kalbe Farma Tbk. • 2012 Annual Report 21Pemegang Saham Yang Terhormat,Puji syukur dan ucapan terima kasih kami haturkan kepadaTuhan Yang Maha Esa, yang telah memberikan bimbingan danperlindungan, sehingga Kalbe dapat terus meraih pertumbuhandi tahun 2012. Mewakili Direksi, dengan gembira saya laporkanberbagai pencapaian usaha positif selama tahun 2012.Kinerja Keuangan yang PositifTotal penjualan bersih mencapai Rp13.636 miliar di tahun 2012,meningkat 25,0% dari Rp10.912 miliar di 2011,serta berhasilmencapai 102,5% dari target penjualan yang ditetapkan di awaltahun.Pertumbuhan penjualan di tahun 2012 didorong oleh antaralain pertumbuhan penjualan signifikan sebesar 34,0% dariDivisi Distribusi dan Logistik mencapai Rp5.188 miliar, terutamaseiring bergabungnya prinsipal baru, PT Abbott Indonesia,yang meningkatkan kontribusi Divisi ini menjadi 38% dari totalpenjualan Kalbe. Divisi Obat Resep berhasil meraih pertumbuhanpenjualan sebesar 18,4% mencapai Rp3.288 miliar denganpangsa pasar terbesar yaitu 13% (sumber : IMS Health 2012),serta menyumbang sebesar 24% dari total penjualan bersih Kalbe.Divisi Produk Kesehatan Kalbe juga berkinerja positif, denganpertumbuhan penjualan sebesar 16,7% mencapai Rp2.149 miliardan menyumbang 16% dari total penjualan Perseroan. Penjualanbersih Divisi Nutrisi mencapai sebesar Rp3.012 miliar di tahun2012, tumbuh 24,5% dari pencapaian tahun sebelumnya danmenyumbang 22% dari total penjualan Kalbe.Distinguished Shareholders,Let us give praise and thanks to God Almighty who providedus with His guidance and protection, allowing Kalbe to deliversustained growth in 2012. On behalf of the Board of Directors, Iam pleased to report an excellent set of business performanceachieved in 2012.Solid Financial PerformanceIn 2012, Kalbe’s net sales reached Rp13,636 billion, rising by25.0% from Rp10,912 billion in 2011 and reaching 102.5% of thesales target set at the beginning of the year.Sales growth in 2012 was supported, among other things, byconsiderable 34.0% net sales growth to Rp5,188 billion bookedby Kalbe’s Distribution and Logistics Division, largely fromthe arrival of a new principal, PT Abbott Indonesia, boostingthe Division’s contribution to Kalbe’s total sales to 38%. TheCompany’s Prescription Pharmaceuticals Division booked a18.4% sales growth to Rp3,288 billion, commanding the largestmarket share of 13% (source : IMS Health 2012) and accounting24% of Kalbe’s total net sales. Kalbe’s Consumer Health Divisionalso enjoyed a good year, with 16.7% sales growth to Rp2,149billion and contributing 16% of the Company’s total sales. TheNutritionals Division’s net sales amounted to Rp3,012 billionin 2012, growing 24.5% from the previous year’s result andaccounting 22% of Kalbe’s total sales.“Efforts to improve sales and marketing effectivenesswill continue to be our priority, as well as developingstronger distribution network to expand productavailability.”“Upaya peningkatan efektivitas penjualandan pemasaran akan terus menjadiprioritas kami, disertai penguatan jaringandistribusi untuk memperluas ketersediaanproduk.”
  • 24. Performance HighlightsManagement ReportCompany ProfileManagement Discussion and AnalysisCorporate GovernanceCorporate Social ResponsibilityPT Kalbe Farma Tbk. • Laporan Tahunan 201222Pada tahun 2012 Perseroan mencatat pertumbuhan penjualanyang tinggi, sehingga terjadi perbaikan efisiensi biaya operasionalkarena biaya tidak bertumbuh secepat pertumbuhan penjualan.Rasio Biaya Operasional terhadap Nilai Penjualan Bersih jugamembaik 1,2%, dari 32,8% menjadi 31,6% di tahun 2012,terutama didorong oleh pertumbuhan penjualan yang signifikan.Di akhir 2012, laba operasional mencapai Rp2.218 miliar, 12,7%lebih tinggi dari pencapaian tahun sebelumnya, sedangkan lababersih mencapai Rp1.734 miliar, tumbuh 17,0% dibanding kinerja2011.Pencapaian Penting 2012Sebagaimana dijelaskan sebelumnya, Kalbe mencatat kinerjakeuangan yang kuat pada tahun 2012. Kami berpendapat hal inijuga didukung oleh kondisi makroekonomi Indonesia dan profildemografis yang kondusif. Didukung pertumbuhan ekonomiIndonesia secara konsisten sejak pulih pasca krisis keuangan Asiatahun 1997, telah terbentuk golongan ekonomi kelas menengahyang terus bertumbuh dengan daya beli yang semakin kuat.Dengan rasio penduduk usia produktif terhadap total pendudukyang meningkat, Indonesia tengah menikmati kondisi demografisyang kondusif yang akan mendukung pertumbuhan ekonomidi masa mendatang. Ditambah dengan perbaikan pendidikandan arus informasi, masyarakat Indonesia menunjukkan tingkatkesadaran kesehatan yang semakin tinggi. Dalam situasi yangpositif ini, kami yakin Kalbe akan mampu mempertahankanpertumbuhan penjualan yang sehat.Memperkuat portofolio bisnis tetap menjadi perhatian utama kami.Kami secara konsisten melaksanakan strategi untuk memperkuatportofolio bisnis melalui pengembangan produk yang inovatif dansecara anorganik melalui penggabungan usaha dan akuisisi.Kami tetap mempertahankan semangat inovasi dankewirausahaan seiring peluncuran produk-produk baru olehDivisi-divisi Obat Resep, Produk Kesehatan dan Nutrisi. Sejalandengan semangat kami mendorong inovasi untuk kehidupanyang lebih baik, unit pengembangan produk dan penelitian kamiterus menjadi pendorong utama peluncuran produk-produk baruyang menawarkan manfaat kesehatan dan kemudahan bagikonsumen.Pada Divisi Obat Resep, kami berupaya memastikan bahwakami mampu meluncurkan produk generik dari obat yang telahhabis masa perlindungan patennya. Dengan demikian, kamimemperoleh keunggulan sebagai pemain pertama dan mampumenguasai pasar. Dalam menghadapi pelaksanaan jaminankesehatan secara nasional, kami ingin memperkuat posisi kamipada segmen obat generik tidak bermerek. Sepanjang tahun2012, kami melanjutkan upaya persiapan untuk mengantisipasiIn 2012 the Company recorded strong sales growth, resulting inefficiency improvements of operating expenses, as the expensesdid not grow at the same rate as the top line. Operating Expensesto Net Sales Ratio also improved by 1.2% from 32.8% to 31.6%in 2012, mainly due to strong sales growth. By the end of the year,operating profit was recorded at Rp2,218 billion, 12.7% highercompared to the previous year, while net profit was registered atRp1,734 billion, growing 17.0% against 2011 performance.2012 Important HighlightsAs outlined above, Kalbe booked a strong set of financial resultsin 2012. We believe this is supported by Indonesia’s conducivemacroeconomic setting and demographic profile. As Indonesiahas been growing consistently after recovering from the Asianfinancial crisis in 1997, a huge middle income group has beenformed and continued to increase in size and spending power.With the ratio of working age population to the rest of thepopulation on the uptrend, Indonesia is enjoying a demographicdividend that will support further economic growth. Coupled withimproving education and information flow, Indonesians are alsoshowing rising health awareness. In this favorable setting, webelieve Kalbe will be able to sustain strong top line growth.Enhancing business portfolio continued to be one of our keyfocuses. We consistently execute the strategy to strengthen ourbusiness portfolio through innovative product development andinorganically through merger and acquisitions.We retain our spirit of innovation and entrepreneurship asevidenced by the number of new products launched by thePrescription Pharmaceuticals, Consumer Health and NutritionalsDivisions during the year. In line with our spirit to promoteinnovation for a better life, our research and business developmentunit continues to serve as the major driver behind Kalbe’s newproduct launching that offers health benefits and convenience tothe consumers.In the Prescription Pharmaceuticals Division, we strive to ensurethat we are able to introduce the first generic version of a productthat has reached patent expiry. This will provide us with a firstmover advantage and early market dominance. In light of theupcoming national healthcare insurance system, we target tostrengthen our presence in the unbranded generic segment.During 2012, we continued our preparation to anticipate the roll-out of the implementation of the national healthcare insurance
  • 25. PT Kalbe Farma Tbk. • 2012 Annual Report 23pelaksanaan jaminan kesehatan nasional pada tahun 2014. Kamimendukung keputusan Pemerintah untuk menjalankan programjaminan kesehatan nasional agar semakin banyak masyarakatIndonesiayangdapatmemanfaatkanlayanankesehatan,terutamagolongan ekonomi lemah. Untuk menyediakan obat dengan hargaterjangkau, kami terus memperkuat kemampuan produksi kamiagar mampu bersaing di segmen obat generik tidak bermerek.Di bulan Februari 2012, kami telah meresmikan fasilitas produksibaru khusus untuk memproduksi obat-obat generik, agar Kalbedapat memenuhi meningkatnya permintaan seiring implementasiprogram jaminan kesehatan nasional. Lebih lanjut, kami jugamemperkuat pengelolaan rantai pasokan dari awal sampaiakhir, dari pengadaan bahan baku hingga ketersediaan produkbagi konsumen, termasuk dengan melakukan investasi untukmengembangkan jaringan distribusi kami. Untuk memperkuatportofolio produk pada Divisi Obat Resep, saat ini kami tengahmenyelesaikan konstruksi pabrik obat kanker yang diharapkanakan mampu menyediakan produk obat kanker di Indonesiadengan harga lebih terjangkau. Pembangunan fasilitas produksibaru untuk obat-obat kanker berjalan sesuai rencana dandiharapkan dapat selesai pada tahun 2013.Di tahun 2012, Divisi Obat Resep meluncurkan 18 produk baru,yang terdiri dari 6 produk berlisensi, 9 produk generik bermerekdan 3 produk generik tanpa merek. Peluncuran produk barumerupakan hasil aktivitas riset dan pengembangan secara terusmenerus pada Divisi Obat Resep kami. Selain pengembanganproduk, riset dan pengembangan juga mencakup kegiatan risetdengan teknologi canggih untuk mempersiapkan pengembanganterapi masa depan.Di bulan Juli 2012, kami telah melakukan akuisisi 100 persensaham PT Hale International, produsen minuman kesehatan lokal,yang merupakan langkah strategis untuk dapat segera mengaksesfasilitas produksi siap pakai untuk mendukung ekspansi usahaDivisi Produk Kesehatan di segmen produk minuman. Selain itu,akuisisi PT Hale International telah menambah ragam pilihanproduk Divisi Produk Kesehatan dengan merek-merek produkminuman Original Love Juice dan Pomerama, yang memperkuatkehadiran kami di segmen minuman siap saji. Pada segmenminuman energi, kami melengkapi rangkaian produk Extra Jossdengan meluncurkan Nitros – minuman energi dalam bentukkonsentrat cair dengan kemasan yang inovatif. Divisi ProdukKesehatan aktif menghadirkan produk baru ke pasar, antara laindengan peluncuran produk Komix DT, varian baru obat batukKalbe yang menggunakan kemasan yang praktis.Guna mendukung perluasan usaha Divisi Nutrisi, pada bulanJuni 2012 kami telah menjalin kerjasama untuk membentukPT Kalbe Milko Indonesia yang akan menjadi basis produksiproduk-produk susu dalam bentuk cair. Langkah tersebut akansystem starting in 2014. We support the Government’s move toimplement the national healthcare insurance program, as moreIndonesians will benefit from healthcare service, particularly thosefrom the lower income group. To provide drugs at more affordableprice, we continue to strengthen our manufacturing capability tobe able to compete in the unbranded generics space. In February2012, we have inaugurated our new manufacturing facilitydedicated for generic drug production, which will allow Kalbe totap surging market demand following the universal healthcareimplementation. Further, we will also strengthen our supply chainmanagement from end-to-end, from procurement up to productavailability for consumers, including by investing to expand ourdistribution network. To strengthen our product portfolio in thePrescription Pharmaceuticals, we are in the process of finalizingthe construction of our new oncology factory, which is aimed atproviding oncology drugs at more affordable prices in Indonesia.The construction of the oncology facility goes according to planand set to be completed by 2013.In 2012, the Prescription Pharmaceuticals Division introduced18 new products, consisting of 6 licensed products, 9 brandedgeneric products and 3 unbranded generic products. New productlaunches are the result of continuous research and developmentactivities at our Prescription Pharmaceuticals Division. Asidefrom product development, research and development activitiesalso include state-of-the-art research works in anticipation of thedevelopment of future advanced therapies.In July 2012, we acquired a 100 percent stake in PT HaleInternational, a local health drink producer, which is a strategicmove to gain immediate access to a ready-to-use productionfacility to support the Consumer Health Division’s expansion inthe ready-to-drink segment. In addition, the acquisition bringsprominent ready-to-drink brands such as Original Love Juice andPomerama into the Consumer Health Division’s product selection,further strengthening our position in the ready-to-drink segment.In the energy drink segment, we further extended the Extra Jossproduct line by introducing Nitros – energy drink in concentratedliquid format with an innovative packaging. The Consumer HealthDivision was also active in bringing new products to the market,such as the launching of Komix DT, a new variant of Kalbe’s wellknown cough syrup that now features a convenient packaging.To support the Nutritionals Division’s business expansion, in June2012 we have forged an alliance to establish PT Kalbe MilkoIndonesia, which wil serve as production basis for liquid dairyproducts. This will enhance our product range in the Nutritionals
  • 26. Performance HighlightsManagement ReportCompany ProfileManagement Discussion and AnalysisCorporate GovernanceCorporate Social ResponsibilityPT Kalbe Farma Tbk. • Laporan Tahunan 201224memperkuat rangkaian produk pada Divisi Nutrisi yang sekarangterutama terdiri dari produk susu bubuk. Pada tahun 2012, kamijuga meluncurkan Fitbar, makanan ringan sehat yang rendahkalori dan tidak mengandung lemak trans maupun kolesterol,untuk memenuhi kebutuhan akan alternatif makanan ringan yanglebih sehat. Untuk memenuhi kebutuhan terhadap produk susubayi khusus, kami menambahkan seri Morinaga Soya dan P-HPbagi penderita alergi laktosa dan protein susu.Kami percaya distribusi adalah daya saing utama untukmempertahankan kepemimpinan pasar. Untuk memperkuatposisi kepemimpinan distribusi Kalbe, sebagai bagian darirencana ekspansi yang dimulai pada tahun 2011, kami telahmeningkatkan kapasitas pada cabang-cabang di 5 kota yaituBanjarmasin, Jember, Surakarta, Banda Aceh dan Denpasardi tahun 2012. Kami terus memperluas cakupan area distribusibekerja sama dengan para sub-distributor strategis di seluruhIndonesia. Klinik Mitrasana, jaringan klinik satu atap dari Kalbe,telah memperkenalkan model bisnis baru serta menambah 12outlet baru di area Jabodetabek, serta menutup tahun 2012dengan sebanyak 39 klinik dari 27 klinik di tahun sebelumnya.Untuk mendukung salah satu prioritas strategi yang ditetapkanuntuk 2012, sepanjang tahun Kalbe juga telah melaksanakanupaya-upaya untuk menyempurnakan kinerja pemasaran danpenjualannya. Kami telah meluncurkan berbagai kegiatanpemasaran above-the-line dan below-the-line yang kreatifsepanjang tahun 2012. Kami telah memperkenalkan kartu KalbeFamily Rewards Card di tahun 2012, yang menawarkan berbagaimanfaat bagi para pemegang kartu. Inisiatif Corporate Brandingjuga terus berlanjut, antara lain dengan menampilkan logo Kalbedi setiap iklan TV, untuk memposisikan merek korporat Kalbesebagai produsen terpercaya untuk produk-produk berkualitas.Kami telah meresmikan pembentukan Corporate Marketing Officedi tahun 2011, yang bertanggung jawab sebagai pusat seluruhkegiatan pemasaran di Grup Kalbe.Program pengembangan aset kami yang terpenting, sumber dayamanusia, tetap menjadi salah satu prioritas sepanjang tahun 2012.Kami sepenuhnya menyadari, bahwa untuk mendukung sasaranpertumbuhan usaha Perseroan yang tinggi, kami tidak sajaharus mengembangkan sumber daya manusia yang kompeten,melainkan juga insan-insan dengan nilai Panca Sradha Kalbeyang unggul, sebagai identitas korporasi yang mempersatukanseluruh karyawan Grup Kalbe. Pusat pelatihan kami yang baru,Kalbe Learning Center, telah diresmikan di tahun 2012 sebagaibukti komitmen Perseroan pada pengembangan sumber dayamanusia. Program-program pengembangan kepemimpinanKalbe General Management dan Kalbe Middle ManagementProgram, yang dirancang bersama institusi-institusi terkemuka diIndonesia maupun Asia, telah memasuki masing-masing tahunDivision which currently mostly consists of powdered milkproducts. In 2012, we introduced Fitbar, a healthy snack bar withlow calories, zero trans fat and cholesterol to meet the demandfor healthier snacking alternatives. To cater to the needs for morespecialized infant formula products, we have added MorinagaSoya and P-HP lines for lactose intolerance and milk proteinallergy.We believe that distribution is a key competitive edge to maintainour dominance in the market. To strengthen Kalbe’s distributionleadership, as part of the expansion plan started in 2011, we haveconsiderably upgraded the capacity of our branches in 5 citiesin Banjarmasin, Jember, Surakarta, Banda Aceh and Denpasarin 2012. We continued to widen coverage through cooperationwith strategic sub-distributors across the nation. MitrasanaClinics, Kalbe’s integrated clinic network, introduced a newbusiness model and added 12 new outlets in Greater Jakarta(Jabodetabek), closing 2012 with a total of 39 clinics from 27clinics a year earlier.In line with one of the strategic priorities set for 2012, theyear also witnessed Kalbe’s targeted efforts to enhance theCompany’s marketing and sales performance. We launched aseries of creative above-the-line and below-the-line activitiesduring the year. We launched the Kalbe Family Rewards Card in2012, which offers various benefits to the card holders for thepurchase of Kalbe products through our previously launchedonline store, Kalbe e-store. Combined with a home deliveryservice, we aim to provide more convenience for our consumers.Corporate Branding initiatives also continued, among others byflashing Kalbe logo in all TV ads, to position Kalbe’s corporatebrand as a leading trusted producer of high quality products.We have formally launched Kalbe’s Corporate Marketing Officesince 2011, tasked as the hub of all marketing activities withinthe Kalbe Group.Programs for the development of our most important asset,Kalbe’s human capital, remained one of our top prioritiesthroughout 2012. We recognize that to support the Company’srapid business growth objectives, we need to develop notjust highly competent human resources, but also people withstrong Panca Sradha Kalbe values as our corporate personalitythat unifies Kalbe Group’s entire workforce. A new trainingcenter, Kalbe Learning Center, was established during the year,underscoring our commitment to people development. KalbeGeneral Management and Kalbe Middle Management Programs,our leadership development program designed in associationwith leading institutions in Indonesia and Asia, has entered its3rd and 2nd year respectively, and continued to be attended byKalbe’s future leaders. By the end of the year, we organized 1
  • 27. PT Kalbe Farma Tbk. • 2012 Annual Report 25ke 3 dan ke 2, serta terus menjaring kepesertaan dari pemimpin-pemimpin masa depan Kalbe. Hingga akhir tahun 2012, kamitelah menyelenggarakan 1 kelas Kalbe General ManagementProgram dan 2 kelas Kalbe Middle Management Program dengandurasi 10 hari pelatihan untuk masing-masing kelas. Programdiikuti oleh 68 peserta dari berbagai anak perusahaan, denganinvestasi lebih dari Rp4 miliar untuk pengembangan sumber dayamanusia khususnya di level eksekutif. Secara keseluruhan, padatahun 2012 kami telah menginvestasikan sebanyak Rp20,6 miliaruntuk pengembangan sumber daya manusia.Kami senantiasa berupaya untuk mengoptimalkan nilai bagipemegang saham, termasuk melalui pembayaran dividen.Komitmen kami untuk meningkatkan nilai bagi pemegang sahamtercermin dari pembayaran dividen pada tahun 2012 sebesarRp95 rupiah per lembar saham atau sebesar Rp891 miliar untuktahun fiskal 2011, setara dengan rasio pembayaran dividensebesar 60%.Tantangan - TantanganPelemahan dan fluktuasi nilai Rupiah di tahun 2012, yangmengalami depresiasi hingga ke level Rp9.670 di akhir tahun,telah memberikan tekanan kepada industri farmasi, mengingatindustri ini masih sangat tergantung kepada impor untukmemenuhi sebagian besar bahan bakunya.Berkat praktik pengelolaan risiko yang berhati-hati, Kalbe berhasilmengatasi tekanan tersebut, tanpa pengaruh berarti kepadakinerja keseluruhan Perseroan di tahun 2012. Namun demikian,ke depan kami harus terus mencermati gejolak mata uang ini, danmengatasinya secara hati-hati di tengah kondisi ekonomi globalyang masih rapuh dan tidak menentu.Tata Kelola Perusahaan dan Tanggung JawabSosialWalaupun kinerja usaha yang solid merupakan elemen pentingdari keberhasilan kami, Perseroan senantiasa membangunkeseimbangan antara kinerja usaha dan praktik tata kelolaperusahaan yang baik.Kami berkomitmen pada standar transparansi dan akuntabilitasyang tertinggi kepada seluruh pemangku kepentingan yangmeliputi para pemegang saham/investor, konsumen, karyawan,regulator, mitra usaha, pemasok dan seluruh masyarakat.Perseroan percaya, bahwa budaya tata kelola yang baik dan sehatmemiliki manfaat besar bagi kegiatan usaha, mengingat budayatersebut dapat membangun nilai-nilai kepercayaan, percaya diridan profesionalisme dalam jangka panjang dalam hubungan kamidengan berbagai pemangku kepentingan.Tata kelola perusahaan yang baik harus didukung oleh tanggungjawab sebagai warga masyarakat yang baik, seiring upaya Kalbeuntuk membantu seluruh pemangku kepentingan meningkatkankesehatan menuju hidup yang lebih baik.Kalbe General Management Program class and 2 Kalbe MiddleManagement Program classes with a 10-day duration for each.The Programs were attended by 68 participants from varioussubsidiaries with an investment of Rp4 billion for human resourcesdevelopment in the executive level. In total, we have invested overRp20.6 billion for people development in year 2012.We strive to enhance shareholders’ value, including throughdividend payment. In 2012, our commitment to increase value forshareholders was evident from the dividend payment of Rp95 pershare or equivalent to Rp891 billion for fiscal year 2011, whichequals a 60% dividend payout ratio.Key ChallengesThe weakening and volatility of Rupiah in 2012, which depreciatedto Rp9,670 level by year end, has put some pressures to thepharmaceuticals industry, given the industry’s high dependenceon imports for most of its raw materials.Thankstoprudentriskmanagementpractices,Kalbehasbeenableto address this issue successfully, without significantly impactingthe Company’s overall performance in 2012. Nevertheless, goingforward we must closely monitor this exchange rate volatility,and exercise caution in dealing with the still uncertain and fragileworld economy.Corporate Governance and Corporate SocialResponsibilityWhile strong business performance is a key element of oursuccess, we never cease to balance business results with goodcorporate governance.We are committed to the highest standards of transparency andaccountability to all our stakeholders – shareholders/investors,customers, employees, regulators, business partners, vendorsand the public community at large. We believe that a strong andhealthy corporate governance culture makes good businesssense at all times as this culture builds trust, confidence andprofessionalism over the long term in our relationships with ourvarious stakeholders.Good corporate governance is complemented by good corporatecitizenship, as Kalbe strives to help all stakeholders to improvetheir health for a better life.
  • 28. Performance HighlightsManagement ReportCompany ProfileManagement Discussion and AnalysisCorporate GovernanceCorporate Social ResponsibilityPT Kalbe Farma Tbk. • Laporan Tahunan 201226Gerakan Kalbe Berbagi merupakan payung dari empat pilartanggungjawabsosialPerseroandibidangkesehatan,pendidikan,kesehatan, lingkungan, serta sarana & prasarana.Di bidang pendidikan, khususnya riset & teknologi, kami telahmeluncurkan program-program untuk menarik minat padapendidikan ilmu pengetahuan, antara lain melalui kegiatan KalbeJunior Scientist Award bagi para ilmuwan muda Indonesia, sertaRistek Kalbe Science Awards, kompetisi dua tahunan di bidangilmu pengetahuan yang diselenggarakan bersama KementerianRiset & Teknologi, sebagai penghargaan kepada para ilmuwanyang menyumbangkan manfaat riset nyata di bidang life sciencedan teknologi kesehatan. Program kesehatan Kalbe menawarkanakses gratis kelayanan kesehatan kepada masyarakatprasejahtera dan aktif menyebarluaskan manfaat hidup sehat,serta memberikan bantuan medis bagi para korban bencana alam.Di bidang perlindungan lingkungan, Kalbe telah memiliki sertifikasiISO 14001:2004, standar internasional manajemen lingkungan,untuk hampir semua fasilitas produksinya. Selain itu secara rutinkami menyelenggarakan program-program ramah lingkunganyang mengikutsertakan partisipasi aktif dari masyarakat di sekitarfasilitas kami. Akhirnya, kegiatan Kalbe di bidang pembangunansarana terus mendorong pengembangan fasilitas kesehatan danpendidikan, sejalan dengan sasaran kami untuk mengambil peranaktif dalam mendorong tercapainya hidup yang lebih baik.Sepanjang tahun 2012, lebih dari 100.000 orang telah menerimamanfaat dari program-program Kalbe Berbagi. Selain itu, sekitar2.350 relawan Kalbe di seluruh Indonesia turut berperan sertadalam kegiatan Kalbe Berbagi, bukti komitmen karyawan kamiterhadap misi sosial Kalbe.Penghargaan dan PengakuanBerkat dukungan banyak pihak, dengan gembira saya laporkanbahwa di tahun 2012 kami telah berhasil meraih berbagaipenghargaan domestik dan internasional. Antara lain, Perseroanberhasil meraih penghargaan sebagai the Most AdmiredEnterprise for Innovation category dalam ASEAN BusinessAwards 2012 dari ASEAN untuk 2 tahun berturut-turut, the BestManaged Companies Award dari Finance Asia, the Asia PacificFastest Growing Homegrown Company in Oncology CareAward dari Frost and Sullivan untuk Innogene, salah satu anakperusahaan Perseroan, serta penghargaan sebagai Indonesia’s2nd Best Investor Relations dari Asia Money. Produk-produk kamijuga menerima penghargaan antara lain Top Brand Awards 2012untuk Promag, Fatigon, Neo Entrostop dan Mixagrip, IndonesiaBest Brand Award untuk empat tahun berturut-turut 2009 – 2012untuk Komix pada Kategori Obat Batuk dari Swa dan Mars sertaIndonesia Most Favorite Youth Brand untuk Produk Makanan danOur Kalbe Care or ‘Kalbe Berbagi’ movement serves as anumbrella for Kalbe’s four social responsibilities pillars in health,education, environment and infrastructure.In education, particularly in research & technology, we introduceprograms to raise interest in science education, including theKalbe Junior Scientist Award targeting young Indonesian scientistsand Ristek Kalbe Science Awards, a biennial science competitionorganized with the Ministry of Research & Technology, to salutescientists with tangible research works in life sciences and healthrelated technologies. Kalbe’s healthcare programs offer freeaccess to health services to under-privileged communities andpromote the importance of living a healthy life, as well as providemedical assistance to victims of natural disasters. In the area ofenvironmental protection, Kalbe has received ISO 14001:2004certification, an international standard for environmentmanagement, for most of its production facilities. In addition,we regularly launch green programs inviting active participationfrom communities surrounding our facilities. Finally, Kalbe’sinfrastructure programs continue to assist in the development ofhealthcare and education facilities, in line with our goal to becomean active participant in promoting a better life.In 2012, over 100,000 beneficiaries have been touched by KalbeBerbagi’s programs. Moreover, over 2,350 Kalbe employeesthroughout Indonesia have participated in Kalbe Berbagi, a level ofvolunteerism that clearly demonstrates our people’s commitmentto Kalbe’s social responsibility mission.Awards and RecognitionsI am very pleased to note, that thanks to the hard work of many, in2012wehaveearnedsuchwiderangingdomesticandinternationalaccolades from the market. Among the highlights, the Companyreceived the Most Admired Enterprise for Innovation category inASEAN Business Awards 2012 from ASEAN for two consecutiveyears, the Best Managed Companies Award from FinanceAsia, the Asia Pacific Fastest Growing Homegrown Companyin Oncology Care Award from Frost and Sullivan for Innogene,the Company’s subsidiary, and was recognized as Indonesia’s2nd Best Investor Relations by Asia Money. Our products alsoreceived strong recognition such as the Top Brand Awards 2012for Promag, Fatigon, Neo Entrostop and Mixagrip, Indonesia BestBrand Award for four consecutive years 2009 – 2012 for Komix inthe Cough Medicine Category from Swa and Mars and IndonesiaMost Favorite Youth Brand in the Food and Beverage Product,Energy Drink for Extra Joss from MarkPlus Inc., Reader’s Choice
  • 29. PT Kalbe Farma Tbk. • 2012 Annual Report 27Minuman, Minuman Energi untuk Extra Joss dari MarkPlus Inc.,Reader’s Choice Award untuk Prenagen dari majalah Mother &Baby, dan Top Brand for Kids 2012 untuk Milna dari Frontier danMajalah Marketing. PT Enseval Putera Megatrading Tbk, anakperusahaan Perseroan yang menangani distribusi, menerimapenghargaan Indonesia Excellence Award 2012 dalam kategori“Indonesian Pharmaceutical Distributor Company of the Year”dari Frost & Sullivan.Para karyawan Kalbelah yang paling pantas menerimapenghargaan atas kinerja positif ini. Dengan dukungan seluruhkaryawan, saya yakin bahwa Perseroan dapat meraih lebihbanyak keberhasilan di masa mendatang.Pandangan dan Prioritas 2013Memasuki tahun yang baru, prospek ekonomi Indonesia tetappositif di tengah kondisi ekonomi dunia yang masih lemah,didorong oleh konsumsi domestik, iklim investasi yang positif,serta akselerasi pembangunan infrastruktur. Industri farmasiakan terus memperoleh manfaat dari prospek Indonesia yangpositif. Ke depan, meningkatnya daya beli serta masih rendahnyapenetrasi industri kesehatan akan tetap menjadi pendorongutama pertumbuhan industri.Dengan memperhatikan faktor-faktor di atas, berikut akan kamisampaikan beberapa prioritas strategi ke depan.Pertama, dengan dukungan penuh dari seluruh unit usahaGrup Kalbe, kami akan memperkuat kehadiran Kalbe di pasarregional melalui peluncuran produk dan penguatan jaringandistribusi di pasar regional, untuk memperkuat merek Kalbe diluar Indonesia.Seperti di tahun sebelumnya, peningkatan portofolio usaha akanterus berlanjut, melalui inovasi di bidang produk, proses danbisnis, serta melalui inisiatif penggabungan usaha dan akuisisi.Upaya peningkatan efektivitas penjualan dan pemasaran akanmenjadi prioritas selanjutnya, yang akan dilaksanakan melaluisinergi brand, pembukaan peluang pasar baru, serta penguatanjaringan distribusi untuk memperluas ketersediaan dankeberadaan produk.Pengembangan sumber daya manusia akan terus menjadiprioritas utama, dengan tujuan untuk senantiasa mengembangkanpemimpin-pemimpin masa depan yang kompeten, dengankarakter Panca Sradha Kalbe, yang menjadi nilai dasarPerseroan.Award for Prenagen dari Mother & Baby Magazine, and Top Brandfor Kids 2012 for Milna from Frontier and Marketing Magazine.PT Enseval Putera Megatrading Tbk, the Company’s subsidiaryin charge of distribution, also received Indonesia ExcellenceAward 2012 in the category of the “Indonesian PharmaceuticalDistributor Company of the Year” from Frost & Sullivan.Our employees deserve particular acknowledgement for theseachievements. They are the main reason why I am confidentKalbe will continue to be successful in the future.The Future and 2013 PrioritiesEntering a new year, Indonesia’s economic outlook remainspositive despite a weak global economy, thanks to a steadydomestic consumption, a robust investment climate andaccelerated infrastructure development. The pharmaceuticalsindustry will continue to benefit from Indonesia’s positive outlook.Rising purchasing power and the relatively low healthcarepenetration will remain the major drivers behind the industrygrowth going forward.Taking the above setting for the year, we would like to outlinesome of our major strategic priorities for the year ahead.First, with full support from the entire Kalbe Group’s businesses,we will strengthen Kalbe’s presence in the regional marketsthrough more aggressive product launching and distributionnetwork strengthening in the regional market, to strengthenKalbe’s brand outside Indonesia.Just as in the previous year, business portfolio strengtheningwill continue, through innovation in products, processes andbusinesses, as well as through merger and acquisitions.Efforts to improve Kalbe’s sales and marketing effectivenesswill be our next priority, addressed by better brand synergy,opening of new market opportunities, and by developing strongerdistribution footing to expand product availability and presence.Human capital development remains our ongoing top priority,aiming at continuously developing Kalbe’s competent futureleaders with Panca Sradha Kalbe, our key values.
  • 30. Performance HighlightsManagement ReportCompany ProfileManagement Discussion and AnalysisCorporate GovernanceCorporate Social ResponsibilityPT Kalbe Farma Tbk. • Laporan Tahunan 201228Akhirnya, pengelolaan rantai pasokan yang efektif merupakanfaktor kunci untuk meraih arus kas operasional yang optimal.Ucapan Terima KasihIzinkan saya untuk menutup laporan ini dengan menyampaikanucapan terima kasih kepada seluruh pemegang saham,konsumen, regulator, mitra, para karyawan, Dewan Komisaris,serta masyarakat luas atas dukungannya kepada Kalbe.Mewakili jajaran manajemen, saya juga menyampaikan terimakasih kepada Bapak Johanes Berchman Apik Ibrahim yangmengundurkan diri dari jabatan Wakil Direktur Utama Perseroanpada tahun 2012 atas pengabdiannya terhadap Grup Kalbeselama lebih dari 27 tahun.Jajaran Direksi dan manajemen senior tetap berkomitmen untukmemberikan yang terbaik agar dapat meningkatkan kinerja tahun2013, serta membangun masa depan yang lebih baik bagi Kalbedan seluruh pemangku kepentingan.Last but not least, effective supply chain management is essentialto maintain optimal operational cash flows.A Thank You NoteAllow me to close this message by extending our thank you toall of our shareholders, customers, regulators, partners, staffmembers, Board of Commissioners and the public at large fortheir continuing support to Kalbe.On behalf of management, I also wish to thank Johanes BerchmanApik Ibrahim who retired in 2012 as the Company’s Vice PresidentDirector, for his invaluable contributions to Kalbe for more than 27years.The Board of Directors and senior management are committed togiving our very best to further enhance our performance in 2013and to build a better future for Kalbe and its larger community ofstakeholders in the years ahead.Bernadette Ruth Irawati SetiadyPresiden Direktur President Director
  • 31. PT Kalbe Farma Tbk. • 2012 Annual Report 29Bernadette Ruth Irawati SetiadyPresiden DirekturPresident DirectorBudi Dharma WreksoatmodjoDirekturDirectorHerman WidjajaDirekturDirectorOngkie TedjasurjaDirekturDirectorVidjongtiusDirekturDirectorKiri ke kananLeft to right
  • 32. Performance HighlightsManagement ReportCompany ProfileManagement Discussion and AnalysisCorporate GovernanceCorporate Social ResponsibilityPT Kalbe Farma Tbk. • Laporan Tahunan 201230Informasi PerseroanCorporate InformationNama Perusahaan Name of CompanyPT Kalbe Farma Tbk.Bidang Usaha Line of BusinessFarmasi, Perdagangan, dan PerwakilanPharmaceuticals, Trading, and AgencyTanggal Pendirian Date of Establishment10 September 1966Dasar Hukum Pendirian Legal Basis of EstablishmentAkta No. 3 tanggal 10 September 1966, dibuat di hadapan Raden Imam SoesatyoPrawirokoesoemo, Wakil Notaris di JakartaDeed No. 3, dated September 10, 1966, drawn up before Raden Imam SoesatyoPrawirokoesoemo, a Deputy Notary in JakartaKepemilikan (per 31 Desember 2012)* Ownership (as of December 31, 2012)*PT Gira Sole Prima 10.17%PT Santa Seha Sanadi 9.62%PT Diptanala Bahana 9.49%PT Lucasta Murni Cemerlang 9.47%PT Ladang Ira Panen 9.22%PT Bina Arta Charisma 8.66%Publik Public 43.37%* tidak termasuk saham yang dibeli kembali excluding treasury stockModal Dasar Authorized CapitalRp 850,000,000,000Modal Ditempatkan dan Disetor Penuh Issued and Fully Paid CapitalRp 507,800,721,100Bursa Stock ExchangeBursa Efek IndonesiaIndonesia Stock Exchange Building, Tower 1Jl. Jend. Sudirman Kav 52-53Jakarta 12190, IndonesiaTel. (62-21) 515 0515Fax. (62-21) 515 0330E-mail: callcenter@idx.co.idKode Saham Ticker CodeKLBFTanggal Pencatatan Listing Date30 Juli 1991Kantor Pusat Head OfficeGedung KALBEJl. Let. Jend. Suprapto Kav. 4Cempaka Putih, Jakarta 10510, IndonesiaTel. (62-21) 4287 3888 - 89Fax. (62-21) 4287 3678Web: www.kalbe.co.idPabrik FactoryKawasan Industri Delta SilikonJl. M.H. Thamrin Blok A3 - 1Lippo Cikarang, Bekasi 17550IndonesiaTel. (62-21) 8990 7333 (62-21) 8990 7337Fax. (62-21) 8990 7360Dana Pensiun Pension FundDana Pensiun Kalbe FarmaSumber Daya Manusia Human Resources10,030 karyawan tetap permanent employees7,670 karyawan tidak tetap contractual employeesHubungi Kami Contact UsGedung KALBEJl. Let. Jend. Suprapto Kav. 4Cempaka Putih, Jakarta 10510, IndonesiaTel. (62-21) 4287 3888(62-21) 4287 3889Fax. (62-21) 4287 3678Sekretaris Perusahaan Corporate SecretaryE-mail: vidjongtius@kalbe.co.idHubungan Investor Investor RelationsE-mail: investor.relations@kalbe.co.idKomunikasi Korporat Corporate CommunicationE-mail: corp.comm@kalbe.co.idLayanan Pelanggan Customer CareTel. 0800-140-2000 (toll free)E-mail: customer@kalbenutritionals.com
  • 33. PT Kalbe Farma Tbk. • 2012 Annual Report 31Nama dan Alamat Lembaga dan/atau Profesi Penunjang Pasar ModalNames and Addresses of Institutions and/or Capital Market Supporting ProfessionalsBursa Stock ExchangeBursa Efek IndonesiaIndonesia Stock Exchange Building, Tower 1Jl. Jend. Sudirman Kav 52-53Jakarta 12190, IndonesiaTel. (62-21) 515 0515Fax. (62-21) 515 0330E-mail: callcenter@idx.co.idAuditor AuditorPurwantono, Suherman & Surja (Ernst & Young)Indonesia Stock Exchange Building, Tower 2, 7th FloorJl. Jend. Sudirman Kav. 52-53Jakarta 12190, IndonesiaTel. (62-21) 5289 5000Fax. (62-21) 5289 4100Biro Administrasi Efek Share RegistrarPT Adimitra TransferindoPlaza Property, 2nd FloorKompleks Pertokoan Pulomas Blok VIII No. 1Jl. Perintis KemerdekaanJakarta 13210, IndonesiaTel. (62-21) 4788 1515Fax. (62-21) 470 9697Notaris NotaryDr. Irawan Soerodjo, SH, Msi.Komp. Ketapang Indah Blok B-2 No. 4-5Jl. K.H. Zainul Arifin No. 2, Jakarta 11140Tel. (62-21) 630 1511Fax. (62-21) 633 7851DivisiDivisions• Divisi Obat Resep Prescription Pharmaceuticals Division• Divisi Produk Kesehatan Consumer Health Division• Divisi Nutrisi Nutritionals Division• Divisi Distribusi & Logistik Distribution & Logistics Division
  • 34. Performance HighlightsManagement ReportCompany ProfileManagement Discussion and AnalysisCorporate GovernanceCorporate Social ResponsibilityPT Kalbe Farma Tbk. • Laporan Tahunan 201232Sejarah Kalbe Farma diawali dari garasi pendiri Perseroan tahun1966 sebagai perusahaan produk kesehatan dengan prinsip-prinsip dasar: inovasi, merek yang kuat dan manajemen prima.Dengan pedoman “Panca Sradha Kalbe” sebagai nilai dasarPerseroan, Kalbe berhasil meraih pertumbuhan yang solid danmencatatkan sebagai perusahaan publik tahun 1991 di BursaEfek Jakarta dan Bursa Efek Surabaya (sekarang bergabungmenjadi Bursa Efek Indonesia).Melalui proses pertumbuhan organik dan penggabungan usaha& akuisisi, kegiatan usaha Kalbe berkembang meliputi 22 anakperusahaan, dalam empat kelompok divisi usaha: divisi obatresep dengan kontribusi sebesar 24% terhadap pendapatantotal, divisi produk kesehatan dengan kontribusi 16%, divisinutrisi dengan kontribusi 22%, serta divisi distribusi dan logistikdengan kontribusi 38%. Pada tahun 2012, Perseroan melakukanakusisi 100% saham PT Hale International, produsen minumankesehatan, untuk terus memperkuat posisi Kalbe di pasarIndonesia yang terus berkembang.Dengan dukungan lebih dari 17.000 karyawan, termasuk 6.000tenaga penjualan dan pemasaran, kegiatan usaha Perseroanmencakup seluruh wilayah kepulauan Indonesia dan keberadaandi pasar internasional yang terus berkembang.The story of Kalbe Farma begins from a humble beginning in thefounder’s garage in 1966 as a pharmaceutical company driven bya set of basic principles: innovation, strong brands and excellentmanagement.Guided by “Panca Sradha Kalbe” as the Company’s corporatevalues, Kalbe establishes a solid growth curve over the pastdecades and went public in 1991 by listing on the Jakarta StockExchange and Surabaya Stock Exchange (now merged asIndonesia Stock Exchange).Growing both organically and through mergers & acquisitions,Kalbe’s business interests are spread across 22 subsidiaries,grouped into four business divisions: the prescriptionpharmaceuticals division with 24% revenue contribution to totalrevenue, consumer health with 16% contribution, nutritionalswith 22% contribution, and distribution and logistics with 38%contribution. In 2012, the Company sealed a deal to take 100%shares in PT Hale International, a producer of health beverages,to further strengthen its position in the burgeoning Indonesianmarket.With over 17,000 employees, including 6,000 sales and marketingprofessionals, the Company’s operations cover the entireIndonesian archipelago with a growing footing in internationalmarkets.Sekilas KALBE FARMAKALBE FARMA at a Glance
  • 35. PT Kalbe Farma Tbk. • 2012 Annual Report 33Di Indonesia, Kalbe mampu menjangkau 70% dokter umum, 90%dokter spesialis, 100% rumah sakit, 100% apotek untuk pasarobat-obat resep serta 80% untuk pasar produk kesehatan dannutrisi. Di pasar internasional, Perseroan telah hadir di pasar AsiaTenggara dan Afrika, serta menjadi perusahaan produk kesehatannasional yang dapat bersaing di pasar ekspor.Semangat inovasi untuk kehidupan yang lebih baik menjadi bagiantak terpisahkan dari seluruh kegiatan usaha Kalbe. Aktivitas risetdan pengembangan telah menghasilkan produk-produk inovatifdengan nilai unggul untuk memenuhi kebutuhan masyarakat.Agar dapat menjangkau seluruh kepulauan nusantara, Kalbeterus meningkatkan kapasitas dan kualitas layanan distribusinya.Upaya penyempurnaan integrasi mata rantai pasokan senantiasamenjadi salah satu prioritas utama Kalbe guna meningkatkanefisiensi dan tingkat layanan.Kini, Kalbe merupakan penyedia “layanan kesehatankomprehensif” yang terdepan, produk obat-obatan, nutrisi,makanan dan minuman kesehatan hingga alat-alat kesehatantermasuk pelayanan kesehatan primer. Kalbe adalah perusahaanproduk kesehatan publik yang terbesar di Asia Tenggara dengannilai kapitalisasi pasar sebesar Rp 53,8 triliun dan omset penjualanRp 13,6 triliun di akhir 2012.In Indonesia, Kalbe maintains coverage to over 70% of generalpractitioners, 90% of specialists, 100% of hospitals and 100%of pharmacies for the prescription pharmaceuticals market, aswell as 80% for the consumer health and nutritionals markets.Internationally, the Company has established its footprint inSoutheast Asia and Africa, positioning Kalbe as a nationalpharmaceuticals company with a competitive edge in the exportmarket.The spirit of innovation for a better life is part of the very fabric ofKalbe’s entire business processes. Research and developmentactivities generate innovative and high-value products addressingthe needs of society. To serve the nation’s vast archipelago,Kalbe continues to increase both the capacity and quality of itsdistribution services. Continuous improvement of its supply chainintegration is always among Kalbe’s key priorities to improveefficiency and level of service.Today Kalbe is a leading provider of “comprehensive healthcaresolutions”, from pharmaceuticals, nutrition, health foods andbeverages to medical devices, including primary healthcareservices. Kalbe is the largest publicly-listed pharmaceuticalcompany in Southeast Asia, with a market capitalization of Rp53.8 trillion and Rp 13.6 trillion sales turnover by end of 2012.
  • 36. Performance HighlightsManagement ReportCompany ProfileManagement Discussion and AnalysisCorporate GovernanceCorporate Social ResponsibilityPT Kalbe Farma Tbk. • Laporan Tahunan 201234Divisi Obat ResepPrescription Pharmaceuticals DivisionDivisi NutrisiNutritionals DivisionDivisi Produk KesehatanConsumer Health DivisionDivisi Obat Resep Kalbe menawarkanrangkaian obat resep yang lengkapuntuk seluruh segmen ekonomimasyarakat, dari obat generik tidakbermerek, obat generik bermerekhingga obat paten. Produk-produkdidistribusikan ke rumah sakit, apotekhingga toko obat di seluruh Indonesiamelaluijaringandistribusiyangterintegrasi.Kalbe juga memiliki tim pemasaran yangsolid, yang dikelompokkan untuk masing-masing segmen dan kelas terapi gunamenjamin kegiatan pemasaran yangterfokus dan efektif.Beberapa produk unggulan Kalbe antaralain adalah Brainact, Cefspan, Mycoral,Cernevit, Cravit, Neuralgin, Broadced,Neurotam, Hemapo, dan CPG.Divisi Nutrisi Kalbe menawarkan ragam produk-produk nutrisi yang lengkap untuk setiap tahapanpenting dalam kehidupan konsumen, mulai daribayi, balita, anak-anak, pra-remaja, dewasa, ibuhamil dan menyusui, hingga usia senja; sertaproduk-produk nutrisi untuk konsumen dengankebutuhan khusus.Beberapa produk unggulan Kalbe antara lainadalah Morinaga Chil Kid, Morinaga Chil School,Morinaga Chil Mil, Morinaga BMT, Prenagen,Milna dan Diabetasol yang diluncurkan sejaklebih dari 20 tahun yang lalu dan menguasaipangsa pasar yang dominan di Indonesia dantelah memperoleh beberapa penghargaan antaralain Reader’s Choice Award untuk Prenagendari majalah Mother & Baby dan Top Brand forKids 2012 untuk Milna dari Frontier dan MajalahMarketing. Kalbe terus melengkapi portofolioproduknya dengan meluncurkan beberapaproduk baru yang menawarkan manfaatkesehatan bagi konsumen seperti Zee, Fitbar,Entrasol dan Nutrive Benecol.Kalbe’s Nutritionals Division showcases acomplete product range for all important stages inconsumer’s lives, from infants, toddlers, children,tweens, adults, expectant and lactating mothers,up to the elderly, as well as nutritional productsfor consumers with special medical needs.Some of Kalbe’s top products include MorinagaChil Kid, Morinaga Chil School, Morinaga Chil Mil,Morinaga BMT, Prenagen, Milna and Diabetasol,which have been launched over 20 years ago andcommand dominant market shares in Indonesiaand have been awarded Reader’s Choice Awardfor Prenagen from Mother & Baby Magazine andTop Brand for Kids 2012 for Milna from Frontierdan Marketing Magazine. Kalbe continues toenhance its product portfolio by introducingseveral new products offering health benefitsfor consumers such as Zee, Fitbar, Entrasol andNutrive Benecol.Divisi Produk Kesehatan Kalbe meliputikategori produk obat bebas bersifat kuratifserta produk-produk konsumsi kesehatanyang memiliki manfaat kesehatan sepertisuplemen dan produk bersifat preventiflainnya, minuman energi serta produkminuman kesehatan. Portofolio kategoriproduk obat bebas Kalbe mencakup lebihdari 6 kelas terapi obat bebas denganmerek-merek dominan yang menguasaipangsa pasar dalam beberapa dekadeterakhir.Beberapa produk unggulan Kalbe sepertiPromag, Komix, Mixagrip dan Entrostoptelah menerima berbagai penghargaandari berbagai institusi. Produk unggulanKalbe lainnya antara lain adalah Woods,Fatigon, Procold, Mextril, Extra Joss,Hydro Coco dan Original Love Juice.Divisi UsahaBusiness DivisionsPT Kalbe Farma Tbk • Laporan Tahunan 201234Kalbe’s Consumer Health Division offersover-the-counter drugs with therapeuticbenefits, consumer products with healthbenefits, including supplements andother preventive products, along withenergy drinks and healthy ready-to-drink products. Kalbe’s over-the-counterportfolio category covers more than 6therapeutical classes with strong brands,commanding a dominant market share,over recent decades.Some of Kalbe’s top products such asPromag, Komix, Mixagrip and Entrostophave been awarded by various institutions.Some other Kalbe’s top products areWoods, Fatigon, Procold, Mextril, ExtraJoss, Hydro Coco and Original LoveJuice.Kalbe’s Prescription PharmaceuticalsDivision features a complete productrange for all segments, from unbrandedgeneric drugs, branded generics upto licensed drugs. These products aredistributed to hospitals, pharmacies anddrug stores across the archipelago throughan integrated distribution network. Kalbealso has a strong marketing team, dividedinto groups dedicated to each segmentand therapeutical class, allowing focusedand effective marketing activities.Some of Kalbe’s top products includeBrainact, Cefspan, Mycoral, Cernevit,Cravit, Neuralgin, Broadced, Neurotam,Hemapo, and CPG.
  • 37. PT Kalbe Farma Tbk. • 2012 Annual Report 35Divisi Distribusi & LogistikDistribution & Logistics DivisionUntukmenjaminketersediaanprodukdiseluruhwilayahIndonesia,Kalbe mempunyai Divisi Distribusi dan Logistik yang dijalankanoleh anak perusahaannya PT Enseval Putera Megatrading Tbk.yang bertanggung jawab atas distribusi produk-produk Kalbe danproduk prinsipal pihak ketiga ke lebih dari 1 juta outlet di seluruhpelosok Indonesia. Di samping itu, Kalbe juga telah memperluasportofolio bisnis Divisi tersebut dengan perdagangan bahan bakukimia, peralatan kesehatan serta layanan jasa kesehatan secararitel.Jaringan distribusi dan logistik Kalbe merupakan jaringandistribusi yang paling luas di Indonesia untuk produk farmasi.Dengan dukungan 2 Pusat Distribusi Regional (RegionalDistribution Center atau RDC) di kota Jakarta dan Surabaya serta65 cabang yang tersebar di 47 kota, Kalbe mampu menjangkaulebih dari 1 juta outlet di seluruh Indonesia secara langsung dantidak langsung bekerja sama dengan perusahaan distribusi lokal.Beberapa prinsipal pihak ketiga utama antara lain adalahPT Abbott Indonesia, PT Mead Johnson Indonesia, PT L’OrealIndonesia, PT Kara Santan Pertama dan PT BeiersdorfIndonesia.35To ensure product availability across the entire nation, Kalbe hasbuilt a Distribution and Logistics Division, run by its subsidiaryPT Enseval Putera Megatrading Tbk., which is responsible fordelivering Kalbe’s and third party principal’s products to over1 million of outlets in Indonesia. In addition, Kalbe has alsoexpanded the business portfolio of the Division to include rawmaterial trading, medical devices and retail health services.Kalbe’s distribution and logistics network for pharmaceuticalsproducts is the most extensive in Indonesia. Supported by 2Regional Distribution Centers (RDCs) in Jakarta and Surabaya,and 65 branches in 47 cities, Kalbe reaches more than1 million outlets all over Indonesia, both directly and indirectly, incooperation with local sub-distributors.Some of the major third party principals include PT AbbottIndonesia, PT Mead Johnson Indonesia, PT L’Oreal Indonesia,PT Kara Santan Pertama and PT Beiersdorf Indonesia.PT Kalbe Farma Tbk • 2012 Annual Report
  • 38. Performance HighlightsManagement ReportCompany ProfileManagement Discussion and AnalysisCorporate GovernanceCorporate Social ResponsibilityPT Kalbe Farma Tbk. • Laporan Tahunan 201236Rapat Umum Pemegang SahamGeneral Meeting of ShareholdersDewan KomisarisBoard of Commissioners President Commissioner : Johannes Setijono Commissioner : Santoso Oen Jozef Darmawan Angkasa Ferdinand Aryanto Independent Commissioner : Wahjudi Prakarsa Farid Anfasa MoeloekDireksiBoard of Directors President Director : Bernadette Ruth Irawati Setiady Director : Budi Dharma Wreksoatmodjo Herman Widjaja Vidjongtius Ongkie TedjasurjaAudit CommitteeFarid Anfasa MoeloekNomination CommitteeJohannes SetijonoRemuneration CommitteeJohannes SetijonoRisk Management CommitteeJohannes SetijonoGCG CommitteeVidjongtiusCorporate Function Strategic Business UnitPharmaceuticalsHerman WidjajaConsumer HealthJohanes Berchman Apik IbrahimNutritionalsOngkie TedjasurjaDistribution & LogisticsBudi Dharma WreksoatmodjoBiopharmaBernadette Ruth Irawati SetiadyEye CareOngkie TedjasurjaMedical DevicesHerman WidjajaHealth ServicesBudi Dharma WreksoatmodjoInternationalOngkie TedjasurjaCorporate MarketingOfficeOngkie TedjasurjaCorporate ManagementSystem & BusinessDevelopmentSie DjohanCorporate HumanResourcesLanny SoputroCorporate LegalHerman WidjajaCorporateCommunication & CSRIrawati Koswara (Advisor)Corporate InformationTechnology & SystemVidjongtiusCorporate StrategicInvestmentJose C. A. CamelloCorporate Treasury &Investor RelationsJoyce V. HandajaniCorporate Finance,Accounting & TaxBernadus Karmin WinataCorporate Audit &Risk ManagementKurniawan TedjoStruktur OrganisasiOrganization Structure
  • 39. PT Kalbe Farma Tbk. • 2012 Annual Report 370.003%Struktur Kepemilikan Perseroandan Entitas AnakShareholding Structure of the Company and SubsidiariesPenjualan dan Distribusi | Sale and DistributionPerusahaan Terbuka | Listed CompanyMakanan Kesehatan | NutritionalsMinuman Kesehatan | Health BeveragesFarmasi | Pharmaceuticals0.4%KalbePharma Metric Labs81.64%Dankos Farma99.975%Innogene KalbiotechPte. Ltd93.34%Finusolprima Farma99.994%Bifarma Adiluhung99.996%Sanghiang Perkasa99.997%Kalbe MorinagaIndonesia70%Kalbe Milko Indonesia51%Orange Kalbe Limited30%Bintang Toedjoe99.90%Hale International99.997%Hexpharm Jaya Labs99.60%Saka Farma Labs75%Millenia Dharma Insani99.6%Tri Sapta Jaya99.999%0.40%25%0.10%0.006%0.003%0.025%Kalbe Vision Pte. Ltd.100%Kalbe InternationalPte. Ltd.100%0.1%Enseval Medika Prima99.9%Global ChemindoMegatrading99.9%0.004%Renalmed TiaraUtama98.75%0.1%0.001%Asiawide KalbePhilippines, Inc.50%EPMT91.75%
  • 40. Performance HighlightsManagement ReportCompany ProfileManagement Discussion and AnalysisCorporate GovernanceCorporate Social ResponsibilityPT Kalbe Farma Tbk. • Laporan Tahunan 201238Menjadi perusahaan produkkesehatan Indonesia terbaik yangdidukung oleh inovasi, merekyang kuat, dan manajemen yangprima.To be the best Indonesian healthcare companydriven by innovation, strong brands, andexcellent management.Meningkatkan kesehatan untukkehidupan yang lebih baik.To improve health for a better life.The Scientific Pursuit of Healthfor a Better LifeVisiVisionMisiMissionMottoVisi dan Misi Perseroan telah disetujui oleh Dewan Komisaris dan DireksiThe Company’s Vision and Mission have been approved by the Board of Commissioners and the Board of Directors
  • 41. PT Kalbe Farma Tbk. • 2012 Annual Report 391 Saling percaya adalah perekat diantara kami Trust is the glue of life2 Kesadaran penuh adalah dasar setiaptindakan kami Mindfulness is the foundation of ouraction4 Bertekad untuk menjadi yang terbaik Strive to be the best5 Saling keterkaitan adalah panduanhidup kami Interconnectedness is a universalway of life3 Inovasi adalah kunci keberhasilankami Innovation is the key to our successBerlandaskan saling percaya, saling menghargaidengan menjunjung tinggi keterbukaan dan kejujuran,kami mengelola Perseroan untuk memberikan yangterbaik bagi sesama.With mutual trust and respect, and by upholdingopenness and honesty, we manage the Company todeliver the very best for all.Kesadaran penuh merupakan landasan kami dalammengambil tindakan yang selaras dengan nilai-nilai Perseroan agar senantiasa tanggap terhadapkebutuhan semua pemangku kepentingan, masyarakat,dan lingkungan.Mindfulness is the foundation for us to take actionsthat are consistent with Company values in order tobe always responsive to the needs of all stakeholders,society, and the environment.Kami memberi kesempatan yang sama kepada setiapindividu untuk mengembangkan potensinya agarmenjadi insan yang handal melalui budaya belajar danperbaikan yang berkesinambungan.We provide equal opportunity to every individual todevelop their potentials and become a reliable humanbeing through the culture of continual learning andimprovement.Sebagai bagian dari kehidupan, kami berperan sertamemelihara keragaman dan keharmonisan denganmelakukan usaha-usaha yang bermanfaat bagi sesamahingga generasi mendatang.As part of life, we assume our role and maintaindiversity and harmony by making efforts that are usefulfor others and for the future generations.Berawal dari kesederhanaan disertai semangat untukterus berinovasi, kami bertumbuh untuk meningkatkankualitas hidup masyarakat.Starting from simplicity combined with a spirit to sustaininnovation, we grow to improve the quality of life.Nilai-nilai PerusahaanCorporate Values
  • 42. Performance HighlightsManagement ReportCompany ProfileManagement Discussion and AnalysisCorporate GovernanceCorporate Social ResponsibilityPT Kalbe Farma Tbk. • Laporan Tahunan 201240Profil Dewan KomisarisBoard of Commissioners ProfilePresiden Komisaris Perseroan sejak tahun 2008.Saat ini beliau menjabat sebagai Presiden KomisarisPerseroan berdasarkan keputusan Rapat UmumPemegang Saham Tahunan Perseroan tanggal 25 Mei2011.Warga Negara Indonesia. Lahir di Solo pada tanggal19 Desember 1944.Meraih gelar Sarjana Farmasi dari Institut TeknologiBandung pada tahun 1969. Sejak tahun 1972, beliautelah bergabung dengan Perseroan sebagai Research& Development Manager dan diangkat menjadiDirektur Pemasaran pada tahun 1976. Sejak tahun1992 hingga tahun 1998, beliau menjabat sebagaiKomisaris Perseroan dan beberapa anak perusahaanPerseroan, antara lain sebagai Komisaris PT KageoIgar Jaya Tbk, Presiden Komisaris PT HexpharmJaya Laboratories dan juga sebagai Komisaris PTSanghiang Perkasa sejak tahun 1993. Dari tahun 1996sampai dengan tahun 1998 beliau menduduki jabatanPresiden Direktur PT Enseval Putera Megatrading Tbk.Sampai tahun 2008, beliau menjabat sebagai PresidenKomisaris PT Bintang Toedjoe sejak tahun 1998, dansebagai Presiden Komisaris PT Finusolprima Farmasejak tahun 1999. Beliau juga menjabat beberapaposisi sebagai pemimpin di PT Dankos LaboratoriesTbk, yaitu sebagai Direktur pada tahun 1985, sebagaiKomisaris pada tahun 1989 hingga 1994, dan sebagaiPresiden Komisaris sejak April 1994 sampai denganpenggabungan usaha. Beliau juga menjadi PresidenDirektur Perseroan sejak tahun 1998 hingga Mei 2008.Pada tahun 2011, beliau terpilih sebagai Ketua UmumGabungan Perusahaan Farmasi Indonesia untukperiode 2011 – 2016.Johannes SetijonoPresiden Komisaris President CommissionerKomisaris Perseroan sejak tahun 2008.Saat ini beliau menjabat sebagai Komisaris Perseroanberdasarkan keputusan Rapat Umum PemegangSaham Tahunan Perseroan tanggal 25 Mei 2011.Warga Negara Indonesia. Lahir di Jakarta padatanggal 18 Juni 1964.Meraih gelar Sarjana Ekonomi dari University ofColorado, Boulder, Amerika Serikat pada tahun 1991.Pada tahun 1987, beliau memulai karirnya sebagaiProduction Supervisor dan jabatan terakhir sebagaiPresiden Direktur di KC Pharmaceuticals, Inc., AmerikaSerikat sampai dengan tahun 1997. Sejak tahun 1997itu juga, beliau mulai bergabung dengan Grup Kalbesebagai Wakil Direktur PT Bintang Toedjoe sampaidengan tahun 1999 dan kemudian diangkat sebagaiDirektur hingga bulan Januari 2001. Sejak bulan Juni2002, beliau menjabat sebagai Komisaris PT DankosLaboratories Tbk. sampai dengan saat penggabunganusaha pada tahun 2005. Sejak tahun 2000, beliaumenjabat Direktur Perseroan hingga Mei 2008.Santoso OenKomisaris CommissionerPresident Commissioner of the Company since 2008.Currently he serves as the President Commissioner ofthe Company based on the resolutions of the AnnualGeneral Meeting of Shareholders dated May 25,2011.An Indonesian citizen, born in Solo on December 19,1944.Graduated with a degree in Pharmacy from BandungInstitute of Technology in 1969. He joined Kalbe in1972 as Research & Development Manager and wasappointed as Director of Marketing in 1976. Between1992 and 1998, he served as a Commissioner of theCompany as well as that of several other companiesin the Kalbe Group, namely as Commissioner ofPT Kageo Igar Jaya Tbk, President Commissionerof PT Hexpharm Jaya Laboratories and also asCommissioner PT Sanghiang Perkasa since 1993.Between 1996 and 1998, he served as PresidentDirector of PT Enseval Putera Megatrading Tbk.Up until 2008, he was the President Commissionerof PT Bintang Toedjoe and a Commissioner ofPT Finusolprima Farma. He has also held severalsenior positions in PT Dankos Laboratories Tbk,having been appointed as a Director in 1985, aCommissioner between 1989 and 1994 and PresidentCommissioner from April 1994 until the merger. Healso served as President Director of the Companyfrom 1998 until May 2008. In 2011, he was appointedas the Chairman of the Indonesian PharmaceuticalAssociation for period of 2011 – 2016.Commissioner of the Company since 2008.Currently he serves as a Commissioner of theCompany based on the resolutions of the AnnualGeneral Meeting of Shareholders dated May 25,2011.An Indonesian citizen, born in Jakarta on June 18,1964.Graduated with a degree in Economics fromUniversity of Colorado, Boulder, U.S., in 1991. Hebegan his career as a Production Supervisor in 1987at KC Pharmaceuticals, Inc., USA, eventually beingappointed President Director. In 1997, he joined KalbeGroup as the Deputy Director of PT Bintang Toedjoe, aposition he held until 1999, when he was appointed asa Director, serving until January 2001. In June 2002,he was appointed as Commissioner of PT DankosLaboratories Tbk. where he served until the mergerin 2005. From 2000 until May 2008, he served asDirector of the Company.
  • 43. PT Kalbe Farma Tbk. • 2012 Annual Report 41Komisaris Perseroan sejak tahun 2008.Saat ini beliau menjabat sebagai Komisaris Perseroanberdasarkan keputusan Rapat Umum PemegangSaham Tahunan Perseroan tanggal 25 Mei 2011.Warga Negara Indonesia. Lahir di Jakarta padatanggal 20 Maret 1968.Meraih gelar Bachelor of Science in EngineeringManagement dari University of Portland padatahun 1990, Master of Business Administration dariLoyola Marymount University pada tahun 1993 danMaster of Science in Engineering Management dariUniversity of Southern California pada tahun 1995.Beliau memulai karir di bidang farmasi sejak tahun1992 di KC Pharmaceuticals, Inc, Amerika Serikatsampai dengan tahun 1995. Beliau mulai bergabungdengan Grup Kalbe pada tahun 1995 dengan jabatansebagai Plant Manager di PT Bintang Toedjoe. Selainitu, selama tahun 1995 hingga 1999, beliau menjabatsebagai Marketing Manager Perseroan dan PresidenDirektur PT Hexpharm Jaya Laboratories. Padatahun 2002 hingga tahun 2005, beliau mendudukijabatan sebagai Direktur PT Dankos LaboratoriesTbk. Beliau diangkat sebagai Presiden DirekturPT Bintang Toedjoe pada tahun 2002 hingga bulanMaret 2007. Sejak penggabungan usaha, beliaumenduduki jabatan sebagai Direktur Perseroansampai dengan tahun 2008.Jozef Darmawan AngkasaKomisaris CommissionerKomisaris Perseroan sejak tahun 2008.Saat ini beliau menjabat sebagai Komisaris Perseroanberdasarkan keputusan Rapat Umum PemegangSaham Tahunan Perseroan tanggal 25 Mei 2011.Warga Negara Indonesia. Lahir di Jakarta padatanggal 7 Mei 1972.Mendapatkan gelar sarjana dari California StateUniversity of Long Beach, Amerika Serikat di tahun1995. Beliau bergabung dengan Grup Kalbe sebagaiProduct Executive di PT Dankos Laboratories Tbk.pada tahun 1996, sebelum menjabat sebagai ProductManager di PT Bintang Toedjoe pada tahun 1997 dankemudian terus memegang berbagai posisi penting diperusahaan yaitu Senior Product Manager, MarketingManager, General Marketing Manager dan AssistantMarketing Director. Sejak tahun 2001 hingga tahun2008, beliau menjabat sebagai Komisaris di PTEnseval Putera Megatrading Tbk. dan beberapaperusahaan lainnya.Ferdinand AryantoKomisaris CommissionerCommissioner of the Company since 2008.Currently he serves as a Commissioner of theCompany based on the resolutions of the AnnualGeneral Meeting of Shareholders dated May 25,2011.An Indonesian citizen, born in Jakarta on March 20,1968.Graduated with a Bachelor of Science degree inEngineering Management from the University ofPortland in 1990, Master of Business Administrationfrom Loyola Marymount University in 1993 andMaster of Science in Engineering Management fromthe University of Southern California in 1995. Hestarted his career in the pharmaceutical industryin 1992 at KC Pharmaceuticals, Inc, U.S., where heworked until 1995. He joined Kalbe Group in 1995,serving as Plant Manager at PT Bintang Toedjoe. Inaddition, between 1995 and 1999, he also servedas Marketing Manager of the Company, and asPresident Director of PT Hexpharm Jaya Laboratories.From 2002 until 2005, he served as a Director atPT Dankos Laboratories Tbk. He also served as thePresident Director of PT Bintang Toedjoe from 2002until March 2007. Since the merger, he served as theDirector of the Company, until 2008.Commissioner of the Company since 2008.Currently he serves as a Commissioner of theCompany based on the resolutions of the AnnualGeneral Meeting of Shareholders dated May 25,2011.An Indonesian citizen, born in Jakarta on May 7,1972.Earned his Bachelor’s Degree from California StateUniversity at Long Beach, U.S. in 1995. In 1996,he joined Kalbe Group as Product Executive atPT Dankos Laboratories Tbk., before serving asProduct Manager at PT Bintang Toedjoe in 1997. Hewas then promoted to various senior positions includingSenior Product Manager, Marketing Manager, GeneralMarketing Manager and Assistant Marketing Director.Between 2001 and 2008, he served as Commissionerof PT Enseval Putera Megatrading Tbk. and severalother companies.
  • 44. Performance HighlightsManagement ReportCompany ProfileManagement Discussion and AnalysisCorporate GovernanceCorporate Social ResponsibilityPT Kalbe Farma Tbk. • Laporan Tahunan 201242Komisaris Independen Perseroan sejak tahun 2010.Saat ini beliau menjabat sebagai KomisarisIndependen Perseroan berdasarkan keputusan RapatUmum Pemegang Saham Tahunan Perseroan tanggal25 Mei 2011.Warga Negara Indonesia. Lahir di Madiun padatanggal 30 Januari 1938.Memperoleh gelar Sarjana Ekonomi di bidangAkuntansi dari Fakultas Ekonomi Universitas Indonesiatahun 1968, Master of Business Administration dariUniversity of Wisconsin tahun 1974 serta PhD dibidang Akuntansi dari University of Missouri tahun1980. Beliau adalah guru besar emeritus FakultasEkonomi Universitas Indonesia, pendiri dan ketuapertama dari dua Program Studi Magister FakultasEkonomi Universitas Indonesia yaitu ProgramMagister Manajemen (1988 – 1996) dan ProgramMagister Akuntansi (1997 – 2003). Beliau juga pendiridan aktif sebagai penasihat Center for CorporateLeadership sejak tahun 1993 hingga sekarang danIndonesian Society of Independent Commissionerssejak tahun 2001 hingga sekarang. Kini beliau jugamenjabat komisaris independen dan komite auditdi beberapa perusahaan. Beliau telah menerimabeberapa penghargaan, antara lain tanda kehormatannegara “Satyalancana Dwidya Sistha” dari AngkatanBersenjata Republik Indonesia Markas Besar TNI – ADdan tanda kehormatan negara “Satyalancana KaryaSatya” dari Pemerintah Republik Indonesia.Wahjudi PrakarsaKomisaris Independen Independent CommissionerKomisaris Independen Perseroan sejak tahun 2008.Saat ini beliau menjabat sebagai KomisarisIndependen Perseroan berdasarkan keputusan RapatUmum Pemegang Saham Tahunan Perseroan tanggal25 Mei 2011.Warga Negara Indonesia. Lahir di Lampung padatanggal 28 Juni 1944.Meraih gelar Doktor dalam Ilmu Kebidanan danGinekologi dari Fakultas Kedokteran UniversitasIndonesia pada tahun 1983 dan Guru Besar FakultasKedokteran Universitas Indonesia pada tahun 1994.Beliau berperan sebagai Direktur Akademis UniversitasIndonesia untuk program Pasca Sarjana (1996-1998),Menteri Kesehatan Indonesia Kabinet PembangunanVII, Menteri Kesehatan Indonesia Kabinet ReformasiPembangunan, anggota MPR RI (1999), Ketua UmumPengurus Besar Ikatan Dokter Indonesia (2003-2006),dan President of Medical Associations of SouthEast Asian Nations (MASEAN) Council (2003-2006).Beliau pernah mendapatakan beberapa penghargaanseperti Adi Satya Utama dari Ikatan Dokter Indonesia(1996), Bintang Republik Indonesia Maha PutraAdriprana (1999), Satyalancana Karya Satya RepublikIndonesia XXX (2002), Penghargaan Bina Ekatamadari Perkumpulan Keluarga Berencana Indonesia(2002) dan Penghargaan Prof. Mohtar Award dalamBidang Ilmiah dan Riset dari Ikatan Ahli KesehatanMasyarakat Indonesia (2007).Farid Anfasa MoeloekKomisaris Independen Independent CommissionerIndependent Commissioner of the Company since2010.Currently he serves as an Independent Commissionerof the Company based on the resolutions of theAnnual General Meeting of Shareholders dated May25, 2011.An Indonesian citizen, born in Madiun on January 30,1938.Graduated with a Bachelor of Economics inAccountancy from the Economics Faculty of theUniversity of Indonesia in 1968, was awarded aMaster’s of Business Administration degree fromUniversity of Wisconsin in 1974 and a PhD inAccountancy from the University of Missouri in 1980.He is a Professor Emeritus at the Faculty of Economics,University of Indonesia. He was the Founder and FirstProgram Head of the initial two professional graduateprograms at the Economics Faculty of the University ofIndonesia, the Magister Management Program (1988– 1996) and Magister Accountancy Program (1997-2003). He also established and is still serving as anadvisor of the Center for Corporate Leadership since1993 and The Indonesian Society of IndependentCommissioners since 2001. Currently, he also servesas Independent Commissioner and Audit Committeemember at several other companies. In recognition ofhis public service he has been awarded several statemedals, including the “Satyalancana Dwidya Sistha”from the Indonesia Armed Forces - Army CentralHeadquarter; and the “Satyalancana Karya Satya”from the Indonesian Government.Independent Commissioner of the Company since2008.Currently he serves as an Independent Commissionerof the Company based on the resolutions of theAnnual General Meeting of Shareholders dated May25, 2011.An Indonesian citizen, born in Lampung on June 28,1944.Awarded a Doctorate in Obstetrics and Gynecologyby the Faculty of Medicine, University of Indonesia in1983 and a Professor of Faculty of Medicine, Universityof Indonesia in 1994. He served as Academic Directorat the University of Indonesia for the Master’s DegreeProgram (1996-1998), as Indonesian Minister ofHealth in the Development VII Cabinet, as IndonesianMinister of Health in the Development ReformCabinet, as a member of the Indonesian ConsultativeAssembly MPR RI (1999), General Chairman of theSupervisory Council of the Indonesian Doctors’Association, and President of Medical Associations ofSouth East Asian Nations (MASEAN) Council (2003-2006). He has received several awards, including theAdi Satya Utama Award from the Indonesian Doctors’Association (1996), the Maha Putra Adriprana Star ofthe Republic of Indonesia (1999), the SatyalancanaKarya Satya XXX of the Republic of Indonesia (2002),the Bina Ekatama Award from the Indonesian FamilyPlanning Association (2002), and the Prof. MohtarAward in Science and Research from the IndonesianPublic Health Association (2007).
  • 45. PT Kalbe Farma Tbk. • 2012 Annual Report 43Profil DireksiBoard of Directors ProfilePresiden Direktur Perseroan sejak tahun 2008.Saat ini beliau menjabat sebagai Presiden DirekturPerseroan berdasarkan keputusan Rapat UmumPemegang Saham Tahunan Perseroan tanggal 25 Mei2011.Warga Negara Indonesia. Lahir di Jakarta padatanggal 19 Mei 1962.Meraih gelar Master of Science dari Faculty of FoodScience, Cornell University, Ithaca, New York, AmerikaSerikat tahun 1986.Sejak tahun 1987, beliau memulai karirnya sebagaiProduct Manager di PT Bukit Manikam Sakti, DivisiInfant Food dari PT Kalbe Farma Tbk., kemudiantahun 1989, pindah ke PT Sanghiang Perkasa, anakperusahaan PT Kalbe Farma Tbk. yang bergerak dibidang makanan kesehatan. Pada bulan Febuari 1992,beliau ditunjuk sebagai Presiden Direktur di PT BukitManikam Sakti. Selanjutnya beliau menjabat sebagaiWakil Presiden untuk Manufacturing dan SumberDaya Manusia di Helios Foods pada bulan November1992 hingga 1994. Sejak tahun 1994 sampai saat inibeliau menjabat sebagai Presiden Direktur dari PTSanghiang Perkasa, yang menjadi Divisi Nutrisi Kalbe.Di PT Kalbe Farma Tbk., beliau memulai karirnyapada tahun 1997 hingga 2005 sebagai MarketingDirector of Ethical and OTC Businesses, dan padatahun 2006 setelah penggabungan usaha menjabatsebagai Direktur untuk bagian Corporate Strategyand Business Development. Pada tahun 2008, beliaudiangkat sebagai Presiden Direktur PT Kalbe FarmaTbk.Saat ini, beliau juga menjabat sebagai PresidenDirektur PT Sanghiang Perkasa, Direktur AsiawideKalbe Philippines Inc., Presiden Komisaris dariPT Kalbe Morinaga Indonesia, Komisaris dariPT Enseval Putera Megatrading Tbk.Bernadette Ruth Irawati SetiadyPresiden Direktur President DirectorPresident Director of the Company since 2008.Currently she serves as the President Director of theCompany based on the resolutions of the AnnualGeneral Meeting of Shareholders dated May 25,2011.An Indonesian citizen, born in Jakarta on May 19,1962.Earned a Master’s of Science Degree from the Facultyof Food Science, Cornell University, Ithaca, New York,U.S., in 1986.In 1987, she began her career as Product Managerat PT Bukit Manikam Sakti, the Infant Food Divisionof PT Kalbe Farma Tbk., and then in 1989 moved toPT Sanghiang Perkasa, a Health Food Subsidiary of PTKalbe Farma Tbk., as Marketing Manager. In February1992 she was appointed as the President Director ofPT Bukit Manikam Sakti and later on becameVice President for Manufacturing and HumanResources at Helios Foods. From 1994 until thepresent, she has held the position of PresidentDirector of PT Sanghiang Perkasa, whichbecame the Nutritionals Division of Kalbe. AtPT Kalbe Farma Tbk., she started her career in 1997as Marketing Director of Ethical and OTC Businesses,where she served until 2005, and in 2006 after themerger she was appointed as Director for CorporateStrategy and Business Development. In 2008, shewas appointed as President Director of PT KalbeFarma Tbk.Currently, she also serves as President Director ofPT Sanghiang Perkasa, Director of Asiawide KalbePhilippines Inc., President Commissioner of PT KalbeMorinaga Indonesia, and Commissioner of PT EnsevalPutera Megatrading Tbk.
  • 46. Performance HighlightsManagement ReportCompany ProfileManagement Discussion and AnalysisCorporate GovernanceCorporate Social ResponsibilityPT Kalbe Farma Tbk. • Laporan Tahunan 201244Direktur Perseroan sejak tahun 2005.Saat ini beliau menjabat sebagai Direktur Perseroanberdasarkan keputusan Rapat Umum PemegangSaham Tahunan Perseroan tanggal 25 Mei 2011.Warga Negara Indonesia. Lahir di Tegal pada tanggal15 Juni 1958. Meraih gelar sarjana dari InstitutTeknologi Bandung pada tahun 1981.Beliau memulai karirnya pada tahun 1982 sebagaiGeneral Manager di PT Tatas Mulia. Pada tahun 1984beliau bergabung dengan PT Sanghiang Perkasasebagai General Manager, tahun 1986 di PT BukitManikam Sakti dan tahun 1989 di PT Enseval. Sejaktahun 1992 hingga tahun 1998, beliau menjabatsebagai Presiden Direktur Perseroan dan kemudianmenjabat sebagai Presiden Direktur PT Enseval PuteraMegatrading Tbk. hingga bulan Januari 2006. Sejakpenggabungan usaha antara PT Kalbe Farma Tbk.,PT Dankos Laboratories Tbk. dan PT Enseval, beliaumenjabat sebagai Direktur PT Kalbe Farma Tbk.Saat ini beliau juga menjabat sebagai PresidenDirektur PT Enseval Putera Megatrading Tbk.,Presiden Komisaris PT Sanghiang Perkasa, PresidenKomisaris PT Enseval Medika Prima, Komisaris PT TriSapta Jaya, Komisaris PT Millenia Dharma Insani, danKomisaris PT Global Chemindo Megatrading.Budi Dharma WreksoatmodjoDirektur DirectorDirector of the Company since 2005.Currently he serves as a Director of the Companybased on the resolutions of the Annual GeneralMeeting of Shareholders dated May 25, 2011.An Indonesian citizen, born in Tegal, Central Java, onJune 15, 1958. Earned a Bachelor’s Degree from theBandung Institute of Technology in 1981.He began his career in 1982 as General Manager ofPT Tatas Mulia, moving to the post of General Managerof PT Sanghiang Perkasa in 1984, PT Bukit ManikamSakti in 1986 and PT Enseval in 1989. Between 1992and 1998, he served as President Director of theCompany before being appointed President Directorof PT Enseval Putera Megatrading Tbk., a positionhe held until January 2006. Since the merger ofPT Kalbe Farma Tbk., PT Dankos Laboratories Tbk.and PT Enseval, he has served as a Director ofPT Kalbe Farma Tbk.Currently he also serves as President Director ofPT Enseval Putera Megatrading Tbk., PresidentCommissioner of PT Sanghiang Perkasa, PresidentCommissioner of PT Enseval Medika Prima,Commissioner of PT Tri Sapta Jaya, Commissionerof PT Millenia Dharma Insani, and Commissioner ofPT Global Chemindo Megatrading.Direktur Perseroan sejak tahun 2005.Saat ini beliau menjabat sebagai Direktur Perseroanberdasarkan keputusan Rapat Umum PemegangSaham Tahunan Perseroan tanggal 25 Mei 2011.Warga Negara Indonesia. Lahir di Bojonegoro padatanggal 3 Januari 1954. Berkuliah di Fakultas FarmasiUniversitas Surabaya hingga tahun 1977.Beliau bergabung dengan Grup Kalbe pada tahun1985 sebagai Sales Manager Ethical PT DankosLaboratories Tbk. Pada tahun 1988 beliau diangkatsebagai Marketing Manager Ethical, lalu menjabatsebagai Direktur PT Bintang Toedjoe pada tahun 1991hingga tahun 1992. Sejak tahun 1996 hingga tahun2002, menjabat sebagai Presiden Direktur dan setelahitu sebagai Komisaris PT Bintang Toedjoe. Sejaktahun 1992 hingga tahun 1996 beliau mendudukijabatan sebagai Direktur dan kemudian menjabatsebagai Presiden Direktur PT Dankos LaboratoriesTbk. sejak tahun 2002 hingga penggabungan usahapada tahun 2005.Saat ini beliau menjabat sebagai Presiden KomisarisPT Finusolprima Farma Internasional, PresidenKomisaris PT Enseval Putera Megatrading Tbk.,Presiden Komisaris PT Hexpharm Jaya Laboratories,Presiden Komisaris PT Dankos Farma, dan KomisarisPT Renalmed Tiara Utama.Herman WidjajaDirektur DirectorDirector of the Company since 2005.Currently he serves as a Director of the Companybased on the resolutions of the Annual GeneralMeeting of Shareholders dated May 25, 2011.An Indonesian citizen, born in Bojonegoro on January3, 1954. Studied at the Faculty of Pharmacy, SurabayaUniversity until 1977.He joined Kalbe Group in 1985 as Sales Manager forthe Ethical Division at PT Dankos Laboratories Tbk.,and in 1988 was appointed as Marketing Managerfor the Ethical Division. He served as a Director ofPT Bintang Toedjoe from 1991 to 1992, as PresidentDirector from 1996 to 2002 and was then appointed aCommissioner. From 1992 to 1996, he was a Directorof PT Dankos Laboratories Tbk. and then servedas President Director from 2002 until the merger in2005.Currently he serves President Commissionerof PT Finusolprima Farma Internasional,President Commissioner of PT Enseval PuteraMegatrading Tbk., President Commissioner ofPT Hexpharm Jaya Laboratories, PresidentCommissionerofPTDankosFarma,andCommissionerof PT Renalmed Tiara Utama.
  • 47. PT Kalbe Farma Tbk. • 2012 Annual Report 45Direktur Perseroan sejak tahun 1997.Beliau ditetapkan sebagai Direktur Tidak TerafiliasiPerseroan berdasarkan keputusan Rapat UmumPemegang Saham Perseroan tanggal 23 Mei 2012.Warga Negara Indonesia. Lahir di Pontianak padatanggal 5 Juli 1964. Meraih gelar Sarjana Ekonomidari Universitas Trisakti.Pada tahun 1985, beliau memulai kariernya diKantor Akuntan Publik Drs. Joseph Susilo & Rekandan sebagai Dosen di STIE Trisakti. Beliau mulaibergabung dengan Perseroan sejak tahun 1990pada Bagian Keuangan dan Akuntansi. Pada tahun1996, beliau diangkat menjadi Direktur Keuangan PTDankos Laboratories Tbk. sampai dengan tahun 1997dan diangkat menjadi Direktur Perseroan pada tahun1997. Sejak bulan Januari 2006 dan hingga tahun2010 beliau menjabat sebagai Presiden Direktur PTEnseval Putera Megatrading Tbk., anak perusahaanPerseroan di bidang distribusi.Saat ini beliau juga menjabat sebagai KomisarisPT Bifarma Adiluhung.VidjongtiusDirektur Tidak Terafiliasi Unaffiliated DirectorDirector of the Company since 1997.He was appointed as an Unaffiliated Director of theCompany based on the resolutions of the AnnualGeneral Meeting of Shareholders dated May 23,2012.An Indonesian citizen, born in Pontianak, WestKalimantan, on July 5, 1964. Earned a Bachelor’sDegree in Economics from Trisakti University.In 1985, he began his career at the Public AccountantFirm of Drs. Joseph Susilo & Partners, and was alsoa lecturer at STIE Trisakti. He joined Kalbe in 1990,in the Finance and Accounting Department. In 1996,he was appointed the Finance Director of PT DankosLaboratories Tbk., where he served until 1997, and asDirector of the Company since 1997. From January2006 until 2010 he has served as President Director ofPT Enseval Putera Megatrading Tbk., the Company’sdistribution division.Currently he also serves Commissioner of PT BifarmaAdiluhung.Direktur Perseroan sejak tahun 2011.Saat ini beliau menjabat sebagai Direktur Perseroanberdasarkan keputusan Rapat Umum PemegangSaham Tahunan Perseroan tanggal 25 Mei 2011.Warga Negara Indonesia. Lahir di Bandung padatanggal 9 November 1959.Meraih gelar Master in Business Administration dariMonash University, Mt. Eliza Business School Australiapada tahun 1996 dan menamatkan pendidikan diColumbia University, Columbia Business SchoolExecutive Education, Amerika Serikat di tahun 2001.Pada tahun 1984, beliau bergabung denganPT Enseval Putera Megatrading dengan posisi terakhirsebagai Regional Sales Manager pada tahun 1986.Sejak tahun 1968 hingga tahun 1991, beliau menjabatsebagai Manager pada PT Bukit Manikam Sakti danHelios Foods. Pada tahun 1991, beliau menjabatMarketing Director pada PT Arnott’s Indonesia. Beliaubergabung dengan Indofood Group dari tahun 1996hingga tahun 2003. Sejak tahun 1996 hingga tahun2000, beliau menjabat sebagai Division Head DairyDivision dan Direktur pada PT Indomilk, PT Indolakto,dan PT Indomeiji. Kemudian, sejak tahun 2000 hinggatahun 2002, beliau menjabat Division Head Edible Oil& Fats Indofood dan General Manager PT IntibogaSejahtera. Sejak tahun 2002 hingga tahun 2003, beliaumenjabat Managing Director PT Pepsi Indobeverages.Sejak tahun 2003 hingga 2011, beliau mendudukiposisi sebagai Direktur PT Mayora Indah Tbk.Saat ini beliau juga menjabat sebagai Direktur PTSanghiang Perkasa, Direktur Kalbe Vision Pte. Ltd.,Komisaris PT Kalbe Morinaga Indonesia, DirekturKalbe International Pte. Ltd., dan Komisaris PT KalbeMilko Indonesia.Ongkie TedjasurjaDirektur DirectorDirector of the Company since 2011.Currently he serves as a Director of the Companybased on the resolutions of the Annual GeneralMeeting of Shareholders dated May 25, 2011.An Indonesian citizen, born in Bandung, on November9, 1959.Earned a Master in Business Administration degreefrom Monash University, Mt. Eliza Business SchoolAustralia in 1996 and graduated from ColumbiaUniversity, Columbia Business School ExecutiveEducation, U.S. in 2001.In 1984, he joined PT Enseval Putera Megatradingwith latest position as District Sales Manager in 1986.From 1986 to 1991, he was appointed as a Manager ofPT Bukit Manikam Sakti and Helios Foods. In 1991, heserved as Marketing Director of PT Arnott’s Indonesia.He joined Indofood Group from 1996 to 2003. From1996 to 2000, he served as Division Head DairyDivision and Director of PT Indomilk, PT Indolakto,dan PT Indomeiji. Later, from 2000 to 2002, he servedas Division Head of Edible Oil & Fats Indofood andGeneral Manager of PT Intiboga Sejahtera. From 2002to 2003, he served as Managing Director of PT PepsiIndobeverages. From 2003 to 2011, he served asDirector of PT Mayora Indah Tbk.Currently he also serves as Director of PT SanghiangPerkasa, Director of Kalbe Vision Pte. Ltd.,Commissioner of PT Kalbe Morinaga Indonesia,Director of Kalbe International Pte. Ltd., andCommissioner of PT Kalbe Milko Indonesia.
  • 48. Performance HighlightsManagement ReportCompany ProfileManagement Discussion and AnalysisCorporate GovernanceCorporate Social ResponsibilityPT Kalbe Farma Tbk. • Laporan Tahunan 201246Profil Komite AuditAudit Committee ProfileKetua Komite Audit sejak tanggal 5 Agustus 2008.Saat ini beliau menjabat sebagai Ketua Komite Auditberdasarkan Surat Keputusan Dewan Komisaristentang pengangkatan Komite Audit tanggal 22Agustus 2011.Riwayat hidup dapat dilihat pada bagian riwayathidup Dewan Komisaris.Farid Anfasa MoeloekKetua Komite Audit Chairman of Audit CommitteeAnggota Komite Audit sejak tanggal 5 Agustus 2008.Saat ini beliau menjabat sebagai anggota KomiteAudit berdasarkan Surat Keputusan Dewan Komisaristentang pengangkatan Komite Audit tanggal 22Agustus 2011.Warga negara Indonesia. Lahir di Jakarta pada tanggal17 September 1938. Meraih gelar Sarjana InsinyurTeknologi Kimia dari Institut Teknologi Bandung padatahun 1963.Sejak tahun 1962, beliau memulai karir sebagai WakilDirektur PT Pagoda Sakti Raya. Selanjutnya padatahun 1969, beliau menjabat sebagai Direktur UtamaPT Jaya Gas Indonesia. Beliau mulai bergabungdengan Perseroan pada tahun 1988 hingga 1990sebagai Direksi Grup Kalbe. Pada tahun 1990 sampaidengan 1993, beliau menempati posisi sebagaiDirektur Group PT Tempo, dan pada tahun 1994hingga 2000 sebagai Direktur Utama PT CakrawalaNalar Mekar.Ichsan GunawanAnggota Komite Audit Member of Audit CommitteeAnggota Komite Audit sejak tanggal 5 Agustus 2008.Saat ini beliau menjabat sebagai anggota KomiteAudit berdasarkan Surat Keputusan Dewan Komisaristentang pengangkatan Komite Audit tanggal 22Agustus 2011.Warga negara Indonesia. Lahir di Cirebon padatanggal 10 November 1966.Meraih gelar Sarjana Akuntansi dari UniversitasParahyangan, Bandung di tahun 1990Beliau memulai karirnya sebagai Supervisor Pajakpada Gunawan, Prijohandojo, Utomo & Co sejak tahun1993 sampai dengan 1996. Selanjutnya pada tahun1996 sampai dengan tahun 2005, beliau menjabatsebagai Tax Manager pada Prijohandojo, Boentoro &Co. Terhitung mulai Januari tahun 2009, beliau adalahmitra kerja dari Kantor Konsultan Pajak dan KeuanganTrustion Consulting.Dianawati SugiartoAnggota Komite Audit Member of Audit CommitteeMember of the Audit Committee since August 5,2008.Currently she serves as a member of the AuditCommittee based on the Decree of the Board ofCommissioners on the appointment of the AuditCommittee dated August 22, 2011.An Indonesian citizen, born in Cirebon on November10, 1966.Graduated with a Degree in Accountancy fromParahyangan University, Bandung in 1990.She started her career as a Tax Supervisor atGunawan, Prijohandojo, Utomo & Co, where sheworked from 1993 to 1996. From 1996 to 2005, shewas Tax Manager at Prijohandojo, Boentoro & Co.Effective January 2009, she has served as a partnerof the Financial and Tax Consultant Office at TrustionConsulting.Member of the Audit Committee since August 5,2008.Currently he serves as a member of the AuditCommittee based on the Decree of the Board ofCommissioners on the appointment of the AuditCommittee dated August 22, 2011.An Indonesian citizen, born in Jakarta on September17, 1938. Earned a Bachelor’s Degree in ChemicalEngineering from Bandung Institute of Technology in1963.From 1962, he began his career as Deputy Directorat PT Pagoda Sakti Raya. In 1969, he was promotedto the position of President Director of PT Jaya GasIndonesia. He joined our Company in 1988, and servedup to 1990 as Director of the Kalbe Group. From 1990to 1993, he held the position of Director of PT TempoGroup and from 1994 to 2000 was President Directorof PT Cakrawala Nalar Mekar.Chairman of the Audit Committee since August 5,2008.Currently he serves as the Chairman of the AuditCommittee based on the Decree of the Board ofCommissioners on the appointment of the AuditCommittee dated August 22, 2011.For a complete biography please refer to the Board ofCommissioners Biography Section.
  • 49. PT Kalbe Farma Tbk. • 2012 Annual Report 47Profil Komite NominasiNomination Committee ProfileKetua Komite Nominasi sejak tahun 2008.Saat ini beliau menjabat sebagai ketua KomiteNominasi berdasarkan Surat Keputusan DewanKomisaris tentang pengangkatan Komite Nominasitanggal 10 Oktober 2012.Riwayat hidup dapat dilihat pada bagian riwayat hidupDewan Komisaris.Johannes SetijonoKetua Komite Nominasi Chairman of Nomination CommitteeAnggota Komite Nominasi sejak tahun 2008.Saat ini beliau menjabat sebagai anggota KomiteNominasi berdasarkan Surat Keputusan DewanKomisaris tentang pengangkatan Komite Nominasitanggal 10 Oktober 2012.Riwayat hidup dapat dilihat pada bagian riwayat hidupDireksi.Bernadette Ruth Irawati SetiadyAnggota Komite Nominasi Member of Nomination CommitteeChairman of the Nomination Committee since 2008.Currently he serves as the Chairman of the NominationCommittee based on the Decree of the Board ofCommissioners on the appointment of the NominationCommittee dated October 10, 2012.For a complete biography please refer to Board ofCommissioners biography section.Member of the Nomination Committee since 2008.Currently she serves as the member of the NominationCommittee based on the Decree of the Board ofCommissioners on the appointment of the NominationCommittee dated October 10, 2012.For a complete biography please refers to Board ofDirectors biography section.
  • 50. Performance HighlightsManagement ReportCompany ProfileManagement Discussion and AnalysisCorporate GovernanceCorporate Social ResponsibilityPT Kalbe Farma Tbk. • Laporan Tahunan 201248Profil Komite RemunerasiRemuneration Committee ProfileKetua Komite Remunerasi sejak tahun 2008.Saat ini beliau menjabat sebagai Ketua KomiteRemunerasi berdasarkan Surat Keputusan DewanKomisaris tentang pengangkatan Komite Remunerasitanggal 10 Oktober 2012.Riwayat hidup dapat dilihat pada bagian riwayat hidupDewan Komisaris.Johannes SetijonoKetua Komite Remunerasi Chairman of Remuneration CommitteeAnggota Komite Remunerasi sejak tahun 2008.Saat ini beliau menjabat sebagai anggota KomiteRemunerasi berdasarkan Surat Keputusan DewanKomisaris tentang pengangkatan Komite Remunerasitanggal 10 Oktober 2012.Riwayat hidup dapat dilihat pada bagian riwayat hidupDireksi.Bernadette Ruth Irawati SetiadyAnggota Komite Remunerasi Member of Remuneration CommitteeChairman of the Remuneration Committee since2008.Currently he serves as the Chairman of theRemuneration Committee based on the Decree of theBoard of Commissioners on the appointment of theRemuneration Committee dated October 10, 2012.For a complete biography please refer to Board ofCommissioners biography section.Member of the Remuneration Committee since 2008.Currently she serves as the member of theRemuneration Committee based on the Decree of theBoard of Commissioners on the appointment of theRemuneration Committee dated October 10, 2012.For a complete biography please refers to Board ofDirectors biography section.
  • 51. PT Kalbe Farma Tbk. • 2012 Annual Report 49Profil Komite Risiko UsahaBusiness Risk Committee ProfileJohannes SetijonoKetua Komite Risiko Usaha Chairman of Business Risk CommitteeAnggota Komite Risiko Usaha sejak tahun 2008.Saat ini beliau menjabat sebagai anggota KomiteRisiko Usaha berdasarkan Surat Keputusan DewanKomisaris tentang pengangkatan Komite RisikoUsaha tanggal 10 Oktober 2012.Riwayat hidup dapat dilihat pada bagian riwayat hidupDireksi.Budi Dharma WreksoatmodjoAnggota Komite Risiko Usaha Member of Business Risk CommitteeAnggota Komite Risiko Usaha sejak tahun 2008.Saat ini beliau menjabat sebagai anggota KomiteRisiko Usaha berdasarkan Surat Keputusan DewanKomisaris tentang pengangkatan Komite RisikoUsaha tanggal 10 Oktober 2012.Riwayat hidup dapat dilihat pada bagian riwayat hidupDireksi.VidjongtiusAnggota Komite Risiko Usaha Member of Business Risk CommitteeChairman of the Business Risk Committee since2008.Currently he serves as the Chairman of the BusinessRisk Committee based on the Decree of the Board ofCommissioners on the appointment of the BusinessRisk Committee dated October 10, 2012.For a complete biography please refer to Board ofCommissioners biography section.Member of the Business Risk Committee since 2008.Currently he serves as the member of the BusinessRisk Committee based on the Decree of the Board ofCommissioners on the appointment of the BusinessRisk Committee dated October 10, 2012.For a complete biography please refer to Board ofDirectors biography section.Member of the Business Risk Committee since 2008.Currently he serves as the member of the BusinessRisk Committee based on the Decree of the Board ofCommissioners on the appointment of the BusinessRisk Committee dated October 10, 2012.For a complete biography please refer to Board ofDirectors biography section.Ketua Komite Risiko Usaha sejak tahun 2008.Saat ini beliau menjabat sebagai Ketua Komite RisikoUsaha berdasarkan Surat Keputusan Dewan Komisaristentang pengangkatan Komite Risiko Usaha tanggal10 Oktober 2012.Riwayat hidup dapat dilihat pada bagian riwayat hidupDewan Komisaris.
  • 52. Performance HighlightsManagement ReportCompany ProfileManagement Discussion and AnalysisCorporate GovernanceCorporate Social ResponsibilityPT Kalbe Farma Tbk. • Laporan Tahunan 201250Profil Komite GCGGCG Committee ProfileKetua Komite GCG sejak tahun 2008.Saat ini beliau menjabat sebagai Ketua Komite GCGberdasarkan Surat Keputusan Dewan Komisaristentang pengangkatan Komite GCG tanggal 10Oktober 2012.Riwayat hidup dapat dilihat pada bagian riwayat hidupDireksi.VidjongtiusKetua Komite GCG Chairman of GCG CommitteeChairman of GCG Committee since 2008.Currently he serves as the Chairman of GCGCommittee based on the Decree of the Board ofCommissioners on the appointment of the GCGCommittee dated October 10, 2012.For the complete biography please refer to the Boardof Directors biography section.Penasihat Komite GCG sejak tahun 2012.Saat ini beliau menjabat sebagai Penasihat KomiteGCG berdasarkan Surat Keputusan Dewan Komisaristentang pengangkatan Komite GCG tanggal 10Oktober 2012.Riwayat hidup dapat dilihat pada bagian riwayat hidupDireksi.Budi Dharma WreksoatmodjoPenasihat Komite GCG Advisor of GCG CommitteeAdvisor of GCG Committee since 2012.Currently he serves as Advisor of GCG Committeebased on the Decree of the Board of Commissionerson the appointment of GCG Committee dated October10, 2012.For a complete biography please refer to Board ofDirectors biography section.Penasihat Komite GCG sejak tahun 2012.Saat ini beliau menjabat sebagai Penasihat KomiteGCG berdasarkan Surat Keputusan Dewan Komisaristentang pengangkatan Komite GCG tanggal 10Oktober 2012.Riwayat hidup dapat dilihat pada bagian riwayat hidupDewan Komisaris.Johannes SetijonoPenasihat Komite GCG Advisor of GCG CommitteeAdvisor of GCG Committee since 2012.Currently he serves as Advisor of GCG Committeebased on the Decree of the Board of Commissionerson the appointment of GCG Committee dated October10, 2012.For a complete biography please refer to Board ofCommissioners biography section.
  • 53. PT Kalbe Farma Tbk. • 2012 Annual Report 51Profil Kepala Unit Audit InternalHead of Internal Audit Unit ProfileProfil Sekretaris PerusahaanCorporate Secretary ProfileKepala Unit Audit Internal sejak 29 Maret 2007.Saat ini beliau menjabat sebagai Kepala Unit AuditInternal berdasarkan Surat Keputusan Direksi tentangPengangkatan Ketua Unit Audit Internal tanggal 29Maret 2007.Beliauadalah lulusandari FakultasEkonomiUniversitasIndonesia jurusan Manajemen dan Akunting dan jugaanggota dari Institute of Internal Audit (IIA) – IndonesiaChapter. Beliau juga meraih gelar profesional sebagaiCertified Internal Auditor (CIA) dan Certified ControlSelf Assesment (CCSA). Sebelum bergabung denganPerseroan, beliau menjabat sebagai Chief InternalAudit – Sales Operation dari PT Astra InternationalTbk. Beliau mulai bergabung dengan Kalbe sejaktahun 2007.Sekretaris Perusahaan sejak tahun 2008.Saat ini beliau menjabat sebagai SekretarisPerusahaan berdasarkan Surat Keputusan Direksitentang pengangkatan Sekretaris Perusahaan tanggal28 Maret 2008.Riwayat hidup dapat dilihat pada bagian riwayat hidupDireksi.Kurniawan TedjoKepala Unit Audit Internal Head of Internal Audit UnitVidjongtiusSekretaris Perusahaan Corporate SecretaryHead of Internal Audit Unit since March 29, 2007.Currently he serves as Head of Internal Audit Unitbased on the Decree of the Board of Directors on theappointment of the Head of Internal Audit Unit datedMarch 29, 2007.He graduated from the Economics Faculty ofUniversity of Indonesia, majoring in Management andAccounting and a member of Institute of Internal Audit(IIA)–IndonesiaChapter.Healsoobtainedprofessionaltitles as Certified Internal Auditor (CIA) and CertifiedControl Self Assessment (CCSA). Before joining theCompany, he had served as the Chief of Internal Auditin Sales Operation of PT Astra International Tbk. Hejoined Kalbe since 2007.Corporate Secretary since 2008.Currently he serves as Corporate Secretary basedon the Decree of the Board of Directors on theappointment of the Corporate Secretary dated March28, 2008.For the complete biography please refer to the Boardof Directors biography section
  • 54. Performance HighlightsManagement ReportCompany ProfileManagement Discussion and AnalysisCorporate GovernanceCorporate Social ResponsibilityPT Kalbe Farma Tbk. • Laporan Tahunan 201252Informasi Pemegang SahamShareholders InformationPemegang Saham (per 31 Desember)Shareholders (as of December 31)Nama Pemegang Saham2012 2011Shareholders’ NamesJumlah Lembar Saham*Number of Shares*%Jumlah Lembar SahamNumber of Shares%PT Gira Sole Prima 4,767,872,885 10.17 953,574,577 10.17 PT Gira Sole PrimaPT Santa Seha Sanadi 4,509,646,840 9.62 901,929,368 9.62 PT Santa Seha SanadiPT Diptanala Bahana 4,447,970,440 9.49 889,594,088 9.49 PT Diptanala BahanaPT Lucasta Murni Cemerlang 4,439,895,440 9.47 887,979,088 9.47 PT Lucasta Murni CemerlangPT Ladang Ira Panen 4,322,952,940 9.22 864,590,588 9.22 PT Ladang Ira PanenPT Bina Arta Charisma 4,060,816,540 8.66 812,163,308 8.66 PT Bina Arta CharismaPublik 20,325,967,025 43.36 4,065,193,405 43.36 PublicSaham yang DiperolehKembali3,904,950,000 - 780.990,000 - Treasury StockTOTAL 50,780,072,110 100.00 10,156,014,422 100.00 TOTAL* Setelah pemecahan nilai nominal saham dengan rasio 1:5 pada tahun 2012After stock split with 1:5 ratio in 2012Pemegang Saham Pengendali Individu (per 31 Desember)Individual Controlling Shareholders (as of December 31)KalbePT Gira SolePrima10.17%PT Santa SehaSanadi9.62%PT DiptanalaBahana9.49%PT Lucasta MurniCemerlang9.47%PT Ladang IraPanen9.22%PT Bina ArtaCharisma8.66%dr. Khouw Lip Swandr. BoenjaminSetiawan, Ph.D.Gerda Veronica Dra. Maria Karmiladrg. Theresia HarsiniSetiadyF. B. Aryanto
  • 55. PT Kalbe Farma Tbk. • 2012 Annual Report 53Kepemilikan Saham Anggota Dewan Komisaris dan Anggota DireksiShare Ownership by the Board of Commissioners and DirectorsNamaNamePosisiPositionJumlah SahamNumber of SharePersentasePercentageDewan Komisaris | Board of CommissionersJohannes Setijono Presiden Komisaris / President Commissioner - -Santoso Oen Komisaris / Commissioner - -Jozef Darmawan Angkasa Komisaris / Commissioner - -Ferdinand Aryanto Komisaris / Commissioner - -Wahjudi Prakarsa Komisaris Independen /Independent Commissioner- -Farid Anfasa Moeloek Komisaris Independen/Independent Commissioner- -Direksi | DirectorsBernadette Ruth Irawati Setiady Presiden Direktur / President Director 4,372,500 0.01%Herman Widjaja Direktur / Director - -Budi Dharma Wreksoatmodjo Direktur / Director - -Vidjongtius Direktur Tak Terafiliasi/ Unaffiliated Director - -Ongkie Tedjasurja Direktur / Director - -Komposisi Kepemilikan Saham Berdasarkan Golongan (Per 31 Desember) (%)Share Ownership Composition Based on Category (As of December 31) (%)Lokal | DomesticAsing | Foreign201266%34%201164%36%
  • 56. Performance HighlightsManagement ReportCompany ProfileManagement Discussion and AnalysisCorporate GovernanceCorporate Social ResponsibilityPT Kalbe Farma Tbk. • Laporan Tahunan 201254Status PemilikJumlah SahamNumber of SharesPersentasePercentageOwner StatusPemodal Nasional Domestic InvestorsPerorangan * 397,253,225 0.85% Individuals*Koperasi 15,300,000 0.03% CooperativesYayasan 11,699,940 0.02% FoundationsDana Pensiun 745,243,315 1.59% Pension FundsAsuransi 430,903,445 0.92% InsurancesBank 2,716,700 0.01% BankingsPerseroan Terbatas** 27,937,626,210 59.60% Limited Liability Companies**Lembaga Keuangan 7,458,796 0.02% Financial InstitutionsReksadana 1,158,224,597 2.47% Mutual FundsTotal Pemodal Nasional 30,706,428,228 65.51% Total Domestic InvestorsPemodal Asing Foreign InvestorsPerorangan 21,184,383 0.05% IndividualsBadan Usaha Asing 16,147,511,499 34.45% Foreign Business EntitiesTotal Pemodal Asing 16,168,895,882 34.49% Total Foreign InvestorsTotal Pemodal (Nasional dan Asing) 46,875,122,110 100.00% Total Investors (Domestic and Foreign)Saham Yang Diperoleh Kembali 3,904,950,000 Treasury StocksTOTAL 50,780,072,110 TOTAL*termasuk Dewan Komisaris, Direksi, dan karyawan | including Board of Commissioners, Board of Directors, and employees**termasuk Pemegang Saham Pendiri | including the Founding ShareholdersSejarah DividenDividend HistorySebelum pemecahan nilai nominal saham (stock split)Before stock splitDividen Tunai (Rp/saham) Cash Dividend (Rp/share)Rasio Pembayaran Dividen (%) Dividend Payout Ratio (%)10.014% 17%26%12.525.070.020082007 2009 2010 201151%60%95.0
  • 57. PT Kalbe Farma Tbk. • 2012 Annual Report 55Kronologis Pencatatan SahamChronological Share ListingPencatatan pada Bursa Efek Indonesia(sebelumnya Bursa Efek Jakarta dan Surabaya)Peningkatan Jumlah SahamIncrease in the Number of SharesListing on the Indonesia Stock Exchange(previously Jakarta and Surabaya Stock Exchange)30 Juli 1991Penawaran Umum dan Pencatatan Terbatas20,000,000July 30, 1991Initial Public Offering and Partial Listing23 April 1992 (BEJ)22 Mei 1992 (BES)Pencatatan Seluruh Saham30,000,000April 23, 1992 (JSX)May 22, 1992 (SSX)Company Listing10 November 1992 (BES)17 November 1992 (BEJ)Saham Bonus50,000,000November 10, 1992 (SSX)November 17, 1992 (JSX)Bonus Shares4 Mei 1993Penawaran Umum Terbatas8,000,000May 4, 1993Rights Issue15 Juli 1994 (BES)18 Juli 1994 (BEJ)Saham Bonus danDividen Saham75,600,00032,400,000July 15, 1994 (SSX)July 18, 1994 (JSX)Bonus Shares andStock Dividend7 Oktober 1996Pemecahan saham dari nilai nominal Rp1.000 menjadiRp500 per saham216,000,000October 7, 1996Change in the nominal value of shares from Rp1,000to Rp500 per share (stock split)24 Agustus 1999Pemecahan saham dari nilai nominal Rp500 menjadiRp100 per saham1,728,000,000August 24, 1999Change in the nominal value of shares from Rp500 toRp100 per share (stock split)6 Desember 2000Saham Bonus1,900,800,000December 6, 2000Bonus Shares19 Desember 2003Pemecahan saham dari nilai nominal Rp100 menjadiRp50 per saham4,060,800,000December 19, 2003Change in the nominal value of shares from Rp100 toRp50 per share (stock split)16 Desember 2005Tambahan penempatan saham sehubungan denganpenggabungan usaha2,034,414,422December 16, 2005Additional issuance of shares in connection with themerger2 Oktober 2012Pemecahan nilai nominal saham dari nilai nominalRp50 menjadi Rp10 per saham40,624,057,688October 2, 2012Change in the nominal value of shares from Rp50 toRp10 per share (stock split)
  • 58. Performance HighlightsManagement ReportCompany ProfileManagement Discussion and AnalysisCorporate GovernanceCorporate Social ResponsibilityPT Kalbe Farma Tbk. • Laporan Tahunan 201256Entitas AnakSubsidiariesNama Anak PerusahaanSubsidiary NameAlamat Anak PerusahaanSubsidiary AddressKegiatan UsahaLine of BusinessMulai BeroperasiKomersialCommencement ofCommercial OperationsKepemilikan EfektifEffective OwnershipPT Bifarma Adiluhung Gedung Plaza Property Lantai 1Kompleks Pertokoan Pulomas VIII/1Jl. Perintis KemerdekaanJakarta Timur 13210Tel. : (62-21) 4786 0033Fax. : (62-21) 4786 0322FarmasiPharmaceuticals1997 100.00%PT Bintang Toedjoe Jl. Jend. A. Yani No.2, PulomasJakarta Timur 13210Tel. : (62-21) 475 7777Fax. : (62-21) 470 1678FarmasiPharmaceuticals1949 100.00%PT Dankos Farma Kawasan Industri PulogadungJl. Rawa Gatel Blok III / SKav. 37-38 Jakarta Timur 13930Tel. : (62-21) 460 0158Fax. : (62-21) 461 1301FarmasiPharmaceuticals2006 100.00%PT Finusolprima FarmaInternasionalKawasan Industri Rawa PasungJl. Raya Bekasi Km. 28,5Bekasi 17133Tel. : (62-21) 884 2253Fax. : (62-21) 884 2254FarmasiPharmaceuticals1981 100.00%PT Hexpharm JayaLaboratoriesGedung Ziebart Lt. 1Jl. Let. Jend. Suprapto Kav. 4Cempaka Putih,Jakarta Pusat 10510Tel. : (62-21) 420 3030, 425 5000Fax. : (62-21) 425 0412FarmasiPharmaceuticals1995 100.00%Innogene Kalbiotech Pte.Ltd.21 Bukit Batok Crescent #28-79WCEGA Tower Singapore 658065Tel. : (65) 6501-0400Fax. : (65) 6501-0401FarmasiPharmaceuticals2004 93.34%Orange Kalbe Limited 66/68 Town Planning Way, Ilupeja,Lagos, NigeriaTel. : (234) 149 33 507/8Fax. : (234) 149 32 233FarmasiPharmaceuticals2009 30.00%PT Pharma Metric Labs Gedung Indra SentralCempaka Putih Unit R & SJl. Let. Jend. Suprapto No.60Jakarta Pusat 10520Tel. : (62-21) 426 9475Fax. : (62-21) 421 0302Jasa Pengujian ProdukContract ResearchService2006 81.64%PT Saka Farma Laboratories Jl. Jend. A. Yani No.2, PulomasJakarta Timur 13210Tel. : (62-21) 4786 6556Fax. : (62-21) 4786 6557FarmasiPharmaceuticals1997 100.00%PT Kalbe MorinagaIndonesiaKawasan Industri IndotaiseiSektor I A Blok Q1,Kota Bukit Indah Karawang 41373Tel. : (62-264) 350 680Fax. : (62-264) 350 679Makanan KesehatanHealth Foods2007 70.00%PT Sanghiang Perkasa Gedung Graha KiranaLantai 5-Suite 501Jl. Yos Sudarso Kav. 88Jakarta Utara 14350Tel. : (62-21) 6531 1234Fax. : (62-21) 6531 1213Makanan KesehatanHealth Foods1982 100.00%PT Hale International Jl. Raya Pemuda Kav. 88ADesa Curug Gn. SindurTel. : (62-251) 860 4691Fax. : (62-251) 860 4690Minuman KesehatanHealth Beverages2012 100.00%
  • 59. PT Kalbe Farma Tbk. • 2012 Annual Report 57Nama Anak PerusahaanSubsidiary NameAlamat Anak PerusahaanSubsidiary AddressKegiatan UsahaLine of BusinessMulai BeroperasiKomersialCommencement ofCommercial OperationsKepemilikan EfektifEffective OwnershipPT Kalbe Milko Indonesia Jl. Let. Jend Suprapto Kav 4Jakarta 10510 P.O. Box 3105 JAK.Tel. : (62-21) 42873888 - 89Fax. : (62-21) 4256326Makanan KesehatanHealth FoodsUnder construction 51.00%PT Enseval PuteraMegatrading Tbk.Kawasan Industri PulogadungJl. Pulo Lentut No.10Jakarta Timur 13920Tel. : (62-21) 4682 2422Fax. : (62-21) 460 9039Distributor Obat-obatanPharmaceuticalsDistributor1993 91.75%PT Tri Sapta Jaya Kawasan Industri PulogadungJl. Pulogadung No. 10Jakarta Timur 13920Tel. : (62-21) 461 8737Fax. : (62-21) 4683 2926Distributor Obat-obatanPharmaceuticalsDistributor1980 91.75%PT Enseval Medika Prima Kawasan Industri PulogadungJl. Pulo Lentut No. 10Jakarta Timur 13920Tel. : (62-21) 4682 3234Fax. : (62-21) 4682 2413Distributor PeralatanKesehatanDistribution of MedicalInstruments2008 91.75%PT Global ChemindoMegatradingKawasan Industri PulogadungJl. Pulo Kambing Raya Kav. 2E,No. 8Jakarta Timur 13920Tel. : (62-21) 4683 0028Fax. : (62-21) 4683 6167Penjualan Bahan BakuObat-obatanTrading of RawMaterials forPharmaceuticalsProducts2008 91.75%PT Millenia Dharma Insani Kawasan Industri PulogadungJl. Pulo Lentut No.10Jakarta Timur 13920Tel. : (62-21) 4682 2422Fax. : (62-21) 4682 2479Apotek, PerdaganganProduk Farmasi danKlinik PelayananKesehatanPharmacy, Tradingof PharmaceuticalsProducts andHealthcare Clinics2003 91.75%PT Renalmed Tiara Utama Kawasan Industri PulogadungJl. Pulo Lentut No. 10Jakarta Timur 13920Tel. : (62-21) 460 9046Fax. : (62-21) 4682 2457Perdagangan PeralatanKesehatan dan BarangHabis PakaiTrading of MedicalInstruments andConsumable Products2008 90.60%Kalbe Vision Pte. Ltd. 21 Bukit Batok Crescent#27-79 WCEGA TowerSingapore 658065Tel. : (65) 65010419Fax. : (65) 65010401Pengembangan,Produksi, Pemasarandan Distribusi ProdukKesehatan MataDevelopment,Production, Marketingand Distribution of EyeHealth Products2008 100.00%Kalbe International Pte. Ltd. 21 Bukit Batok Crescent#27-79 WCEGA TowerSingapore 658065Tel. : (65) 65010419Fax. : (65) 65010401Pemasaran ProdukKesehatan dan FarmasiWholesale of Medicaland PharmaceuticalProducts2007 100.00%Asiawide Kalbe Philippines,Inc.Unit 201 Solmac Building,84 Dapitan Street CornerBanawe Street Quezon City,Philippines.Tel. : (632) 516-526Fax : (632) 516-526Pemasaran MinumanEnergi Siap SajiMarketing of EnergyDrink in Ready-to-drinkFormat2010 50.00%
  • 60. Performance HighlightsManagement ReportCompany ProfileManagement Discussion and AnalysisCorporate GovernanceCorporate Social ResponsibilityPT Kalbe Farma Tbk. • Laporan Tahunan 201258Daftar PrinsipalPrincipals ListObat ResepPrescriptionsPT InterbatPT NufarindoObat Bebas dan Produk KonsumenOTC and Consumer ProductsHandjono Jf (John Francis)Osaki Medical IndonesiaPT Abbott IndonesiaPT Anugrah Persada AlamPT Aquasolve SanariaPT Beiersdorf IndonesiaPT Hermon Anugrah IndahPT Impers PratamaPT InterbatPT Kara Santan PertamaPT L’Oreal IndonesiaPT Mead Johnson IndonesiaPT Nata Meridian InvestaraPT Tata NutrisanaPeralatan KesehatanMedical DevicesArgon Critical care systemsBellcoBiomerieux & QvidelBMI BiomedicalBoston ScientificBPC Biosed SrlCarefusionCovidienCV Beauty KasatamaDemetech corpDental EZ IncorporationEntra Health SystemsEppendorft AGFALC Instruments S.R.L.Fukuda SangyoGE HealthcareInterscienceJ.S. ResearchMAKMedex Loncin S.AMegadyneMG ElectricNakamura Medical Industry Co., Ltd.One BiotechOsaki Medical IndonesiaPro-Lab DiagnosticPT 3M Indonesia Food SafetyPT Jantra Reka SaksanamasPT Medquest Jaya GlobalPT Renalmed Tiara UtamaPT Roche IndonesiaPT Indoprima BionetPT SNA MedikaPT Sterin LaboratoriesScientech, Inc.SGM BiotechSiare Engineering International GroupSooil development Co. Ltd.Syngene (SGM Biotech, Inc.)Tesena InovindoThermo Fisher Scientific OyBahan BakuRaw MaterialsA & E Connock (Perfumery)Advanced NutraceuticalAdvanced Protein SystemAir Products And ChemicalAkzo NobelAland (Jiangsu) NutraceuticalAntibiotice S.A.Augustus Oils Ltd.Avignon Resonance SpecialAzelis Uk Ltd.Basf Care Chemical IndonesiaBasf South East AsiaBasildonBiotech MarineChangsu Huagang Pharma Co., Ltd.Changzhou Siyao Pharm.Co., Ltd.Changzhou Synhyper Biotehcnology Co., Ltd.Chelated Minerals InternationalChengda Pharmaceuticals Co., Ltd.Chongqing Aoli Bio-Pharmaceutical Co., Ltd.Dafeng Huashu Pharmaceutical Co., Ltd.Daicel Chemical Industries Co., Ltd.Daiichi Fine Chemical Co., Ltd.Divis Laboratories LimitedDMV Fontera Excipient GmbHDMV International B.V.
  • 61. PT Kalbe Farma Tbk. • 2012 Annual Report 59Dow CorningDrom Fragrances InternationalEmerald Kalama ChemicalsFriesland Campina DomoFuchi Pharmaceutical Co., Ltd.Fuji Chemicals Industry Co., Ltd.Fuyang Best Flavor Perfumery Co., Ltd.Glenmark PharmaceuticalsGrain Processing CorporateGuangzhou Tinci MaterialsHanMi Pharmaceuticals Co., Ltd.Henan LihuaHenan Topfond Pharmaceutical Co., Ltd.Huazhong Pharmaceutical Co., Ltd.Huisong PharmaceuticalsHunan Dongting Pharmaceuticalco., Ltd.Ikeda CorporationImperial Industrial ChemicalsIpca Laboratories Ltd.Isky Chemical Co., Ltd.Jilin Pharmaceutical Co., Ltd.Jilin Shulan Syntetic Pharmaceutical Co., Ltd.Kirin Kyowa Foods CompanyKobo Products, Inc.Kyowa Chemical Industry Co., Ltd.Lianyungang Debang Fine ChemicalLonza Ltd.Lupin Ltd.Malladi Drugs & PharmaceuticalsMega Fine Pharma (P) LtdMehta Pharmaceutical IndustriesMerck KgaaMerix Laboratories PrivateMinsheng Group Shao XingMonix IndonesiaNantong Tianhong InternationalNb EnterpreneursNingxia Qiyuan PharmaceuticalNutrasweet IndonesiaOker Chemie GmbhPaik Kwang Industrial Co.Qianjiang Yongan PharmaceuticalQuat-Chem LimitedResonance Specialties Ltd.Resources Of Nature LlcSahjanand Ferro AlloysSamyang Genex CorporationShandong NB Technology Co.Shandong Xinhua Pharm Co.Shenyang BioticSiddarth InternationalSisecam Dis Ticaret A.S.Sms Pharmaceuticals Ltd.Sohan Healthcare Pvt Ltd.Stellar Chemicals Laboratories Pvt. Ltd.Sumitomo Chemical SingaporeSun Pharmaceutical IndustrySupriya LifescienceSymbiotica SpecialityTaminco Choline ChlorideTaminco Ghent BelgiumTechnoble Co., Ltd.Techpack Solutions Co., Ltd.Teva Pharmaceutical WorksTianjin Zhongjin Pharm.Co., Ltd.Tianxin Pharmacauticals (Group)Trouw IndonesiaTTCA Co., Ltd.Ueno Fine Chemicals IndustryUnivar B.V.Virchow Laboratories Ltd.Vitasweet Co., Ltd.Wanbury, Ltd.Weifang Ensign IndustryWeifang Qiangyuan ChemicalWestern Drugs Pvt.,Ltd.Wockhardt Ltd.Wuhan Grand Pharmaceutical Group Co., Ltd.Xiamen Kingdomway Group Co.Xi’an Day Natural Tech. Co.Yangzhou Lianhuan PharmaYongsan Chemical, Inc.Yung Zip Chemical Ind. Co., Ltd.Zagro Singapore Pte., Ltd.Zhejiang Apeloa Kangyu Pharmaceuticals Co., Ltd.ZhejiAng Hisoar Pharmaceutical Co., Ltd.Zhejiang Hisun Pharmaceutical Co., Ltd.Zhejiang Kangle Pharmaceutical Co., Ltd.Zhejiang Qiming Pharmaceutical Co., Ltd.Zhejiang Xinhua PharmaceuticalsZhuhai United Laboratories Co., Ltd.Zschimmer & Schwarz
  • 62. Performance HighlightsManagement ReportCompany ProfileManagement Discussion and AnalysisCorporate GovernanceCorporate Social ResponsibilityPT Kalbe Farma Tbk. • Laporan Tahunan 201260IndonesiaPharmaceuticalDistributor Companyof the Year untukPT Enseval PuteraMegatrading Tbk. dariFrost & SullivanIndonesiaPharmaceuticalDistributor Companyof the Year for PTEnseval PuteraMegatrading Tbk.from Frost & SullivanThe Most Admired Enterprises 2012 untuk kategoriInovasi dari ASEAN Business Awards (ABA)The Most Admired Enterprises 2012 in the category ofInnovation from ASEAN Business Awards (ABA)Fastest GrowingHome GrownCompany in OncologyCare untuk InnogeneKalbiotech dari Frost& SullivanFastest GrowingHome GrownCompany in OncologyCare for InnogeneKalbiotech from Frost& SullivanPrestasi dan PenghargaanRecognitions and AwardsPerformance HighlightsManagement ReportCompany ProfileManagement Discussion and AnalysisCorporate GovernanceCorporate Social Responsibility20 Most Admired Companies2011 dari Majalah FortuneIndonesia20 Most Admired Companies2011 from Fortune IndonesiaMagazineIndonesia’s 2nd BestInvestor Relationsdari Asia MoneyIndonesia’s 2nd Bestfor Investor Relationsfrom Asia MoneyAsia’s Best ManagedCompanies 2012 dariFinance AsiaAsia’s Best ManagedCompanies 2012 fromFinance Asia
  • 63. PT Kalbe Farma Tbk. • 2012 Annual Report 61Indonesia CustomerSatisfaction Award(ICSA) untuk Promagdan MixagripIndonesia CustomerSatisfaction Award(ICSA) for Promagand MixagripIndonesia BestBrand Award for 4Consecutive Years(2009-2012), dariSwa dan Mars, padakategori CoughMedicine untukKomixIndonesia BestBrand Award for 4Consecutive Years(2009-2012), fromSwa dan Mars, in thecategory of CoughMedicine for KomixIndonesia’s MostFavorite WomenBrand kategori obatOTC sakit perut untukPromagIndonesia’s MostFavorite WomenBrand, categoryOTC medicine –stomachache, forPromagIndonesia MostFavorite Youth Brand2012 dalam kategoriFood & BeverageProduct, EnergyDrink, dari MarkPlusInc. and Marketeers,untuk Extra JossIndonesia MostFavorite Youth Brand2012 in the categoryof Food & BeverageProduct, EnergyDrink, from MarkPlusInc. and Marketeers,for Extra JossIndonesia BrandChampion 2012 untukPromag dan Fatigondari Marketeers danMarkPlusIndonesia BrandChampion 2012 forPromag and Fatigondari Marketeers andMarkPlusReader’s Choice Award2012 di kategori produknutrisi dan suplemen untukibu untuk Prenagen dariMajalah Mother & BabyReader’s Choice Award2012 in the categoryof mothers’ nutritionalsproduct and supplementfor Prenagen from Mother& Baby MagazineRekor Bisnis“Perusahaan NutrisiPertama yangMeluncurkan ProgramMulti ChannelNutritionals Store diIndonesia” oleh TERAFoundation dan HarianSeputar IndonesiaBusiness Record“The First NutritionalCompany whichlaunches Multi ChannelNutritional StoreProgram in Indonesia”from TERA Foundationand Seputar IndonesiaNewspaperTop Brand Award2012 untukPromag, Fatigon,Neo Entrostop,dan Mixagrip dariFrontier dan MajalahMarketingTop Brand Award2012 for Promag,Fatigon, NeoEntrostop, andMixagrip from Frontierand MarketingMagazine
  • 64. Performance HighlightsManagement ReportCompany ProfileManagement Discussion and AnalysisCorporate GovernanceCorporate Social ResponsibilityPT Kalbe Farma Tbk. • Laporan Tahunan 2012621966199519891977 1991199719812005199219851994PendirianPerseroandengan namaPT KalbeFarmaIncorporation ofthe Companyunder thename PT KalbeFarmaMemperkuatbisnis farmasimelaluipendirianPT DankosLaboratoriesStrengtheningpharmaceuticalsbusinessthrough theestablishmentof PT DankosLaboratoriesPT KalbeFarmamelakukanPenawaranUmum PerdanaPT KalbeFarmaconducted itsInitial PublicOfferingPengalihanbisnis distribusikepadaPT Ensevalsesuai denganketentuanperaturanpemerintahSpin-off thedistributionbusiness toPT Enseval tocomply withgovernmentregulationAkuisisiPT SanghiangPerkasa dankonsolidasibisnis nutrisike dalam anakperusahaan iniAcquisition ofPT SanghiangPerkasa andconsolidationof nutritionalbusiness into thissubsidiaryEkspansi keusaha produkkesehatan melaluiakuisisiPT BintangToedjoe danmemperkuatusaha farmasimelalui akuisisiPT HexpharmJayaExpansion intoconsumer healthbusiness throughacquisition of PTBintang Toedjoeand strengtheningpharmaceuticalsbusiness throughacquisition ofPT HexpharmJayaDilusi 50%kepemilikan padaPT Helios Arnott’sIndonesia yangbergerak dalambisnis makananDilution of 50%ownership in PTHelios Arnott’sIndonesia whichengaged in the foodbusinessPT Igar Jayadan PT DankosLaboratoriesmelakukanPenawaranUmum PerdanaPT Igar Jayaand PT DankosLaboratoriesconducted theirInitial PublicOfferingKonsolidasiGrup KalbeConsolidationof Kalbe Group• Penjualan sisa 50%kepemilikan padaPT Helios Arnott’sIndonesia Divestment of remaining50% ownership inPT Helios Arnott’sIndonesia• Penjualan divisipengemasan gelaskepada Schott GlasswerkeBeteiligungs GmbH Divestment of glasspackaging division toSchott GlasswerkeBeteiligungs GmbH• Akuisisi merek Woods’ Acquisition of Woods’brand• Akuisisi 80% sahamPT Saka FarmaLaboratories Acquisition of 80%ownership in PT SakaFarma Laboratories• Memulai bisnisminumanenergi denganpeluncuran ExtraJoss Entry into energydrink market withthe launching ofExtra Joss• PT Enseval PuteraMegatradingTbk. (“EPMT”)melakukanPenawaran UmumPerdana PT Enseval PuteraMegatradingTbk. (“EPMT”)conducted itsInitial PublicOfferingJejak LangkahMilestonesPT Kalbe Farma Tbk. • Laporan Tahunan 201262
  • 65. PT Kalbe Farma Tbk. • 2012 Annual Report 632009 201020072006 2008• Peningkatankepemilikan atasPT Saka FarmaLaboratories hingga100% melalui PTBintang Toedjoe Increasing itsownership inPT Saka FarmaLaboratories up to100% throughPT Bintang Toedjoe• Peningkatankepemilikan atasEPMT hingga83,75% melaluiPenawaran Tender Increasing itsownership inEPMT up to 83.75%through Tender Offer• Pelunasan ObligasiKalbe Farma I Tahun2006 sejumlahRp 300 miliar• Meluncurkan logoperusahaan yangbaru sebagaibagian dari prosestransformasi Launch ofnew corporatelogo as part oftransformationprocess• Produk-produkmemasuki semuanegara ASEAN,kecuali Laos Products enter allASEAN countriesexcept Laos• Pendirian StemCell dan CancerInstitute Establishment ofthe Stem Cell andCancer Institute• AkuisisiPT RenalmedTiara Utamayang bergerakdi bidangperdaganganperalatankesehatan Acquisition of PTRenalmed TiaraUtama whichis engagedin trading ofmedical devices• Memperluascakupan regional Expand regionalfootprint• Membangun merekdan infrastrukturglobal Build global brandsand infrastructure• Meningkatkanfokus bisnis melaluipenggabunganusaha dan akuisisi Scale up throughmergers andacquisitions• PembentukanPerusahaan JointVenture di Filipina Establishing aJoint VentureCompany in thePhilippines• DivestasiPT Kageo IgarJaya Tbk. yangmerupakanDivisi KemasanPerseroan Divestment ofPT Kageo IgarJaya Tbk., theCompany’sPackaging Division• EPMT melakukan penawaran hakmemesan efek terlebih dahulu untukmembiayai ekspansi EPMT conducted rights issue tofinance expansion• Peningkatan kepemilikan atasEPMT, anak perusahaan Perseroan,hingga 91,75%. Increased ownership of EPMT, theCompany’s subsidiary, to 91.75%• Peningkatan rasio pembayaran dividenmenjadi 51% Increased dividend payout ratio to 51%2011• Meningkatkanpengembanganpenemuan obat Intensifyproprietary drugdevelopment• Membangunjaringan dankemitraan global Establish globalpartnerships andnetworks• Implementasiperbaikanpengelolaan rantaipasokan secaramenyeluruh End-to-end supplychain managementimprovementsimplemented• Sistem teknologiinformasi yangterintegrasi Informationtechnologysystems integrated• Memulai programpembelian kembalisaham Commencing sharebuy-back program• Perolehan izinedar TheraCIMdi Indonesia danFilipina TheraCIM securedits registrationapproval inIndonesia and thePhilippines• Peresmian outletpertama KlinikMitrasana diCikarang Inauguration ofthe first outlet ofMitrasana Clinic inCikarang Full repaymentof Kalbe FarmaI Bonds 2006amounting toRp 300 billion• PelaksanaanStrategiProductivity-Innovation CashFlow (PIC) ExecutingProductivity-Innovation-CashFlow (PIC)StrategyPT Kalbe Farma Tbk. • 2012 Annual Report 63
  • 66. Performance HighlightsManagement ReportCompany ProfileManagement Discussion and AnalysisCorporate GovernanceCorporate Social ResponsibilityPT Kalbe Farma Tbk. • Laporan Tahunan 201264Peristiwa Penting 2012Event Highlights 2012Peristiwa KorporatCorporate EventsKalbe menerima penghargaan “Asia’s Best ManagedCompanies 2012” dari Finance Asia.Kalbe was awarded as the “Asia’s Best ManagedCompanies 2012” from Finance Asia.10 Maret MarchPenandatanganan Perjanjian Usaha Patungan untukpendirian PT Kalbe Milko Indonesia yang bergerak di bidangindustri/manufaktur makanan dan minuman kesehatan.Signing of Joint Venture Agreement for the establishment ofPT Kalbe Milko Indonesia, engaged in the manufacturing ofhealth foods and beverages.28 Juni JunePeresmian pabrik obat generik PT Hexpharm Jaya diCikarang, Jawa Barat oleh Menteri Kesehatan Almarhumahdr. Endang Rahayu Sedyaningsih.Inauguration of new plant dedicated for generic productionunder PT Hexpharm Jaya in Cikarang, West Java by the lateMinister of Health dr. Endang Rahayu Sedyaningsih.28 Februari FebruaryKalbe berpartisipasi dalam Investor Day 2012 yangdiselenggarakan oleh Bursa Efek Indonesia, Asosiasi EmitenIndonesia, PT KSEI, dan KPEI.Kalbe participated in the Investor Day 2012 organized byIndonesian Stock Exchange, Indonesian Association ofIssuer (AEI), PT KSEI, and KPEI.4 Mei MayPelaksanaan Rapat Umum Pemegang Saham Tahunan danRapat Umum Pemegang Saham Luar Biasa PT Kalbe FarmaTbk.Annual General Meeting of Shareholders and ExtraordinaryGeneral Meeting of Shareholders of PT Kalbe Farma Tbk.23 Mei MayKalbe menerima penghargaan “2nd Best Investor Relations”tahun 2012 dari Asia Money.Kalbe was awarded the “2nd Best Investor Relations” year2012 from Asia Money.26 Januari January
  • 67. PT Kalbe Farma Tbk. • 2012 Annual Report 65PT Enseval Putera Megatrading Tbk., anak perusahaanPerseroan, menerima penghargaan Indonesia ExcellenceAward 2012 dalam kategori “Indonesian PharmaceuticalDistributor Company of the Year” dari Frost & Sullivan.PT Enseval Putera Megatrading Tbk., the Company’ssubsidiary, received Indonesia Excellence Award 2012 inthe category of the “Indonesian Pharmaceutical DistributorCompany of the Year” from Frost & Sullivan.23 Oktober OctoberKalbe menerima penghargaan Rekor Bisnis “PerusahaanNutrisi Pertama yang Meluncurkan Program Multi ChannelNutritionals Store in Indonesia” dari TERA Foundation danHarian Seputar IndonesiaKalbe was awarded Business Record “The First NutritionalsCompany to Launch a Multi Channel Nutritionals StoreProgram in Indonesia” from TERA Foundation and SeputarIndonesia Newspaper.7 November NovemberKalbe menerima penghargaan dari ASEAN Business Awardssebagai “the Most Admired ASEAN Enterprises” dalamkategori inovasi.Kalbe received awards from ASEAN Business Awards as“the Most Admired ASEAN Enterprises” in the category ofinnovation.18 November NovemberInnogene Kalbiotech Pte. Ltd., anak perusahaan Perseroan,menerima penghargaan Indonesia Excellence Award 2012dalam kategori “Fastest Growing Homegrown Company inOncology Care” dari Frost & Sullivan.Innogene Kalbiotech Pte. Ltd., the Company’s subsidiary,received Indonesia Excellence Award 2012 in the categoryof the “Fastest Growing Homegrrown Company in OncologyCare” from Frost & Sullivan.27 September SeptemberPenandatanganan Akta Pengalihan Saham dalam rangkaakuisisi 100% saham PT Hale International, sebuahperusahaan minuman kesehatan Indonesia.Signing of Share Transfer Deed in the acquisition of 100%shares of PT Hale International, an Indonesian-based healthbeverage company.6 Juli JulyPeluncuran “Kalbe Family Rewards Card”, sebuah programuntuk membangun consumer loyalty dengan merangkulsemua pelanggan dalam satu ikatan keluarga Kalbe.Launching of the Kalbe Family Rewards Card, a programto develop consumer loyalty by embracing all customersthrough one Kalbe family.8 Agustus August
  • 68. Performance HighlightsManagement ReportCompany ProfileManagement Discussion and AnalysisCorporate GovernanceCorporate Social ResponsibilityPT Kalbe Farma Tbk. • Laporan Tahunan 201266Januari - DesemberJanuary - DecemberAktivitas PemasaranLangsung kepadaKonsumenDirect-to-Consumer Marketing ActivitiesKalbe, melalui brand Morinaga, mengadakan kegiatanedukasi bertajuk “Morinaga Dunia Generasi Platinum”, yangantara lain berupa kompetisi anak-anak, konsultasi orangtua, talkshow & seminar orang tua, berikut edutainmentuntuk anak-anak di 40 kota di Indonesia dengan totalpeserta sekitar 200.000 orang.Kalbe, through its Morinaga brand, conducted educationalactivities “Morinaga Dunia Generasi Platinum”, whichinclude kids competition, parental consultations, talk shows& seminars and edutainment for kids in 40 cities acrossIndonesia with total participants of more than 200,000people.Januari - DesemberJanuary - DecemberKalbe, melalui brand Diabetasol, melakukan kampanye gayahidup sehat seperti pola makan 3J (Jumlah, Jenis, Jadwal)dan kegiatan komunitas sehat seperti aksi jalan dan senamsehat di 10 kota di Indonesia.Kalbe, through its Diabetasol brand, conducted healthylife campaign such as 3J diet campaign (Quantity, Type,Schedule) and healthy community activities such as healthywalk and exercise in 10 cities across Indoenesia.Mei - DesemberMay - DecemberKalbe, melalui produk terbarunya Extra Joss Nitros,mengadakan Kampanye Safety Riding bagi parapengendara sepeda motor.Kalbe, through its new product, Extra Joss Nitros,conducted Safety Riding Campaign for motor cyclists.Oktober - DesemberOctober - DecemberKalbe, melalui brand Prenagen, melakukan rangkaiankegiatan “Prenagen & The City” di 6 kota besar di Indonesia,dengan total peserta lebih dari 10.000 ibu hamil.Kalbe, through its Prenagen brand, conducted sequenceof events of “Prenagen & The City” in 6 major cities acrossIndonesia, attended by more than 10,000 expectantmothers.April - SeptemberApril - SeptemberKalbe, melalui brand Fatigon, mengadakan gerakan “FatigonAksi Semangat Indonesia” dengan berbagai macamkegiatan di berbagai kota di Indonesia, termasuk aksi jalandan senam sehat yang melibatkan lebih dari 54.000 orang.Kalbe, through its Fatigon brand, conducted “Fatigon AksiSemangat Indonesia” activities, with various events acrossIndonesia, including fun walk and healthy exercise with totalparticipants of more than 54,000 people.Mei - DesemberMay - DecemberKalbe, melalui brand Hydro Coco, mengadakan serangkaiankegiatan bersepeda fun bike di 11 kota besar di Indonesiayang secara keseluruhan diikuti oleh lebih dari 110.000peserta.Kalbe, through its Hydro Coco brand, organized series of funbike activities in 11 major cities in Indonesia which in totalwere joined by more than 110,000 participants.
  • 69. PT Kalbe Farma Tbk. • 2012 Annual Report 67Kalbe, melalui brand Promag, mengadakan Pusat KonsultasiAhlinya Lambung di Jakarta, dengan total sekitar 1.500pasien.Kalbe, through its brand Promag, conducting ConsultationCentre for gastric health in Jakarta, with total patients of1,500 people.16-21 Agustus August20 & 25 Januari January!Kalbe mengadakan rangkaian pelayanan kesehatan gratis diKabupaten Jombang dan Tulungagung, Jawa Timur, dengantotal pasien mencapai sekitar 1.500 orang.Kalbe conducted sequence of free healthcare services inJombang & Tulungagung, East Java, with a total of 1,500beneficiaries.15 Februari February &19 September SeptemberKalbe menyelenggarakan “Kalbe Junior Scientist Award2012” (KJSA), sebuah penghargaan kepada para ilmuwancilik setingkat SD. Kompetisi diselenggarakan sejakApril – September 2012, dengan puncak acara danpenganugerahan penghargaan pada tanggal 9 September2012.Kalbe conducted “Kalbe Junior Scientist Award 2012” astributes to junior scientists in elementary school. Selectionprocess was held during April – September 2012 while theawarding ceremony was held on September 9, 2012.9 September SeptemberKalbe menyelenggarakan “Kalbe Junior Science Fair 2012”(KJSF) dengan tema “Inovasi untuk Kehidupan yang lebihBaik”, yang dihadiri lebih dari 30.000 pengunjung.Kalbe conducted “Kalbe Junior Science Fair 2012” with thetheme of “Innovation for a Better Life”, attracting more than30,000 visitors.8-9 September SeptemberKalbe, bekerjasama dengan Kementerian Riset danTeknologi Indonesia, menyelenggarakan “Ristek KalbeScience Awards” (RKSA) 2012, dengan penganugerahanpenghargaan pada tanggal 5-6 September 2012.Kalbe, in cooperation with the Ministry of Research andTechnology, held the “Ristek Kalbe Science Award” (RKSA)2012 with awarding ceremony on September 5-6, 2012.5-6 September SeptemberAktivitas Tanggung JawabSosialCSR ActivitiesKalbe, melalui brand Extra Joss, mengadakan pengobatanberkala untuk pedagang asongan di area Jakarta Raya danBandung dengan total pasien mencapai 660 orang.Kalbe, through its brand Extra Joss, periodically conductedfree health service for hawkers in the Greater Jakarta Areaand Bandung, with total patients of 660 people.Maret - Oktober March - OctoberKalbe, melalui brand Entrostop dan Kalpanax, memberikanbantuan sembako bagi sekitar 2.000 warga korban banjir diPati dan sekitar 1.200 warga korban banjir di Pandeglang.Kalbe, through its brand Entrostop and Kalpanax, providedrelief aids for more than 2,000 flood victims in Pati and morethan 1,200 flood victims in Pandeglang.
  • 70. ANALISIS DAN PEMBAHASAN MANAJEMENManagement Discussion and Analysis
  • 71. Meraih PeningkatanNilai Jangka Panjangbagi Seluruh PemangkuKepentinganDelivering Enhanced Long-term Valueto All StakeholdersTinjauan Usaha • Business ReviewTinjauan Industri • Industrial ReviewTinjauan Operasional • Operational Review76-10370-75104-135Tinjauan Keuangan • Financial Review136-167
  • 72. Performance HighlightsManagement ReportCompany ProfileManagement Discussion and AnalysisCorporate GovernanceCorporate Social ResponsibilityPT Kalbe Farma Tbk. • Laporan Tahunan 201270Ekonomi Global dan Indonesia Tahun 2012Tahun 2012 masih ditandai dengan rendahnya pertumbuhan disebagian besar negara maju, serta melambatnya pertumbuhanekonomi di negara-negara berkembang.Selama dua tahun terakhir, Eropa harus menghadapi masalahhutang pemerintah di negara-negara Yunani, Portugal, Irlandia,Spanyol dan Italia. Hingga saat ini, keputusan-keputusan pentingyang diambil, serta komitmen negara Uni Eropa untuk membantupemerintah yang mengalami masalah dan reformasi regulasiperbankan, telah berhasil mengatasi beban hutang dari negara-negara tersebut.Di Amerika Serikat, lambatnya pertumbuhan ekonomi duniadan masalah kebijakan fiskal domestik telah menghambatpertumbuhan di tahun 2012. Selama tahun 2012, ekonomi Amerikaharus menghadapi masih relatif tingginya angka pengangguran,turunnya tingkat kepercayaan konsumen dan dunia usaha, sertakrisis “jurang fiskal” di akhir Desember 2012.Global and Indonesian Economy in 20122012 was still marked with weak growth for most developedcountries, and one of slowing economic growth for developingnations.Europe has spent the last two years fighting to contain sovereigndebt problems that have emerged in Greece, Portugal, Ireland,Spain and Italy. So far, austerity measures, combined with Euroarea commitments to bail out troubled national governmentsand to reform banking regulations, have mostly contained theborrowing costs of the troubled nations.In the U.S., the slowing of economic growth globally andunresolved domestic fiscal policy issues constrained growth in2012. During the year, the U.S. economy had to face persistenthigh unemployment, shaken consumer and business confidence,and fiscal cliff crisis at the end of December 2012.Tinjauan IndustriIndustrial ReviewMemanfaatkan Peluang untukMenawarkan Solusi KesehatanTerbaik bagi IndonesiaTapping the Opportunity to Provide the Best HealthSolutions for Indonesia
  • 73. PT Kalbe Farma Tbk. • 2012 Annual Report 71Pengaruh resesi di Eropa dan rendahnya pertumbuhan AmerikaSerikat, telah mulai dirasakan oleh wilayah-wilayah lain, terutamadi Asia. Terjadi penurunan permintaan produk manufaktur yangberasal dari negara berkembang, terutama dari Cina. Perlambatanini telah mulai dirasakan oleh negara-negara yang memilikihubungan dagang dengan Cina serta menekan permintaan akanproduk-produk komoditas, yang berakibat pada negara eksportirkomoditas.Melemahnya harga komoditas di tahun 2012 telah mempengaruhiekspor komoditas Indonesia, yang terutama didominasi olehkomoditas kelapa sawit dan batu bara. Selain itu, tetap tingginyapermintaan akan mata uang asing untuk membiayai kebutuhanimpor Indonesia, telah menekan surplus perdagangan danmenyebabkan gejolak mata uang Rupiah di semester kedua2012 sehingga nilai mata uang melemah ke level Rp9.670 di akhirtahun.The impacts of the recession in Europe and tepid growth in theU.S. are beginning to be felt in other regions of the world, mostsignificantly Asia. We witnessed declines in the demand formanufactured goods from developing nations, most notably fromChina. This slowdown hit countries with close trade links withChina and lowered demands for commodity products, puttingpressures to commodity exporters.The weakening of commodity prices in 2012 has impacted exportsof Indonesia’s commodities, largely dominated by crude palm oiland coal. Coupled with constant demand for foreign exchangeto finance the country’s import requirements, we experiencedlower trade surplus, triggering Rupiah volatility during the secondsemester that weakened to the Rp9,670 level at year end.…didukung oleh besarnya jumlah penduduk dan makintumbuhnya segmen kelas menengah, Indonesia memilikipotensi menjadi pasar yang menarik bagi industrikesehatan dan farmasi, yang diperkirakan akan mencapaiRp312 triliun di tahun 2015.…thanks to the country’s vast population and growing middle class base, Indonesia has the potentialto be a lucrative healthcare and pharmaceuticals market, projected to reach Rp312 trillion by 2015.15.9%6.2%Pertumbuhan ekonomiIndonesia tahun 2012Indonesia’s economicgrowth in 2012Pertumbuhan pasar farmasiIndonesia tahun 2012Indonesia’s pharmaceuticalsmarket growth in 2012
  • 74. Performance HighlightsManagement ReportCompany ProfileManagement Discussion and AnalysisCorporate GovernanceCorporate Social ResponsibilityPT Kalbe Farma Tbk. • Laporan Tahunan 201272Walaupun harus menghadapi berlanjutnya turbulensi dunia,Indonesia berhasil mempertahankan momentum pertumbuhanekonominya. Didukung masih berlanjutnya permintaan domestikdari 240 juta penduduk Indonesia, serta meningkatnya investasibaru mencapai Rp313,2 triliun (sumber: Badan KoordinasiPenanaman Modal), Indonesia sekali lagi membuktikanketangguhan ekonominya yang mencapai pertumbuhan produkdomestik bruto (PDB) sebesar 6,2% di 2012, sedikit lebih rendahdari performa tahun sebelumnya sebesar 6,5%. (Sumber: BankIndonesia 2012)Inflasi tetap terjaga sebesar 4,3%, didukung oleh stabilnya hargadan ketersediaan pangan, serta keputusan Pemerintah untukmempertahankan subsidi bahan bakar. Dengan demikian, BankIndonesia (BI) dapat mempertahankan tingkat suku bunga BIdi 5,75% di tahun 2012. Didorong oleh masuknya modal asing,pasar modal domestik juga menikmati pertumbuhan, di manaindeks harga saham Bursa Efek Indonesia (BEI) mencapai lebihdari 4.300 serta dipandang sebagai salah satu pasar berkinerjaterbaik di Asia. (Sumber: Bank Indonesia 2012)6.04.66.26.56.22008 2009 2010 2011 2012Pertumbuhan PDB Indonesia 2008-2012 (% y-o-y)2008-2012 Indonesia’s GDP Growth (% y-o-y)11.12.87.03.84.32008 2009 2010 2011 2012Tingkat Inflasi Indonesia 2008-2012 (%)2008-2012 Indonesia’s Inflation Rate (%)Sumber Source: Bank Indonesia 2012Industri Kesehatan dan Farmasi IndonesiaDibandingkan dengan negara-negara tetangga, pasar industrikesehatan Indonesia masih relatif kecil. Di antara negara-negaraASEAN, Indonesia merupakan salah satu negara dengan biayakesehatan terkecil, rata-rata hanya sebesar 2,6%-2,7% daritotal PDB. Hal ini sebagian disebabkan oleh masih rendahnyapenetrasi asuransi kesehatan, sehingga biaya kesehatan terutamaditanggung oleh pengeluaran pribadi (out-of-pocket payments).(Sumber: Business Monitor International 2012)Namun demikian, didukung oleh besarnya jumlah penduduk danmakin tumbuhnya segmen kelas menengah, Indonesia memilikipotensi menjadi pasar yang menarik bagi industri kesehatan danfarmasi, yang diperkirakan akan mencapai Rp312 triliun di tahun2015. (Sumber: Business Monitor International 2012)Despite the continuing global turbulence, Indonesia succeededin maintaining its economic growth momentum. Backed byongoing buoyant domestic demand from the country’s 240 millionpopulations and a significant influx of new investments reachingRp313.2 trillion (source: Indonesia Investment CoordinatingBoard), Indonesia once again demonstrated its economicresilience and registered a 6.2% gross domestic product (GDP)growth in 2012, only slightly lower than the previous year’s figureof 6.5%. (Source: Bank Indonesia 2012)Inflation remained on track at a manageable 4.3% year-on-year, stemming from stable food prices and supply, as well asGovernment’s decision to maintain fuel subsidy. As a result, BankIndonesia (BI) was able to maintain BI rate at 5.75% throughoutthe year. Boosted by foreign inflows, the domestic capital marketalso enjoyed a good year, with Indonesian Stock Exchange (IDX)Composite index reaching more than 4,300 and consideredas one of the best performing markets in Asia. (Source: BankIndonesia 2012)Indonesia’s Healthcare and PharmaceuticalsIndustryCompared to its neighboring countries, Indonesia’s healthcaremarket is still relatively small. Among ASEAN countries, Indonesiahas one of the lowest total expenditures on health, averaged atonly 2.6%-2.7% of its GDP. This is partially due relatively lowhealth insurance penetration within the population, so healthrelated expenditures are largely financed by household, out-of-pocket payments. (Source: Business Monitor International 2012)Yet, thanks to the country’s vast population and growing middleclass base, Indonesia has the potential to be a lucrative healthcareand pharmaceuticals market, projected to reach Rp312 trillion by2015. (Source: Business Monitor International 2012)
  • 75. PT Kalbe Farma Tbk. • 2012 Annual Report 73Sistem pemerintahan desentralisasi Indonesia, atau dikenaldengan nama otonomi daerah, juga merupakan faktor penentubagi perkembangan sektor kesehatan. Di berbagai propinsi,para pemimpin lokal yang reformis mulai meluncurkan skemaasuransi kesehatan sebagai bagian dari program pengembanganekonomi dan kesejahteraan. Peluncuran Kartu Sehat Jakarta bagisebanyak 4,7 juta penduduk berpenghasilan rendah di ibu kota,adalah salah satu contoh dari makin banyaknya skema asuransikesehatan lokal di Indonesia.Lebih dari itu, keputusan Pemerintah untuk mulai menerapkankebijakan jaminan kesehatan nasional di tahun 2014 akanmeningkatkan akses masyarakat ke layanan kesehatan, danmeningkatkan prospek industri kesehatan ke depan.Sebagai bagian dari industri kesehatan, sektor farmasi Indonesiatelah berhasil meraih tren pertumbuhan positif dalam sepuluhtahun terakhir, dengan rata-rata pertumbuhan sebesar 13,6%per tahun. Pada tahun 2012, industri farmasi berhasil meraihpertumbuhan 15,9% mencapai lebih dari Rp50 triliun di akhirtahun. Segmen obat resep menyumbang sebesar Rp30,1 triliundari total penjualan, sedangkan sisanya sebesar Rp19,9 triliunberasal dari obat bebas. (Sumber: IMS Health 2012)Program kesehatan pemerintah adalah salah satu pendorongtingginya pertumbuhan di segmen obat generik tanpa merek.Dibandingkan total segmen farmasi nasional, segmen produkobat generik tanpa merek terus meningkatkan segmen pasarnya,dari sebesar 5,9% di tahun 2008 menjadi 9,7% dari total segmenfarmasi di akhir 2012 (Sumber: Business Monitor International2012). Perkembangan ini diperkirakan akan terus berlanjut seiringpelaksanaan kebijakan jaminan kesehatan nasional di tahun2014.Guna mengantisipasi pertumbuhan permintaan, perusahan-perusahaan farmasi telah melakukan investasi di beberapa tahunterakhir agar dapat meraih pangsa pasar, terutama di segmenobat generik.Meningkatnyapemintaanpelayanankesehatantelahmenyebabkanmeningkatnya kelangkaan ketersediaan tenaga medis. Denganpenambahan hanya sebanyak 4.000 tenaga dokter baru setiaptahunnya, saat ini hanya tersedia 0,4 tenaga dokter untuk setiap1.000 penduduk Indonesia (Sumber: Kementerian Kesehatan). Dinegara-negara Asia Tenggara lainnya, rasio adalah sebesar satudokter untuk setiap 1.000 penduduk. Kelangkaan juga terjadipada akses layanan rumah sakit, yang saat ini terutama hanyatersedia di kota-kota besar di Indonesia.Indonesia’s decentralized government system, or sistem otonomidaerah, is also an important factor in recent development in thehealth sector. Across the provinces, empowered and reformedminded local leaders introduce health insurance schemes aspart of their economy and social development programs. Thelaunching of Jakarta Health Card for the capital city’s 4.7 milionlower-income residents is just one example of the growing numberof local health insurance schemes in Indonesia.Furthermore, the Government’s decision to implement itsuniversal health insurance by 2014 will increase public accessto healthcare services, creating positive outlook for the industrygoing forward.As part of the healthcare industry, the Indonesian pharmaceuticalsmarket has enjoyed a positive growth trajectory in the pastdecade, with approximately 13.6% average growth per annum.In 2012, the pharmaceuticals industry registered a 15.9% growth,reaching over Rp50 trillion by the end of the year. The ethicaldrug segment contributed Rp30.1 trillion of total sales, whilethe remaining Rp19.9 trillion came from over-the-counter (OTC)drugs. (Source: IMS Health 2012)The government’s healthcare programs are one of the primarydrivers behind strong growth of the unbranded generic market.Relative to the nation’s total pharma market, the unbrandedgeneric product segment continues to deliver growing marketsize, from 5.9% in 2008 to 9.7% share of the total pharma marketby the end of 2012 (Source: Business Monitor International 2012).This trend is expected to continue with the implementation of theuniversal healthcare policy by 2014.To anticipate growing demand, pharma companies have beeninvesting heavily in the last few years to enable them to grabmarket share, particularly in the generic market segment.Growing demand for healthcare services creates challenges forthe supply of medical personnel. With only 4,000 new doctorsgraduating annually, there are currently only 0.4 doctors for every1,000 populations in Indonesia (Source: Ministry of Health),compared to the 1 doctor for 1,000 people in other SoutheastAsian countries. Shortage is also evident in access to hospitalbeds, still primarily available only in Indonesia’s major cities.
  • 76. Performance HighlightsManagement ReportCompany ProfileManagement Discussion and AnalysisCorporate GovernanceCorporate Social ResponsibilityPT Kalbe Farma Tbk. • Laporan Tahunan 201274Di sektor industri farmasi, perusahaan farmasi masih sangattergantung kepada transaksi impor untuk memenuhi kebutuhanbahan bakunya. Impor bahan baku mencapai 95% dari totalkebutuhan bahan baku industri.Mengingat masih tingginya ketergantungan pada impor, terjadinyagejolak mata uang Rupiah telah mempengaruhi industri farmasi.Ke depan, perusahaan-perusahaan farmasi perlu melaksanakanmanajamen risiko yang berhati-hati, serta secara seksamamengamati perkembangan gejolak mata uang.Industri nutrisi juga menampilkan tren yang sama dengan industrifarmasi. Di sektor produk susu, yang merupakan salah satubidang usaha Kalbe, konsumsi susu per kapita per tahun masihrelatif lebih rendah dibandingkan negara-negara ASEAN lainnya.Namun demikian, sektor ini memiliki prospek positif seiring makinmeningkatnya daya beli dan kesadaran masyarakat akan manfaatkesehatan produk susu, yang membuka kesempatan bagi industripengolahan susu di Indonesia.As for the pharma industry, pharmaceutical companies are stillheavily dependent on imports for raw material supply. Rawmaterial imports reached 95% of the industry’s total raw materialrequirements.Given its heavy dependence on imports, recent volatility in theRupiah exchange rates has sparked some concerns within thepharmaceuticals industry. Pharma players need to exerciseprudence in its risk management practices, and closely follow thedevelopment in this exchange rate volatility going forward.Indonesia’s nutritional industry shares the same picture as thepharmaceuticals industry. In the dairy market for example,where Kalbe also has a business interest, annual per capita milkconsumption is relatively lower than other ASEAN countries.Nonetheless, the market presents a positive outlook with risingaffluence and growing awareness of the health benefits fromdairy products, providing opportunities for the country’s milkprocessing industry.Pasar Farmasi Indonesia 2008-20122008-2012 Indonesia’s Pharmaceuticals Market30,98335,51538,64443,211Pertumbuhan Pasar Farmasi Indonesia (%)Indonesia’s Pharmaceuticals Market Growth (%)Nilai Pasar Farmasi Indonesia (Rp Miliar)Indonesia’s Pharmaceuticals Market Value (Rp Billion)50,0822008 2009 2010 2011 201217.114.68.811.815.92008 2009 2010 2011 2012Pembagian Pasar Farmasi Indonesia 2008-2012 (%)2008-2012 Indonesia’s Pharmaceuticals Market Breakdown (%)44 43 41 41 4056 57 59 59 60Obat ResepPrescription DrugsObat BebasOTC DrugsPasar ProdukGenerik TidakBermerek (RpMiliar)UnbrandedGeneric MarketValue (Rp Billion)2008 2009 2010 2011 2012Pasar Produk Generik Tidak Bermerek Indonesia 2008-20122008-2012 Indonesia’s Unbranded Generic Product Market1,8322,0602,5923,0574,8435.9 5.86.77.19.7(Sumber Source: IMS Health 2012)Rasio Pasar ProdukGenerik TidakBermerek terhadapTotal Pasar Farmasi(%)UnbrandedGeneric to TotalPharmaceuticalsMarket Ratio (%)(Sumber Source: IMS Health 2012)(Sumber Source: IMS Health 2012)
  • 77. PT Kalbe Farma Tbk. • 2012 Annual Report 75Pandangan Usaha 2013Kondisi operasional Indonesia yang positif diperkirakan akanterus berlanjut di tahun 2013, walaupun masih adanya risikodari ketidakpastian pasar eksternal. Walau masalah zona Eropaterus berlanjut, pertumbuhan ekonomi tahun 2013 diperkirakanmencapai 6,3%. Pertumbuhan ini tetap berasal dari pertumbuhanekonomi domestik, didukung oleh stabilnya makro ekonomi, sukubunga yang rendah serta perbaikan iklim investasi.Industri kesehatan dan farmasi akan terus memperoleh manfaatdari prospek perekonomian Indonesia. Meningkatnya daya belikonsumen tidak saja membuka peluang pasar yang lebih luas,melainkan juga membuka peluang perluasan produk, sepertiproduk-produk dengan kandungan alami, serta terapi-terapispesifik seperti pengobatan kanker, penyakit ginjal dan diabetes.Ke depan, industri kesehatan juga harus menghadapi berbagaitantangan. Ketidakpastian global yang telah medorong terjadinyagejolak mata uang Rupiah dapat berlanjut dan karenanya perludicermati secara seksama, mengingat tingginya ketergantunganpada impor bahan baku. Selain itu, seiring dengan makintersebarnya pertumbuhan ekonomi Indonesia, serta luasnyadaerah kepulauan Indonesia dan ketersediaan infrastruktur yangbelum memadai, akan menimbulkan tantangan logistik yangsignifikan bagi kegiatan distribusi produk yang harus dapatmelayani jutaan outlet di seluruh Indonesia.2013 Business OutlookIndonesia’s positive operating environment is expected tocontinue in 2013, despite ongoing risks from external marketuncertainties. The economic growth forecast for 2013, in spiteof the Euro zone problems, is expected to be around 6.3%. Thisgrowth continues to come from the country’s domestic economy,coupled with macro-economy stability, low interest rates andimprovements in investment climate.The healthcare and pharmaceuticals industries will continueto benefit from Indonesia’s positive outlook. Consumer’s risingpurchasing power not just presents larger market opportunities,but also product expansion possibilities, such as products withnatural ingredients as well as specific therapies for cancer, kidneyand diabetics treatments.Going forward, the healthcare industry also needs to face a numberof challenges. Ongoing global uncertainties that trigger recentfluctuation in Rupiah exchange rates may continue that needs tobe carefully addressed, given the industry’s high dependence onimports of raw material. Next, Indonesia’s increasingly distributedeconomy growth, combined with the country’s vast archipelagoand substandard infrastructure presents a considerable logisticschallenge to product distribution that needs to reach millions ofoutlets across the country.
  • 78. Performance HighlightsManagement ReportCompany ProfileManagement Discussion and AnalysisCorporate GovernanceCorporate Social ResponsibilityPT Kalbe Farma Tbk. • Laporan Tahunan 201276Portofolio Bisnis yang DisempurnakanEnhanced Business PortfolioTinjauan UsahaBusiness ReviewSetelah melewati lebih dari empat dekade, Kalbe telah berhasilmemperluas kehadirannya di industri kesehatan Indonesiadan menjadi perusahaan penyedia produk dan jasa kesehatanterbesar di Indonesia.Kalbe adalah perusahaan di bidang kesehatan dengan portofoliobisnis yang terdiversifikasi dan meliputi sembilan kategori bidangusaha, dari usaha di bidang obat resep, produk kesehatan,produk nutrisi dan layanan distribusi produk kesehatan, hinggausaha di bidang pemasaran peralatan medis dan diagnostik,pelayanan kesehatan, biofarmasi, produk perawatan mata danbisnis internasional. Dengan portofolio bisnis yang beragam ini,Kalbe dapat menawarkan solusi kesehatan terintegrasi bagi parakonsumen, sejalan dengan sasaran Perseroan untuk menjadipemain terdepan yang menawarkan solusi kesehatan palingkomprehensif di industri kesehatan.After more than four decades, Kalbe has succeeded insignificantly expanding its presence in the Indonesian healthcaremarket and positioned itself as the largest healthcare companyin the country.Kalbe is a highly diversified healthcare company with acomprehensive set of business portfolio comprising ninebusiness categories, from prescription pharmaceuticals,consumer health product, nutritional product and health productdistribution business categories, to medical and diagnosticdevices marketing, health service, biopharma, eye care productand international businesses. This expanded business portfolioallows the Company to bring an integrated health solution to itsconsumers, in line with Kalbe’s goal to become the leading playerwith the most comprehensive healthcare solution in the market.Menawarkan Solusi Kesehatanyang Paling Komprehensif bagiKonsumenProviding the Most Comprehensive Health Solutionsto the Consumers
  • 79. PT Kalbe Farma Tbk. • 2012 Annual Report 77294Divisi UsahaBusiness DivisionsProduk Baru pada Tahun 2012New Products Launched in 2012Ke sembilan bidang usaha Kalbe dikelola di bawah empat divisiberbeda, yakni Divisi Obat Resep, Divisi Produk Kesehatan, DivisiNutrisi, serta Divisi Distribusi dan Logistik.Bidang usaha obat resep merupakan bidang usaha inti Perseroan,yang juga merupakan bidang usaha Kalbe yang pertama di tahun1966. Lini usaha ini menawarkan portofolio produk obat resepyang lengkap untuk semua lapisan masyarakat, dari obat lisensi,obat generik bermerek hingga obat generik tanpa merek, yangmenempatkan Kalbe sebagai perusahaan terdepan di pasarfarmasi Indonesia yang terfragmentasi.Bidang usaha kedua Kalbe adalah bisnis produk kesehatan, yangmenawarkan obat-obatan bebas, minuman energi, serta minumankesehatan. Seiring dengan meningkatnya kesejahteraan dantingkat pendidikan masyarakat, Kalbe meyakini bahwa produk-produk kesehatan akan makin menjadi bagian dari kebutuhandan gaya hidup konsumen sehari-hari. Di bidang usaha ini, KalbeKalbe’s nine businesses are managed under four differentdivisions, namely the Prescription Pharmaceuticals Division,Consumer Health Division, Nutritionals Division and theDistribution and Logistics Division.The prescription pharmaceuticals business is the Company’smain business category and also Kalbe’s first line of businessin 1966. This line of business offers a complete portfolio ofprescription products for all income segments – from licenseddrugs, generic and unbranded generic products, which enablethe Company to command a stronghold over the fragmentedIndonesian pharmaceuticals market.Kalbe’s second business category is the consumer health productbusiness, comprising over-the-counter drugs, energy drinks andhealth drinks. In line with the population’s rising welfare andeducation level, Kalbe believes that consumer health productswill increasingly become part of day-to-day consumer needsand lifestyles. In this line of business, Kalbe manages dominantDengan portofolio bisnis yang beragam, Kalbe dapatmenawarkan solusi kesehatan terintegrasi bagi konsumen,sejalan dengan sasaran Perseroan untuk menjadi pemainterdepan yang menawarkan solusi kesehatan palingkomprehensif di industri kesehatan.This expanded business portfolio allows the Company to bring an integrated healthsolution to its consumers, in line with Kalbe’s goal to become the leading player withthe most comprehensive healthcare solution in the market.
  • 80. Performance HighlightsManagement ReportCompany ProfileManagement Discussion and AnalysisCorporate GovernanceCorporate Social ResponsibilityPT Kalbe Farma Tbk. • Laporan Tahunan 201278mengelola merek-merek dagang yang dominan dengan pangsapasar yang signifikan, didukung oleh kemampuan pengembanganproduk yang tangguh guna melayani perubahan kecenderunganpasar dan tuntutan konsumen.Bidang usaha produk nutrisi menawarkan produk-produk susuuntuk seluruh segmen usia, dari bayi, balita, anak-anak, pra-remaja, dewasa, ibu hamil dan menyusui, serta para lanjutusia; serta produk-produk untuk konsumen dengan kebutuhankhusus. Untuk lini usaha ini, Kalbe melaksanakan pendekatanpengembangan produk untuk segmen-segmen khusus (nichemarket), dengan memanfaatkan keunggulan Perseroan di industrikesehatan dan jaringan pemasaran serta distribusi yang sangatluas. Sebagai bentuk pengembangan jalur distribusi, pada tahun2011 Kalbe telah meluncurkan situs belanja online, Kalbe e-store,yang menawarkan layanan pengiriman gratis, yang bertujuanmemberikan lebih banyak kenyamanan bagi konsumen.Distribusi produk kesehatan adalah bidang usaha keempat dibawah kelompok usaha Kalbe. Bidang usaha ini mengelolajaringan distribusi yang luas, mencakup sekitar 1 juta outlet diIndonesia, yang terdiri dari outlet-outlet farmasi seperti rumahsakit dan apotek, serta outlet produk kesehatan dan produknutrisi. Jaringan distribusi Kalbe merupakan jaringan distribusiproduk kesehatan yang terluas di Indonesia.Bidang usaha kelima adalah usaha Kalbe di bidang pemasaranalat-alatmedisdandiagnostik.Selamatahun-tahunterakhir,usahaini menikmati pertumbuhan pasar yang signifikan, sejalan denganmakin meningkatnya belanja untuk kesehatan di Indonesia.Rencana Pemerintah untuk mulai melaksanakan jaminankesehatan secara nasional mulai tahun 2014 diproyeksikanakan mendorong peningkatan permintaan, seiring dengan makinmeningkatnya akses layanan kesehatan di seluruh Indonesia.Di bidang usaha pelayanan kesehatan, yang merupakan lini usahaPerseroan yang keenam, Kalbe mengembangkan jaringan kliniksatu atap, Klinik Mitrasana, yang menggabungkan layanan dokterumum, apotek, laboratorium dan ritel produk-produk kesehatan.Lini usaha ini dipersiapkan untuk memainkan peran strategisseiring pelaksanaan sistem jaminan kesehatan nasional, denganmenempatkan jaringan klinik ini sebagai mitra Pemerintah dalammemberikan layanan kesehatan bagi masyarakat luas.Biofarmasi adalah lini usaha yang ketujuh, yang ditujukan untukmengantisipasi perkembangan teknologi medis dan paradigmapengobatan masa depan dalam bentuk targeted therapy. Aktivitasmeliputi kegiatan riset di bidang sel punca untuk pengobatanberbagai penyakit, serta layanan diagnostik molekular untukbrands with strong brand equity, supported by strong newproduct development capabilities, in line with changing markettrends and consumer needs.The nutritionals product business category presents Kalbe’s milkproducts for all age segments, from infants, toddlers, children,tweens, adults, expectant and lactating mothers, up to the elderlysegment, as well as products for consumers with special medicalneeds. In this business category, Kalbe adopts a niche productdevelopment approach that leverages the Company’s strengths inthe health industry and extensive marketing network. To enhancethe channel mix, in 2011 Kalbe has launched its Kalbe e-store,an online shopping website with free delivery service, aimed atdelivering more convenience to consumers.Health product distribution is the fourth business category underthe Kalbe Group. This business manages a wide distributionnetwork, covering roughly 1 million outlets in Indonesia,comprising pharmaceuticals outlets such as hospitals andpharmacies, as well consumer health and nutritional productsoutlets. Kalbe’s distribution network is widely considered as thelargest distribution network for health products in the country.The fifth business category is Kalbe’s medical and diagnosticsdevice marketing business. In recent years, this businesswitnesses accelerating market growth, in line with increasedhealthcare spending in Indonesia. The Government’s plan toimplement the national healthcare insurance by 2014 is expectedto further boost demand along with increasing access tohealthcare services throughout Indonesia.In the healthcare service business, the Company’s sixth businessline, Kalbe is developing its integrated clinic network, MitrasanaClinic, combining physician’s general practice, pharmacies,laboratory, and healthmart services. This clinic business is set toplay a strategic role in the implementation of the national healthinsurance system, by positioning the clinic chain as a partner ofthe Government in providing healthcare for society.Biopharma is the seventh business category, engineered toanticipate the development of medical technology and futuremedical treatment paradigms in the form of targeted therapy.Activities comprise research in stem cell for treatment of variousdiseases, as well as molecular diagnostic services for cancer
  • 81. PT Kalbe Farma Tbk. • 2012 Annual Report 79pengobatan kanker yang mengarah kepada pengobatanpersonalized medicine sebagai wujud komitmen Kalbe untukterus memberikan nilai tambah bagi konsumen.Lini usaha Kalbe yang kedelapan bergerak di bidang pemasaranberbagai produk perawatan mata, yang mencakup produk obatmata, lensa kontak, peralatan operasi dan berbagai produkpenunjang kesehatan mata, di bawah pengelolaan Kalbe VisionPte. Ltd. anak perusahaan yang berlokasi di Singapura.Bidang usaha bisnis internasional merupakan bidang usahaKalbe yang kesembilan dan terakhir, yang dikelola oleh KalbeInternational Pte. Ltd. Bidang usaha bisnis internasional Kalbeberupaya meraih peluang pasar di negara-negara lain. MelaluiKalbe International, Perseroan telah mengembangkan usahanyake negara-negara di kawasan Asia Tenggara serta Sri Lanka,Nigeria dan Afrika Selatan.Divisi Obat Resep bertanggung jawab atas tiga kategori bidangusaha, yakni bidang usaha obat resep, biofarmasi dan produkperawatan mata. Divisi Produk Kesehatan mengelola bisnis Kalbedi bidang produk kesehatan, sedangkan Divisi Nutrisi mengelolausaha produk nutrisi. Divisi yang keempat, Divisi Distribusi danLogistik,mengelolausahadistribusiprodukkesehatan,pemasaranalat medis dan diagnostik, serta usaha Kalbe di bidang pelayanankesehatan. Di samping itu, bidang usaha bisnis internasional,bertanggung jawab menjalankan aspirasi pertumbuhan usahaKalbe untuk menjadi perusahaan Indonesia dengan usaha yangkuat di pasar internasional.Ke depan, ke sembilan lini usaha Kalbe akan terus dikembangkanuntuk menawarkan lebih banyak manfaat bagi seluruh konsumen.Selain itu, upaya untuk meningkatkan sinergi di antara liniusaha tersebut akan terus ditingkatkan, sehingga Kalbe dapatmenawarkan solusi kesehatan yang terintegrasi dan makin dapatmerealisasikan sasarannya menjadi penyedia layanan kesehatankomprehensif yang terkemuka di kawasan.treatment that leads to personalized medicine treatments, amanifestation of Kalbe’s commitment to continue offering addedvalue to the consumers.Kalbe’s eight business category markets a range of eye careproducts, from eye medicine, contact lenses, surgery equipmentsto other kinds of products that support optical health under KalbeVision Pte. Ltd., a subsidiary based in Singapore.Kalbe’s international business unit is the ninth and final businesscategory, managed by Kalbe International, Pte. Ltd. Kalbe’sinternational venture captures market opportunities in othercountries. Through Kalbe International, the Company hasexpanded its wing to Southeast Asian countries and Sri Lanka aswell as Nigeria and South Africa.Kalbe’s Prescription Pharmaceuticals Division is responsiblefor three different business categories: the prescriptionpharmaceuticals, biopharma and eye care product businesses.The Consumer Health Division runs Kalbe’s consumer healthproduct business category, while the Nutritionals Divisionmanages the nutritional product businesses. The Company’sfourth Division, Distribution and Logistics Division, managesthe health product distribution, medical and diagnostic devicesmarketing and Kalbe’s health service businesses. In addition,the international business unit is responsible for running Kalbe’sgrowth aspiration to become an Indonesian company with strongpresence in the international market.Kalbe’s nine business categories will continue to be expandedgoing forward, to offer more benefits to all consumers. Equallyimportant, efforts to build further synergies among thesebusiness lines will intensify to allow Kalbe to present integratedhealthcare solution to the market and bring the Company closerto its objective to become a premier provider of comprehensivehealthcare in the region.
  • 82. Performance HighlightsManagement ReportCompany ProfileManagement Discussion and AnalysisCorporate GovernanceCorporate Social ResponsibilityPT Kalbe Farma Tbk. • Laporan Tahunan 201280Divisi Obat ResepPrescription Pharmaceuticals DivisionMenawarkan Rangkaian Produkyang Lengkap untuk SeluruhLapisan MasyarakatOffering a Complete Product Range for All SegmentsDivisi Obat Resep Kalbe menawarkan berbagai pilihan produkuntuk semua segmen pasar, dari obat generik tanpa merekuntuk segmen mass market, hingga obat generik bermerekdan obat lisensi bagi segmen pasar menengah dan segmenpremium. Beberapa produk-produk unggulan Kalbe antara lainadalah Brainact, Cefspan, Mycoral, Cernevit, Cravit, Neuralgin,Broadced, Neurotam, dan CPG.Didukung lebih dari 2,300 tenaga penjualan, yang merupakantim pemasaran terbesar di Indonesia, serta jaringan distribusiterintegrasi yang melayani rumah sakit, apotek dan toko obat diseluruh Nusantara, Kalbe adalah perusahaan terdepan di industriobat resep Indonesia dengan pangsa pasar 13% di tahun 2012(sumber: IMS Health 2012). Untuk menjamin upaya pemasaranyang terarah dan efektif, tenaga pemasaran kami dikelompokkandalam beberapa grup, masing-masing memfokuskan padasegmen dan kelas terapi tertentu.Kalbe’s Prescription Pharmaceuticals Division features a completeset of products for all segments, from unbranded generic drugsfor the mass market segment, to branded generics and licenseddrugs catering the middle and premium segments. Some ofKalbe’s top products include Brainact, Cefspan, Mycoral,Cernevit, Cravit, Neuralgin, Broadced, Neurotam and CPG.Supported by over 2,300 medical representatives, the largestmarketing team in Indonesia, and an integrated distributionnetwork serving hospitals, pharmacies and drug stores acrossthe nation, Kalbe is the leading player in the prescriptionpharmaceutical industry in Indonesia with 13% market sharein 2012 (source: IMS Health 2012). To ensure a focused andeffective marketing effort, our marketing team is organized bygroups targeted to each segment and therapeutical class.Tinjauan UsahaBusiness Review
  • 83. PT Kalbe Farma Tbk. • 2012 Annual Report 81Pencapaian 2012Seperti di tahun-tahun sebelumnya, Kalbe terus memperluasragam produknya melalui peluncuran 18 produk baru dan lineextension di tahun 2012, yang terdiri dari 6 produk lisensi, 9produk generik bermerek dan 3 produk generik tanpa merek. Diakhir tahun, Divisi Obat Resep mengelola sebanyak 385 produkdalam 16 kelas terapi.Untuk segmen obat generik, Kalbe memanfaatkan strategi ‘firstmover’nya, dengan berupaya menjadi produsen obat pertamayang meluncurkan produk generik atas obat-obat yang telahhabis masa patennya. Untuk mendukung strategi di atas, Kalbeterus meningkatkan kompetensinya di bidang riset dan formulasiobat, agar dapat meraih keunggulan sebagai produsen yangterdepan.2012 HighlightsAs in the previous years, Kalbe continued to widen its productrange with the introduction of 18 new products and line extensionin 2012, consisting of 6 licensed products, 9 branded genericproducts and 3 unbranded generic products. By the end of theyear, the Prescription Pharmaceuticals Division manages a totalof 385 products in 16 therapeutical classes.In the generic drug segment, Kalbe adopts a ‘first mover’ strategyby becoming the first manufacturer in the market to introducegeneric products for drugs that have reached their patentexpiration dates. To support this first mover strategy, we continueto strengthen our competence in research and drug formulation,thus ensuring the first mover advantage.18.4%Pertumbuhan PenjualanBersihNet Sales Growth3,288bnPenjualan Bersih tahun 20122012 Net SalesRpDidukung tim pemasaran terbesar di Indonesia, serta jaringandistribusi terintegrasi yang melayani rumah-rumah sakit, apotekdan toko obat di seluruh nusantara, Kalbe adalah perusahaanterdepan di industri obat resep Indonesia.Supported by the largest marketing team in Indonesia, and an integrated distribution networkserving hospitals, pharmacies and drug stores across the nation, Kalbe is the leading player in theprescription pharmaceutical industry in Indonesia.
  • 84. Performance HighlightsManagement ReportCompany ProfileManagement Discussion and AnalysisCorporate GovernanceCorporate Social ResponsibilityPT Kalbe Farma Tbk. • Laporan Tahunan 201282Untuk obat-obat lisensi, Kalbe aktif memelihara dan menjalinkerjasama dengan perusahaan farmasi terkemuka, seperti Baxter,Astellas, Samyang, Daiichi-Sankyo, Sinclair, Orion, Smith &Nephew, BioGaia, Boryung, Cymbiotics, Helsinn dan Winclove.Dalam rangka mengantisipasi pertumbuhan di segmen obatgenerik tanpa merek seiring pelaksanaan Sistem Jaminan SosialNasional (SJSN) yang dimulai tahun 2014, di bulan Februari2012 Kalbe secara resmi telah membuka fasilitas produksi baruuntuk obat generik di Cikarang, Jawa Barat. Dengan kapasitasproduksi hingga 87 juta tablet per bulan, fasilitas baru ini memilikikemampuan produksi kecepatan tinggi dalam jumlah volumesignifikan, yang akan menjadi fitur penting untuk menghadapitingginya tingkat persaingan di pasar obat generik tanpamerek. Kami juga akan meningkatkan daya saing dengan fokuspada beberapa molekul kunci sehingga dapat dicapai prosespembelian, produksi, pemasaran dan distribusi yang terintegrasi.Fasilitas produksi baru lainnya khusus untuk obat-obat kanker saatini sedang dibangun di Pulogadung, Jakarta. Dijadwalkan untukmulai berproduksi tahun 2014, inisiatif ini sejalan dengan strategiKalbe untuk meningkatkan ketersediaan obat-obat dengan hargaterjangkau. Inisiatif tersebut merupakan bagian dari responsKalbe seiring meningkatnya angka kejadian penyakit-penyakittersebut, yang mendorong tumbuhnya permintaan akan obat danperawatan kesehatan. Divisi Obat Resep sedang membangunsinergi dengan Divisi Nutrisi serta unit produk dan peralatankesehatan dalam Kelompok Usaha Kalbe untuk mengembangkanlayanan holistik yang menggabungkan produk obat dengan hargaterjangkau dengan produk nutrisi dan peralatan kesehatan.Produksi obat resep dan obat bebas Perseroan menggunakanfasilitas produksi yang sama. Kapasitas produksi beberapaproduk obat-obatan utama Kalbe dijabarkan pada tabel sebagaiberikut.Kapasitas Produksi Obat Resep dan Obat Bebas Production Capacity of Prescription and OTC DrugsNo Sediaan SatuanKapasitas Produksi / TahunAnnual Production Capacity Unit Type2012 20111 Tablet Juta 12,667 12,667 Million Tablet2 Kapsul Juta 1,497 1,497 Million Capsule3 Cair Juta Botol 92 92 Million of Bottles Liquid4 Krim Juta Tube 33 33 Million of Tubes Cream5 Injeksi Juta Ampul 113 113 Million of Ampoules Injection6 Cairan Infus Juta Liter 3 3 Million of Liters Intravenous SolutionFor licensed drugs, Kalbe maintains and actively establisheslicensing relationships with leading pharmaceutical companies,including Baxter, Astellas, Samyang, Daiichi-Sankyo, Sinclair,Orion, Smith & Nephew, BioGaia, Boryung, Cymbiotics, Helsinnand Winclove.Anticipating rapid growth in the unbranded generic drug segmentwith the upcoming implementation of nation-wide healthinsurance system starting in 2014, in February 2012 Kalbe formallyinaugurated its new production facility dedicated for generic drugsproduction in Cikarang, West Java. With production capacity ofup to 87 million tablets per month, the new factory promises highspeed, high volume production capability, a key feature to win inthe highly competitive unbranded generic drug market. We alsowant to increase our competitiveness by focusing on several keymolecules to allow an integrated approach from procurement,production, down to marketing and distribution.Another new production facility dedicated for oncology drugs iscurrently under construction in Pulogadung, Jakarta. Scheduledto commence production in 2014, the initiative is part of Kalbe’sstrategy to improve oncology drugs availability. This is part ofKalbe’s response to rising occurrence of these diseases thatcreates growing demand for drugs and medical treatment. Thishas driven the Division to leverage on the synergies with theNutritionals Division and other health products and equipmentfrom Kalbe Group, to develop a holistic approach combiningaffordable drugs with nutritional products and medical devices.Prescription and OTC drugs share the same production facilities.Production capacity of some of Kalbe’s major drug products arepresented in the table below.
  • 85. PT Kalbe Farma Tbk. • 2012 Annual Report 83Pada bulan Juli 2012, Kalbe juga meyelesaikan implementasisistem Oracle e-Business Suite untuk mendukung operasi DivisiObat Resep di Cikarang.Tim penjualan Kalbe merupakan salah satu keunggulan untukmeraih efektivitas pemasaran dan mendukung pertumbuhan.Upaya penjualan terus ditingkatkan melalui beberapa inisiatif,termasuk reorganisasi tim penjualan serta peningkatankeselarasan indikator-indikator kinerja guna meraih kinerja yangoptimal.Guna membangun hubungan erat dengan para konsumen,Divisi Obat Resep terus menjangkau pelanggan secara langsungdengan membentuk Kalbe Ethical Customer Care (KECC). KECCaktif terlibat membangun komunitas peduli kesehatan melaluipenyelenggaraan acara edukasi kesehatan dan kerjasamadengan berbagai institusi untuk meningkatkan kesadaran akankesehatan. Beberapa kegiatan di tahun 2012 antara lain adalahpenyelenggaraan temu wicara bekerjasama dengan IndonesiaCancer Care Community dengan tema “Hidup dengan Kanker”memperingati Hari Kanker Sedunia. Melalui Indonesia KidneyCare Community, KECC menyelenggarakan beberapa kegiatanmemperingati Hari Ginjal Sedunia, antara lain kegiatan temuwicara mengenai donasi ginjal di komunitas-komunitas dan rumahsakit. KECC bersama Indonesia Kidney Care Community jugamelaksanakan kampanye kesehatan ginjal melalui pembagianIn July 2012, Kalbe also completed the implementation ofits Oracle e-Business Suite integrated system to support theoperation of Prescription Pharmaceuticals Division in Cikarang.Kalbe’s sales team is a competitive edge to deliver marketingeffectiveness and support growth. We continue to strengthenour sales efforts through several initiatives, including sales teamreorganization and Key Performance Indicators (KPI) alignmentimprovement to achieve a more optimum performance.To build a closer relationship with consumers, the PrescriptionPharmaceuticals Division implements direct-to-consumersactivities through the Kalbe Ethical Customer Care (KECC).KECC is actively involved in developing health communities,providing health education and fostering relationships withvarious institutions to create health awareness. Some of theactivities in 2012 included organizing talk show with the IndonesiaCancer Care Community themed “How to Live with Cancer” incommemoration of World Cancer Day. Through the IndonesiaKidney Care Community, KECC organized a series of activitiesin commemoration of World Kidney Day including various talkshows on the topic of kidney donations to communities andhospitals. KECC and Indonesia Kidney Care Community alsoorganized campaign on kidney health awareness by distributingkidney health booklets to approximately 1,500 recipients. ToProses Produksi ObatDrug Production ProcessKneadingPembuatanAdonanObatDryingPengeringanSievingPengayakanPackingPengemasanCompressingPemadatanCoatingPelapisanFillingPengisianMixingPencampuranCapsuleKapsulTabletTabletCoated TabletTablet Salut
  • 86. Performance HighlightsManagement ReportCompany ProfileManagement Discussion and AnalysisCorporate GovernanceCorporate Social ResponsibilityPT Kalbe Farma Tbk. • Laporan Tahunan 201284booklet kesehatan ginjal ke sekitar 1.500 orang. Dalam rangkamemperingatiHariLanjutUsiaNasional,KECCmenyelenggarakanberbagai kegiatan, termasuk kegiatan jalan sehat, pemeriksaankesehatan dan temu wicara bertemakan “Satu Jantung, SatuHarapan, Menjadi Sehat”. KECC juga melaksanakan berbagaikegiatan memperingati Hari Osteoporosis Dunia berupa kegiatansenam sehat, temu wicara, serta pemeriksaan dan konsultasikesehatan di Yogyakarta dengan tema “Hidupku Tulangku”.Divisi Obat Resep Kalbe menutup tahun 2012 denganmembukukan pertumbuhan penjualan bersih sebesar 18,4%mencapai Rp3.288 miliar, dengan kontribusi sebesar 24%terhadap total penjualan bersih Kalbe tahun 2012. Produkobat generik bermerek mempertahankan posisinya sebagaipenyumbang utama dengan menyumbang sekitar 64% dari totalpenjualan bersih, disusul dengan produk obat lisensi dan obatgenerik tanpa merek masing-masing dengan kontribusi 26% dan10% terhadap total penjualan bersih Divisi Obat Resep. MarjinLaba Bruto mencapai 61,8% pada tahun 2012 dari sebesar65,9% tahun 2011, terutama akibat strategi bauran produk danstrategi pemasaran di tahun 2012.2013: Prospek dan PrioritasDidukung makin meningkatnya kesejahteraan masyarakatdan masih relatif rendahnya pengeluaran untuk kesehatan diIndonesia, industri obat resep masih menawarkan potensi yangmenjanjikan dan diproyeksikan akan terus meraih pertumbuhanke depan. Selain itu, inisiatif Pemerintah untuk melaksanakanprogram jaminan kesehatan nasional (SJSN) di tahun 2014 akanmeningkatkan daya tarik industri ini.commemorate National Senior Citizen Day, KECC organizeda series of events including fun walk, health screening and talkshow presenting “One Heart, One Hope, to be Healthy” theme.KECC also organized a series of events in commemoration ofWorld Osteoporosis Day featuring physical exercise, talk show,health screening and consultation activities in Yogyakarta, themed“My Life, My Bone”.Kalbe’s Prescription Pharmaceuticals Division ended 2012 bybooking 18.4% growth in net sales to Rp3,288 billion, accountingfor 24% of Kalbe’s total net sales in 2012. Branded genericscontinued to become the major contributor with approximately64% sales contribution, followed by licensed and unbrandedgeneric product categories with 26% and 10% contributionsto prescription pharmaceutical sales respectively. Gross profitmargin amounted to 61.8% in 2012 from 65.9% in 2011, mostlydue to product mix and marketing strategies in 2012.2013: Prospects and PrioritiesBacked by the population’s growing prosperity and relativelylow average health spending in Indonesia, the prescriptionpharmaceuticals industry offers promising potentials andis expected to grow steadily over the years. Moreover, theGovernment’s initiative to implement a National Social SecuritySystem (SJSN) in 2014 will further increase the attractiveness ofthis industry.Proses ProduksiProses pengemasan tablet dalam blisterpada fasilitas produksi di CikarangProduction ProcessPacking process of tablets in blisters atCikarang production facility
  • 87. PT Kalbe Farma Tbk. • 2012 Annual Report 85To anticipate the implementation of SJSN, going forward Kalbewill intensify its marketing activities for unbranded generic drugsamong others by deepening relationships with governmenthospitals across Indonesia. Kalbe will also focus on certain keymolecules aiming at better alignment across the supply chain togenerate higher economies of scale.The construction of a new manufacturing facility for oncologydrugs is expected to be completed in 2013, allowing Kalbe tostart production after complying with the necessary certificationprocess. Going forward, Kalbe will continue to build its presencein cancer care segment, as one of the focus along with itspresence in kidney and diabetes therapies.Untuk mengantisipasi pelaksanaan SJSN, ke depan Kalbe akanmenggiatkan kegiatan pemasaran untuk produk obat generiktanpa merek, antara lain dengan meningkatkan kerjasama denganrumah-rumah sakit pemerintah di seluruh Indonesia. Kalbejuga akan memfokuskan pada beberapa molekul utama gunameningkatkan keselarasan di seluruh rantai pasokan sehinggatercapai skala ekonomis yang lebih tinggi.Pembangunan fasilitas produksi baru untuk obat-obat kankerdiharapkan akan selesai di tahun 2013, sehingga Kalbe dapatmemulai proses produksi setelah menyelesaikan proses sertifikasiyang dibutuhkan. Ke depan, Kalbe akan terus meningkatkankeberadaannya di segmen pengobatan kanker sebagai salahsatu fokus selain segment terapi penyakit ginjal dan diabetes.Proses ProduksiProses pengisian obat dalam bentukcair pada fasilitas produksi diCikarangProduction ProcessFilling process of syrup at Cikarangproduction facility
  • 88. Performance HighlightsManagement ReportCompany ProfileManagement Discussion and AnalysisCorporate GovernanceCorporate Social ResponsibilityPT Kalbe Farma Tbk. • Laporan Tahunan 201286Tinjauan UsahaBusiness ReviewDivisi Produk KesehatanConsumer Health DivisionDivisi Produk Kesehatan Kalbe mengelola beberapa kategoriproduk, meliputi obat-obat bebas atau obat OTC, minumanenergi, serta produk minuman kesehatan.Produk obat bebas Kalbe terdiri dari produk-produk yang bersifatkuratif, serta produk-produk konsumsi yang memberi manfaatkesehatan, termasuk produk suplemen dan produk bersifatpreventif lainnya. Produk-produk tersebut meliputi 6 kelas terapiobat bebas dengan merek-merek yang telah lama menguasaipasar dalam beberapa dekade terakhir.Beberapa produk obat bebas Kalbe termasuk Promag dan Waisanyang dominan pada pasar kelas terapi obat maag. Kalbe jugamemiliki produk-produk yang menguasai pangsa pasar yang kuatpada kelas terapi lainnya seperti Neo Entrostop di kelas terapiobat diare; lini produk Komix, Woods, Mextril dan Mixadin untukobat batuk, dan Mixagrip, Mixagrip Flu dan Batuk serta Procolddi kelas terapi obat flu. Kalbe juga memiliki produk Kalpanax danMikorex untuk terapi anti jamur.Kalbe’s Consumer Health Division manages several productcategories, namely over-the-counter or OTC drugs, energy drinksand ready-to-drink products.Kalbe’s OTC drugs consist of products with therapeutic benefits,consumer products with health benefits, including supplementsand other preventive products. These products cover 6 differenttherapeutical classes with strong brand equity that havedominated the market over a long period of time.Some of Kalbe’s top OTC products include Promag and Waisanwhich dominate the antacid therapeutic market. We alsocommand strong presence in other therapeutic classes, such asNeo Entrostop in anti diarrhea, the product lines of Komix, Woods,Mextril and Mixadin in cough remedies, as well as Mixagrip,Mixagrip Cough and Cold and Procold in the cold remedy. Kalbealso has Kalpanax and Mikorex in the anti-fungal treatment.Memperkuat Portofolio denganProduk Kesehatan yang InovatifStrengthening Portfolio with Innovative ConsumerHealth Products
  • 89. PT Kalbe Farma Tbk. • 2012 Annual Report 87Dalam segmen produk dengan manfaat preventif, Kalbe jugamemiliki merek-merek yang kuat yang telah menjadi bagiankeseharian keluarga Indonesia, seperti produk multivitamin danvitamin C termasuk Cerebrovit, Fatigon C-Plus, Sakatonik Liverdan Xon-Ce, juga Cerebrofort dan Sakatonik ABC pada segmenmultivitamin untuk anak-anak.Sejalan dengan pergeseran permintaan konsumen ke arahproduk yang menggunakan bahan alami dan herbal, DivisiProduk Kesehatan Konsumen telah mengambil inisiatif untukmengembangkan portofolio produk yang menggunakan bahandasar alami dan herbal yang secara tradisional diketahui memilikikhasiat untuk kesehatan. Produk yang terakhir diluncurkanadalah Bintang Toedjoe Masuk Angin, yang di antaranyamengandung jahe merah yang efektif mengurangi keluhan masukangin. Beberapa produk Kalbe lainnya antara lain Entrostop Anaksebagai terapi diare pada anak-anak, Procold Promuno yangmerupakan suplemen pencegah influenza dan Fatigon C-Plus,In the preventive product segment, Kalbe has several strongbrands which have also become part of Indonesian families’ life,such as multivitamin and vitamin C products including Cerebrovit,Fatigon C-Plus, Sakatonik Liver and Xon-Ce brands, as well asCerebrofort and Sakatonik ABC in the children’s multivitaminscategory.In response to the shift in consumer preference towards naturaland herbal products, the Consumer Health Division took theinitiative to develop product portfolio using herbal ingredientstraditionally known to have positive health benefits. Our latestproduct launched was Bintang Toedjoe Masuk Angin containingamong others red ginger ingredients effective to alleviate commoncold discomforts. Some of Kalbe’s existing products includeEntrostop Kid as treatment for diarrhea in children, ProcoldPromuno as cold prevention supplement and Fatigon C-Pluswhich is multivitamin containing Pureway-C, the latest generationof Vitamin C with a combination of natural fruit and vegetable16.7%Pertumbuhan PenjualanBersihNet Sales Growth2,149bnRpPenjualan Bersih tahun 20122012 Net SalesDi tahun 2012, Kalbe mengakusisi 100 persen saham PT HaleInternational, yang memperluas portofolio produk minuman siapsaji Kalbe dengan beberapa merek seperti Original Love Juice danPomerama untuk memperluas ekspansi di segmen minuman siapsaji.In 2012, Kalbe acquired a 100 percent stake in PT Hale International, adding Kalbe’s ready-to-drink product portfolio with several prominent brands such as Original Love Juice and Pomerama,to accelerate expansion into the ready-to-drink segment.
  • 90. Performance HighlightsManagement ReportCompany ProfileManagement Discussion and AnalysisCorporate GovernanceCorporate Social ResponsibilityPT Kalbe Farma Tbk. • Laporan Tahunan 201288yaitu multivitamin yang mengandung Pureway-C, vitamin Cgenerasi terakhir yang dikombinasikan dengan buah dan sayur,vitamin B kompleks dan zinc. Produk herbal Kalbe lainnya adalahMensana, yang merupakan produk untuk mengurangi keluhanselama menstruasi dalam kemasan sachet yang praktis.Pada kategori minuman energi, produk Kalbe, Extra Joss,merupakan salah satu produk terdepan di kategorinya. Extra Jossberhasil meraih kinerja positif sejak 2011 dan kini merupakanproduk dengan pangsa pasar terbesar kedua di Indonesia.Produk minuman siap saji Kalbe menawarkan berbagai pilihanminuman kesehatan, antara lain Hydro Coco, minuman isotonikdari air kelapa alami dan Tipco Fruit Juice, minuman sehat daribuah-buahan dan sayuran. Seiring meningkatnya permintaanakan produk-produk kesehatan, Kalbe terus membangunkeberadaannya di segmen produk minuman siap saji. Akuisisi PTHale International tahun 2012 misalnya, telah berhasil menambahpilihan produk minuman siap saji Kalbe dengan beberapa produk,seperti Original Love Juice dan Pomerama, yang merupakanmerek yang cukup dikenal di pasar Indonesia.Pencapaian Penting 2012Tahun 2012 tetap ditandai dengan inisiatif inovasi produkagar dapat menawarkan lebih banyak ragam produk ke pasar.Produk baru yang diluncurkan antara lain adalah Komix-DT,pengembangan dari sirup obat batuk tanpa rasa kantuk Kalbe,yang kini tersedia dalam kemasan baru agar mudah dikonsumsi,Bintang Toedjoe Turun Panas Anak – produk analgesik dalamkemasan sachet untuk anak-anak, serta Bintang Toedjoe MasukAngin – obat herbal tradisional untuk meredakan gejala masukangin.Di bulan Juli 2012, Kalbe mengakusisi 100 persen saham PT HaleInternational, produsen minuman kesehatan lokal yang menjadipionir dalam produk jus dari buah delima. Keberhasilan akuisisiini memperluas portofolio produk minuman siap saji Kalbedengan beberapa merek terkenal seperti Original Love Juicedan Pomerama. Bagi Kalbe, akuisisi ini juga memberikan aksespada fasilitas produksi yang langsung dapat dimanfaatkan untukmemperluas ekspansi di segmen minuman siap saji. Original LoveJuice menawarkan minuman segar dari sari buah bermutu tinggidengan berbagai pilihan rasa. Pomerama merupakan merupakanperintis segmen minuman dari jus delima di Indonesia, sebagaiminuman sehat dengan kandungan zat antioksidan yang tinggi.ingredients, vitamin B Complex and Zinc. Another Kalbe’s herbal-based product is Mensana, which is aimed to reduce menstrualdiscomfort, packed in convenient sachet packaging.In the energy drink category, Kalbe’s product, Extra Joss, is oneof the leading products in its class. Extra Joss has delivered astrong performance since 2011 and now commands the secondlargest market share in Indonesia.Kalbe’s ready-to-drink products offer a range of healthy beverageselections, including Hydro Coco, an isotonic drink made ofnatural coconut water and Tipco Fruit Juice, a fruit and vegetablebased healthy drink. In response to growing demands for healthproducts, Kalbe is currently building a stronger footprint in theready-to-drink products. The acquisition of PT Hale Internationalin 2012 for example, has extended Kalbe’s ready-to-drinkofferings with several new products, including Original LoveJuice and Pomerama, both with considerable brand equities inIndonesian market.2012 Highlights2012 continued to be marked with product innovation initiativesto bring wider product selection to the market. New productsintroduced include Komix-DT, an extension of Kalbe’s popularnon-drowsy cough syrup that now presents a convenientpackaging for easy consumption, Bintang Toedjoe Turun PanasAnak – an analgesic product in sachet packaging for children andBintang Toedjoe Masuk Angin – a traditional herbal remedy forcommon cold symptoms.In July 2012, Kalbe acquired a 100 percent stake in PT HaleInternational, a local health drink producer which was thepioneer in the pomegranate juice. The successful acquisitionexpanded Kalbe’s ready-to-drink product portfolio with severalprominent brands such as Original Love Juice and Pomerama.It also allows Kalbe to access a ready-to-use production facility,thereby accelerating expansion into the ready-to-drink segment.Original Love Juice offers fresh bottled fruit juice made of qualityfruits with a selection of flavors. Pomerama is the pioneer in thepomegranate juice segment in Indonesia, as a healthy drink withhigh antioxidant content.
  • 91. PT Kalbe Farma Tbk. • 2012 Annual Report 89Di segmen minuman energi, minuman energi Extra Joss terusmeraih tingkat loyalitas tinggi dari para konsumen di Indonesia,dengan pangsa pasar sekitar 24% (sumber : AC Nielsen). Diakhir 2012, Kalbe meluncurkan produk Nitros, pengembangandari merek Extra Joss yang telah dikenal luas. Nitros, minumankonsentrat dalam bentuk likuid dengan kemasan tube agarmudah dikonsumsi, disiapkan untuk terus memperkuat posisiKalbe di kategori minuman energi. Selain di Indonesia, Extra Jossjuga telah berhasil dipasarkan di Filipina. Tersedia dalam kemasanbotol gelas dan botol PET, Extra Joss berhasil meraih kinerja yangmenggembirakan di pasar Filipina.Kehadiran kami di segmen obat bebas, minuman energi danminuman siap saji didukung oleh kemampuan produksi Kalbeyang telah teruji.Untuk produk-produk obat bebas, Kalbe mengoperasikaninfrastruktur produksi bervolume tinggi dalam bentuk obat tablet,kapsul dan cair. Untuk produk obat bebas dengan volume penjualantinggi seperti Promag dan Mixagrip, Kalbe mengoperasikan liniproduksi khusus untuk memastikan terpenuhinya permintaanpasar. Sedangkan untuk produk obat bebas yang lain, prosesproduksi memanfaatkan fasilitas yang juga digunakan oleh DivisiObat Resep, mengingat produk-produk tersebut menggunakanteknologi dan proses produksi yang sama.In energy drink category, Extra Joss energy drink continues tocommand high loyalty among the Indonesian consumers withroughly 24% market share (source : AC Nielsen). In late 2012,Kalbe introduced Nitros, a product extension of the successfulExtra Joss brand. Nitros, a concentrated drink in liquid formfeaturing convenient tube packaging for easy consumption, isset to further revive Kalbe’s position in this product category.In addition to Indonesia, Extra Joss has also been successfullymarketed in the Phillipines. Available both in returnable glassbottle and PET bottle packagings, Extra Joss sales in thePhillipines have shown encouraging results.Our presence in the OTC, energy drink and ready-to-drink productcategories are supported by well established manufacturingcapabilities.For OTC products, Kalbe operates high volume productioninfrastructure for tablet, capsule and liquid drugs. For top sellingOTC products with huge sales volume, such as Promag andMixagrip, Kalbe operates dedicated production lines to guaranteecontinuous production to meet market demands. For other OTCproducts, the production process shares the same plants usedby the Prescription Pharmaceuticals Division, as these productsadopt the same manufacturing technology and processes.Komix DT (left)Obat batuk tanpa efek kantukdengan kemasan yang inovatifNon-drowsy cough syrup ininnovative packagingOriginal Love Juice (right)Minuman sari buah daripilihan buah-buahanberkualitas dengan kandunganantioksidan yang tinggiFruit juice made of selectedquality fruits with highantioxidant content
  • 92. Performance HighlightsManagement ReportCompany ProfileManagement Discussion and AnalysisCorporate GovernanceCorporate Social ResponsibilityPT Kalbe Farma Tbk. • Laporan Tahunan 201290Proses Produksi Minuman KemasanBeverage Production ProcessKapasitas Produksi Produk Kesehatan Production Capacity of Health ProductsNo Sediaan SatuanKapasitas / TahunAnnual Production Capacity Unit Type2012 20111 Tablet Juta 424 424 Million Tablet2 Kapsul Juta 33 33 Million Capsule3 Cair Juta Liter 23 11.5 Million of Liters Liquid4 Serbuk Effervescent Ton 15.000 15,000 Tons Effervescent Powder5 Sari Buah Juta Liter 27 N/A* Million of Liters Fruit Juice* Akuisisi pada tahun 2012 Acquisition in 2012Direct-to-consumer marketing activities continued in 2012to build closer relationships with the customers. Some of theprograms carried out including fun walk activities organized underthe “Fatigon Aksi Semangat” Campaign, which successfullyattracted over 54,000 participants in 10 cities across Indonesia.Meanwhile, Kalbe’s Promag brand provided free consultationcenters for gastric health through its “Promag Ahlinya Lambung”event, while Kalbe’s children multivitamin brand, Cerebrofort,conducted multiple intelligence competition that drew enthusiasticparticipation from elementary school children. In addition, throughHydro Coco, we conducted Fun Bike series in 11 major cities inIndonesia attended by more than 110,000 participants.By December 2012, the Consumer Health Division delivereda 16.7% year-on-year net sales growth to Rp2,149 billion andcontributing 16% of Kalbe’s total net sales. Sales growth wassupported by the growing contribution from ready-to-drink,Kegiatan pemasaran direct-to-consumer terus berlanjut tahun2012 untuk membangun hubungan erat dengan konsumen.Beberapa program yang dilaksanakan antara lain kegiatan jalansehat sebagai bagian dari Kampanye “Fatigon Aksi Semangat”,yang berhasil menjaring lebih dari 54.000 peserta di 10 kotadi seluruh Indonesia. Produk Promag menawarkan layanankonsultasi gratis untuk kesehatan lambung melalui kegiatan“Promag Ahlinya Lambung”, sedangkan Cerebrofort, produkmultivitamin untuk anak-anak dari Kalbe, menyelenggarakankompetisi kecerdasan yang mendapat sambutan positif dari paramurid sekolah dasar. Di samping itu, produk Hydro Coco jugamengadakan acara fun bike di 11 kota besar di Indonesia yangdiikuti lebih dari 110.000 orang peserta.Di akhir Desember 2012, Divisi Produk Kesehatan berhasil meraihpertumbuhan penjualan bersih sebesar 16,7% mencapai Rp2.149miliar, serta menyumbang 16% dari total penjualan bersih Kalbe.Pertumbuhan tersebut didorong oleh meningkatnya kontribusiPackagingProductionProduksiKemasanBeverageProductionProduksiMinumanPre-formingPembentukanBlowingPeniupanMixingPencampuranSterilizingSterilisasiFillingPengisianCoolingPendinginanLabellingPelabelanCartoningPengemasandalam kardus
  • 93. PT Kalbe Farma Tbk. • 2012 Annual Report 91dari produk-produk minuman siap saji, minuman energi danproduk-produk baru Kalbe, serta stabilnya pertumbuhan obatbebas. Marjin laba kotor mencapai 55,2% dibandingkan sebesar56,4% di tahun sebelumnya.2013: Prospek dan PrioritasBesarnya populasi Indonesia, serta pertumbuhan kelas menengahdengan daya beli yang terus tumbuh serta makin sadar akanpentingnya kesehatan akan tetap menjadi pendorong utamaprospek di sektor produk kesehatan. Segmen obat bebas akantetap tumbuh stabil dengan marjin yang lebih tinggi, sedangkansegmen minuman siap saji menawarkan pertumbuhan yang lebihtinggi, walaupun dengan tingkat marjin lebih rendah.Ke depan, perluasan portofolio produk akan tetap menjadiprioritas utama Kalbe, melalui peluncuran produk-produk inovatifyang menawarkan manfaat kesehatan bagi konsumen. Produk-produk tersebut didukung oleh reputasi Kalbe yang telah dikenalluas, kemampuan riset dan pengembangannya, serta keunggulandistribusi dan logistik Perseroan. Akhirnya, upaya pemasarandan promosi yang efektif akan terus berlanjut untuk membangunposisi merek yang kuat bagi setiap produk kesehatan Kalbe.energy drink and new products as well as a steady growth ofover-the-counter drugs. Gross profit margin reached 55.2%,compared to 56.4% last year.2013: Prospects and PrioritiesIndonesia’s large population and the growing middle class withrising disposable income and health awareness remain the keydrivers behind the prospects for consumer health products. TheOTC segment offers a stable growth with higher margin, whilethe ready-to-drink segment promises higher growth opportunitiesalbeit with lower margin figure.Going forward, product portfolio expansion will remain Kalbe’s toppriority by bringing new innovative products with health benefitsto the market. These new products will be supported by Kalbe’srespectable reputation, its research & development capabilitiesas well as the Company’s distribution and logistics leadership.Last but not least, well targeted and effective marketing andpromotion efforts will continue to develop strong brand positionfor each consumer health product.Fatigon Aksi Semangat IndonesiaKegiatan jalan sehat yang diadakan di10 kota besar di Indonesia yang diikutilebih dari 54.000 peserta, sebagaibagian dari rangkaian program “FatigonAksi Semangat Indonesia”Fun walk activities held in 10 majorcities in Indonesia with more than54,000 total participants, as part ofthe series of “Fatigon Aksi SemangatIndonesia” program
  • 94. Performance HighlightsManagement ReportCompany ProfileManagement Discussion and AnalysisCorporate GovernanceCorporate Social ResponsibilityPT Kalbe Farma Tbk. • Laporan Tahunan 201292Tinjauan UsahaBusiness ReviewDivisi NutrisiNutritionals DivisionDivisi Nutrisi Kalbe menawarkan berbagai pilihan produk untuksetiap segmen usia, mulai dari bayi, balita, anak-anak, pra-remaja, dewasa, ibu hamil dan menyusui, serta para lanjut usia;dan produk-produk untuk konsumen dengan kebutuhan khusus.Ragam produk ini sejalan dengan strategi produk Kalbe untukmelayani kebutuhan segmen-segmen khusus (niche market)dengan memanfaatkan keunggulan Kalbe di industri kesehatan.Produk-produk nutrisi Kalbe terutama terdiri dari produk-produksusu bubuk bagi segmen premium. Beberapa produk Kalbeuntuk segmen ini termasuk Milna, Prenagen, Morinaga danEntrasol. Kalbe mulai memasuki segmen mass market sekitardua tahun yang lalu melalui peluncuran produk susu bubuk Zeeuntuk anak-anak dan pra-remaja tahun 2010 serta Lovamil bagiibu hamil dan menyusui di tahun 2011. Produk Diabetasol adalahproduk pengganti makanan yang menawarkan nutrisi lengkapbagi para penderita diabetes. Produk nutrisi Kalbe lainnya antaralain adalah Fitbar, sajian makanan ringan berkalori rendah, sertaKalbe’s Nutritionals Division showcases a complete range ofproducts for all age segments, from infants, toddlers, children,tweens, adults, expectant and lactating mothers, up to the elderlysegment, as well as products for consumers with special medicalneeds. This product range is in line with Kalbe’s product strategyto target certain niche markets by leveraging the Company’sstrengths in the health industry.Kalbe’s nutritional products comprise largely of powdered milkproducts targeting the premium segment. Some of Kalbe’sproducts for this segment include Milna, Prenagen, Morinagaand Entrasol. To tap the opportunity in the mass market, Kalbebegan to enter this segment approximately two years ago withthe introduction of its powdered milk product Zee for kids andtweens in 2010 and Lovamil in 2011, a powdered milk productfor expectant and lactating mothers. Kalbe’s Diabetasol is a mealreplacement with complete nutrition for diabetic customers.Other Kalbe’s nutritional products include Fitbar, a healthy andHadir di Setiap TahapanPenting KehidupanTouching Lives inAll Important Stages
  • 95. PT Kalbe Farma Tbk. • 2012 Annual Report 93Nutrive Benecol, minuman kesehatan dengan kandungan khususuntuk menurunkan kolesterol.Pencapaian Penting 2012Di bulan Juni 2012, Kalbe telah membentuk perusahaan patungandengan PT Milko Beverage Industry, produsen minuman berbahandasar susu. Perusahaan patungan tersebut, PT Kalbe MilkoIndonesia, akan menjadi basis produksi bagi produk-produknutrisi cair, guna melengkapi ragam produk Kalbe yang saat inididominasi produk-produk susu bubuk.Inovasi produk baru tetap menjadi prioritas penting Kalbe tahun2012,antaralaindenganpeluncuranprodukFitbar,produkpertamakami pada segmen makanan ringan yang sehat. Berpegang padakomitmen kami pada kesehatan, Fitbar menawarkan alternatifmakanan ringan yang lebih sehat bagi konsumen. Fitbar adalahmakanan ringan yang terbuat dari gandum dan biji-bijian dengankalori rendah, tanpa kandungan kolesterol dan lemak trans. Kalbetasty snack bar with low calories and Nutrive Benecol, a smoothiewith special ingredients to lower cholesterol.2012 HighlightsIn June 2012, Kalbe established a joint venture company with PTMilko Beverage Industry, a milk-based beverage manufacturer.The joint venture company, PT Kalbe Milko Indonesia, is set to bethe manufacturing basis for Kalbe’s liquid nutritional products toexpand its existing product offering, which currently comprisesmostly of milk products in powdered format.New product innovation continues to become Kalbe’s key prioritiesin 2012, among others with the introduction of Fitbar, our firstventure into healthy snack. Staying true to our commitment tohealth, Fitbar provides consumers with a healthier alternative tosnack. It is a snack bar made of oats and cereals which are low incalories, contains zero cholesterol and zero trans fat. Kalbe alsoexpanded the Morinaga product offering through the launching of24.5%Pertumbuhan PenjualanBersihNet Sales Growth3,012bnRpPenjualan Bersih tahun 20122012 Net SalesProspek produk-produk nutrisi akan tetap menarik,mengingat masih rendahnya konsumsi produk susu diIndonesia serta tumbuhnya populasi kelas menengah yangmakin menyadari pentingnya menjaga kesehatan.The market for nutritional products is considered to remain attractive, given the still relativelylow milk consumption in Indonesia and the growing middle class population that increasinglybecomes more health conscious.
  • 96. Performance HighlightsManagement ReportCompany ProfileManagement Discussion and AnalysisCorporate GovernanceCorporate Social ResponsibilityPT Kalbe Farma Tbk. • Laporan Tahunan 201294juga mengembangkan produk Morinaga melalui peluncuranMorinaga Chil Kid P-HP, Morinaga Chil Kid Soya dan MorinagaChil School Soya. Produk-produk berbasis kacang kedelai inimerupakan bagian dari Solusi Total Alergi Morinaga, khusus bagibayi dan anak-anak penderita alergi laktosa.Kapasitas Produksi Produk Nutrisi Production Capacity of Nutritionals ProductsNo Sediaan SatuanKapasitas / TahunAnnual Production Capacity Unit Type2012 20111 Susu bubuk Ton 14,000 14,000 Ton Powdered milk2 Makanan bayi danbiskuitTon 1,200 1,200 Ton Baby foods andbiscuitsProses Produksi Susu BubukPowdered Milk Production ProcessPackingPengemasanFat BlendingPencampuranLemakMixingPencampuranSpray DryingSpray DryingDry BlendingPencampuranBahan KeringSitus belanja online Kalbe, Kalbe e-store (www.kalbestore.com)juga berhasil mencatat kemajuan yang berarti selama tahun2012. Diluncurkan di tahun 2011, Kalbe e-store merupakan situsbelanja produk nutrisi pertama di Indonesia, di mana konsumendapat melakukan pemesanan melalui situs belanja online ataulayanan hotline Kalbe Home Delivery di nomor 500880. Selainmenawarkan kenyamanan pengalaman berbelanja, Kalbe e-storejuga memberikan layanan pengiriman gratis serta manfaat pointrewards bagi para pemilik kartu Kalbe Family Rewards Card.Di akhir 2012, Kalbe e-store sudah dapat melayani 25 kota-kota besar, dan menawarkan berbagai produk nutrisi ke hampir100.000 anggota di seluruh Indonesia.Pada tahun 2012, Kalbe melakukan kegiatan pemasaran secaraintensif. Kami mengadakan berbagai kegiatan pemasaranlangsung kepada konsumen pada seluruh rangkaian produk,seperti program “Prenagen and the City” yang diadakan di enamkota besar, yang diikuti lebih dari 10.000 ibu hamil. Program inimenampilkan temu wicara dan tari perut sebagai aktivitas fisikyang menyenangkan dan aman bagi ibu hamil. Melalui Diabetasol,Kalbe mengorganisir 104 kegiatan jalan sehat dengan lebihdari 40.000 peserta sebagai bagian rangkaian peringatan HariDiabetes Sedunia. Program “Morinaga Dunia Generasi Platinum”meliputi 221 kegiatan di 40 kota, dengan jumlah peserta mencapaiMorinaga Chil Kid P-HP, Morinaga Chil Kid Soya and MorinagaChil School Soya during the year. These soya based productsare part of Kalbe’s Morinaga Allergy Total Solution, catering theneeds of lactose intolerant infants and children.Kalbe’s online shopping site, Kalbe e-store (www.kalbestore.com)also posted considerable progress during the year. Launchedin 2011, Kalbe e-store is widely considered as the first onlinenutrition store in Indonesia, where customers can post theirorders through the online shopping site or through its hotlineservice, Kalbe Home Delivery at 500880. In addition to providingconvenient shopping experience to its customers, Kalbe e-storealso offers free delivery service and point reward benefits forKalbe Family Rewards Card holders. By the end of the year,Kalbe e-store is already available in 25 major cities, offering ournutritionals and consumer product selection to almost 100,000members throughout the country.In 2012, Kalbe intensified marketing activities to create demand.We rolled out series of direct-to-consumer activities in all productrange, such as “Prenagen and the City” program which wereheld in six major cities, with over 10,000 expecting mothers asparticipants. This program featured talk shows and belly dancingas an exciting and safe physical exercise for expecting mothers.Through Diabetasol, Kalbe organized 104 fun walk activitieswith over 40,000 participants, as part of the World DiabetesDay commemoration. “Morinaga Dunia Generasi Platinum”program encompasses 221 events in 40 cities, with a staggeringparticipation of 200,000 people. Through the Zee brand,PackingPengemasanFat BlendingPencampuranLemakMixingPencampuranSpray DryingSpray DryingDry BlendingPencampuranBahan Kering
  • 97. PT Kalbe Farma Tbk. • 2012 Annual Report 95200.000 orang. Melalui Zee, Kalbe mengadakan kompetisimatematika dan sains di enam kota di Indonesia dengan lebihdari 1.300 peserta.Di akhir tahun 2012, Divisi Nutrisi berhasil meraih pertumbuhanpenjualan bersih sebesar 24.5% menjadi Rp3.012 Miliar, sertamenyumbang 22% dari total penjualan bersih Kalbe. Beberapaproduk unggulan Kalbe seperti Prenagen dan Diabetasol tetapmempertahankan posisi teratas pada segmen masing-masing.Prenagen memimpin segmen produk susu bagi ibu hamil danmenyusui dengan pangsa pasar 55%, sementara Diabetasolmenguasai lebih dari 80% dari pasar produk susu bagi penderitadiabetes (sumber : AC Nielsen).2013: Prospek dan PrioritasProspek produk-produk nutrisi akan tetap menarik, mengingatmasih rendahnya konsumsi produk susu di Indonesia sertatumbuhnya populasi kelas menengah yang makin menyadaripentingnya menjaga kesehatan. Kami akan terus memperkuatportofolio produk Kalbe dengan peluncuran produk minuman siapsaji (ready-to-drink) yang lebih mudah dikonsumsi, mulai denganproduk-produk yang ada seperti Prenagen, Nutrive Benecol, Zeedan Diabetasol, untuk dilanjutkan dengan peluncuran produk-produk baru. Saat ini, Kalbe telah menawarkan produk minumansiap saji melalui kerjasama alih daya memanfaatkan fasilitasproduksi pihak ketiga. Guna mengakselerasi proses perluasanusaha, kami akan mulai membangun fasilitas produksi baruuntuk produk nutrisi cair melalui anak perusahaan patungan,PT Kalbe Milko Indonesia. Pembangunan fasilitas produksitersebut diharapkan dapat selesai tahun 2014.Selain itu, kami akan terus meningkatkan kemampuanpengembangan produk baru guna mendukung strategi inovasiproduk Kalbe. Upaya tersebut akan didukung oleh inisiatif-inisiatifbrand repositioning, penyempurnaan dan modernisasi kemasan,kegiatan promosi, serta inisiatif peningkatan ketersediaan barangbekerjasama dengan Divisi Distribusi dan Logistik.mathematics and science competitions were conducted in sixcities in Indonesia with more than 1,300 participants.By the end of the year, Kalbe’s Nutritionals Division delivered a24.5% increase in net sales to Rp3,012 Billion, contributing 22%of Kalbe’s total net sales. Sales growth was supported by strongvolume growth across the products. Some of Kalbe’s leadingproducts like Prenagen and Diabetasol continued to maintainstronghold in the respective segment. Prenagen dominated theexpectant and lactating mother milk segment with close to 55%market share, while Diabetasol controlled over 80% market sharein the milk product for diabetic patient category (source : ACNielsen).2013: Prospects and PrioritiesThe market for nutritional products is considered to remainattractive, given relatively low milk consumption in Indonesia andthe growing middle class population that increasingly becomesmore health conscious. In the future, we will strengthen ourproduct portfolio by expanding into ready-to-drink format toprovide more convenience for consumers, starting with theexisting brands such as Prenagen, Nutrive Benecol, Zee andDiabetasol, and subsequently expanding into new products.Currently, we have offered the ready-to-drink products throughoutsourcing to external production facilities. To accelerateexpansion, we will start the construction of a new productionfacility for liquid nutritionals products to be run under the jointventure subsidiary, PT Kalbe Milko Indonesia. The construction ofthis facility is expected to be completed by 2014.In addition, we will continuously enhance our new productdevelopment capabilities in line with Kalbe’s product innovationstrategy. These efforts will be coupled with brand repositioning,packaging improvement and modernization, active promotion aswell as product availability improvement initiatives in coordinationwith Kalbe’s Distribution and Logistics Division.Nutrive BenecolSmoothie dengan bahankandungan khusus untukmenurunkan kolesterolSmoothie with specialingredient to lowercholesterolFitbarMakanan ringan rendah kalori,tidak mengandung kolesteroldan lemak transLow calory snack bar withzero cholesterol and zerotrans fat
  • 98. Performance HighlightsManagement ReportCompany ProfileManagement Discussion and AnalysisCorporate GovernanceCorporate Social ResponsibilityPT Kalbe Farma Tbk. • Laporan Tahunan 201296Divisi Distribusi & LogistikDistribution & Logistics DivisionSebagai perusahaan farmasi dan produk kesehatan, ketersediaanproduk merupakan salah satu keunggulan bersaing Kalbeuntuk terus mempertahankan kepemimpinan pasarnya. Kondisigeografis Indonesia sebagai negara kepulauan serta kondisiinfrastruktur nasional yang kurang menguntungkan telahmenyebabkan sulitnya menjamin ketersediaan produk di seluruhNusantara. Didukung jaringan yang luas, dari Banda Aceh diujung utara Sumatra hingga Jayapura di timur propinsi PapuaBarat, Divisi Distribusi dan Logistik mengoperasikan jaringandistribusi produk farmasi dengan jangkauan terluas di Indonesia.Jaringan distribusi kami meliputi sekitar 1 juta outlet di Indonesia,yang terdiri dari outlet-outlet farmasi seperti rumah sakit danapotek, serta outlet produk kesehatan dan produk nutrisi. Selainmendistribusikan produk-produk internal Kalbe, Divisi ini jugamelayani para prinsipal pihak ketiga.As a pharmaceuticals and consumer health Company, productavailability is one of Kalbe’s competitive advantages to maintainmarket dominance. Indonesia’s geographical landscape as anarchipelago, coupled with the nation’s substandard infrastructurecondition, has made it particularly challenging to ensure productavailability across the country. With its far-reaching network,spanning from Banda Aceh in the northern tip of Sumatra toJayapura in the eastern part of West Papua, our Distributionand Logistics Division operates the widest distribution coveragefor pharmaceuticals products in Indonesia. Kalbe’s distributionnetwork covers roughly 1 million outlets in Indonesia, comprisingpharmaceuticals outlets such as hospitals and pharmacies,as well as consumer health and nutritional products outlets. Inaddition to distributing Kalbe’s internal products, this Divisionalso serves the needs of third party principals.Tinjauan UsahaBusiness ReviewMemperkuat Jaringan Distribusiagar Lebih Dekat denganKonsumenStrengthening Distribution Network to BecomeCloser to Consumers
  • 99. PT Kalbe Farma Tbk. • 2012 Annual Report 97Bisnis distribusi dan logistik Kalbe dikelola oleh anak perusahaandengan kepemilikan 91,75%, PT Enseval Putra MegatradingTbk., yang merupakan perusahaan publik yang tercatat di BursaEfek Indonesia.Kegiatan usaha Divisi Distribusi dan Logistik juga mencakupperdagangan bahan baku dan alat-alat kesehatan, yang akanmenjadi bidang usaha pendorong pertumbuhan Kalbe di masadepan, seiring pelaksanaan jaminan kesehatan nasional di tahun2014.Akhirnya, Divisi ini juga bertanggung jawab mengelola usahaKalbe di bidang layanan kesehatan ritel, Klinik Mitrasana, jaringanklinik yang menggabungkan layanan dokter umum, apotek,laboratorium dan healthmart dalam satu atap.Kalbe’s distribution and logistics business is run through its91.75%-owned subsidiary, PT Enseval Putra Megatrading Tbk., apublic company listed on the Indonesian Stock Exchange.The Distribution and Logistics Division’s business activities alsoinclude raw material and medical devices trading, an area set tobecome Kalbe’s future growth engine with the implementation ofnational healthcare insurance in 2014.Finally, the Division is also responsible for managing Kalbe’s latestventure into retail health service, Mitrasana Clinics, an integratedclinic network that combines physician’s general practice,pharmacies, laboratory, and healthmart.34.0%Pertumbuhan PenjualanBersihNet Sales Growth5,188bnRpPenjualan Bersih tahun 20122012 Net SalesUpaya perluasan jaringan tetap menjadi salah satu prioritasutama tahun 2012, baik untuk melayani pertumbuhanpermintaan pasar maupun guna mempertahankankepemimpinan Kalbe di pasar farmasi dan produkkonsumen kesehatan di Indonesia.Network expansion continued to be one of the key priorities in 2012, both to address theindustry’s growing demand and to maintain Kalbe’s leadership in the pharmaceuticals andconsumer health product markets in Indonesia.
  • 100. Performance HighlightsManagement ReportCompany ProfileManagement Discussion and AnalysisCorporate GovernanceCorporate Social ResponsibilityPT Kalbe Farma Tbk. • Laporan Tahunan 201298Pencapaian Penting 2012Upaya perluasan jaringan yang dimulai di tahun sebelumnyatetap menjadi salah satu prioritas utama tahun 2012, baikuntuk melayani pertumbuhan permintaan pasar maupun gunamempertahankan kepemimpinan Kalbe di pasar farmasi danproduk konsumen kesehatan di Indonesia. Pada tahun 2012,Kalbe meningkatkan kapasitas di cabangnya di lima kota, yaitudi Banjarmasin, Jember, Surakarta, Banda Aceh, dan Denpasar.Selain itu, Kalbe juga terus melakukan perluasan area layananbekerjasama dengan para sub-distributor strategis. Di akhir 2012,jaringan distribusi dan logistik Kalbe terdiri dari 2 Pusat DistribusiRegional di Jakarta dan Surabaya, serta 65 cabang di 47 kota diseluruh Indonesia.Kapasitas Divisi Distribusi & Logistik Capacity of Distribution & Logistics DivisionNo GudangJumlahNumberJumlah PaletNumber of PalletsWarehouses2012 20111 Pusat Distribusi Regional 2 21,700 21,700 Regional Distribution Centres2 Cabang 65 60,339 51,647 BranchesKlinik Mitrasana telah menambah 12 outlet baru di daerahJabodetabek, sehingga pada akhir tahun 2012 mencapai 39 klinik,meningkat dari 27 klinik di tahun sebelumnya. Berbagai upayapenyempurnaan manajemen rantai pasokan dan operasi outlettelah diselesaikan tahun 2012, yang mulai berhasil meningkatkankelancaran operasi serta kinerja produktivitas di seluruh jaringanoutlet.Aspek distribusi memainkan peranan penting bagi pengelolaanrantai pasok Kalbe. Melalui implementasi berbagai inisiatifsecara konsisten sejak tahun 2008, di akhir 2012 Kalbe berhasilmenurunkan dan mempertahankan tingkat siklus operasionalbersihnya di level 114 hari dan perputaran persediaan di level 107hari.Dengandemikian,secarasignifikanKalbetelahmeningkatkansiklus operasional bersih dan perputaran persediaannya darisebesar 158 dan 142 hari di tahun 2008 sebelum dilaksanakannyaupaya-upaya perbaikan.Divisi Distribusi dan Logistik berhasil meraih pertumbuhanpenjualan bersih yang signifikan sebesar 34,0% dan mencapaiRp5.188 miliar tahun 2012. Secara konsolidasi akuntansi Kalbe,nilai penjualan bersih Divisi Distribusi dan Logistik terdiri daripenjualan bersih dari produk-produk prinsipal pihak ketiga danmarjin layanan distribusi untuk produk-produk internal Kalbe.Untuk tahun 2012, nilai penjualan bersih dari prinsipal pihakketiga menyumbang sebesar 36% dari total penjualan DivisiDistribusi dan Logistisk, sedangkan sisanya sebesar 64% berasaldari penjualan produk-produk internal Kalbe.2012 HighlightsNetwork expansion that began a year earlier continued to be oneof the key priorities in 2012, both to address the industry’s growingdemand and to maintain Kalbe’s leadership in pharmacetuicalsand consumer health markets in Indonesia. In 2012, Kalbeupgraded its branches in 5 cities to increase capacities, whichare Banjarmasin, Jember, Surakarta, Banda Aceh, and Denpasar.Also important was Kalbe’s ongoing efforts to expand and widenits coverage through cooperation with strategic sub-distributors.By the end of the year, Kalbe’s distribution and logistics armcomprised of 2 Regional Distribution Centers in Jakarta andSurabaya, and 65 branches in 47 cities across the nation.Mitrasana Clinics added 12 new outlets in Greater Jakarta(Jabodetabek), and ended 2012 with a total of 39 clinics from27 clinics a year earlier. Various improvement initiatives in supplychain management and in-store operation have been completedin 2012 and begin to deliver more streamlined operation andhigher productivity performance across the entire outlets.Distribution plays an important role in Kalbe’s supply chainmanagement. Through consistent implementation of variousinitiatives since 2008, Kalbe has managed to lower and maintainthe net operating cycle at 114 days and inventory turnover at107 days as of end of year 2012. Thus, Kalbe has managed toremarkably improve its net operating cycle and inventory turnoverfrom 158 days and 142 days respectively in 2008 before theimprovement efforts were implemented.The Distribution and Logistics Division booked a significant34.0% net sales growth to Rp5,188 billion in 2012. On Kalbe’saccounting consolidation basis, the net sales of the Distributionand Logistics Division consists of net sales from third partyprincipals and the internal distribution margin deriving from thedistribution of Kalbe’s internal products.For the year 2012, the net sales from third party principalscontributed 36% of the Distribution and Logistics Division’s totalsales, while Kalbe’s internal products accounted for the remaining64%.
  • 101. PT Kalbe Farma Tbk. • 2012 Annual Report 99Pertumbuhan penjualan yang signifikan tersebut terutamadisumbangkan oleh bergabungnya PT Abbott Indonesia sebagaiprinsipal baru pada bulan September 2011. Sekitar 86% dari totalpenjualan bersih disumbangkan oleh bisnis distribusi, di mana64% berasal dari distribusi produk-produk Kalbe sedangkansisanya sebesar 22% disumbangkan oleh jasa layanan distribusiuntuk para prinsipal pihak ketiga. Bisnis alat kesehatanmenyumbangkan 7% dari total penjualan bersih, sedangkansisanya sebesar 7% berasal dari usaha perdagangan alat-alatkesehatan dan lain-lain. Secara konsolidasi akuntansi, marjinlaba bruto Divisi ini mencapai 27,5% di tahun 2012, lebih rendahdari kinerja tahun 2011 sebesar 30,7%.2013: Prospek dan PrioritasLuasnya wilayah kepulauan Indonesia dan kondisi infrastrukturyang buruk akan terus menciptakan berbagai tantangan danpeluang bagi sektor usaha distribusi produk kesehatan. Selainitu, tingginya pertumbuhan ekonomi di daerah-daerah akanmendorong makin tersebarnya populasi konsumen di Indonesia,sehingga akan meningkatkan nilai strategis usaha Kalbe di bidangdistribusi.Dalam jangka pendek dan menengah, Kalbe akan melanjutkanekspansi jaringan distribusinya melalui pembukaan Pusat-pusat Distribusi Regional dan cabang-cabang baru. Kamijuga akan terus meningkatkan kapasitas cabang dan fasilitasyang ada, serta menyempurnakan sistem teknologi informasidan meningkatkan armada distribusi Kalbe guna mendukungpeningkatan permintaan di masa mendatang. Jumlah outlet KlinikMitrasana akan terus bertambah, agar Kalbe dapat mencapaisasaran usahanya menjadi penyedia solusi kesehatan palingkomprehensif di Indonesia.Ke depan, penyempurnaan tingkat layanan akan berlanjut,baik untuk melayani kebutuhan internal maupun para prinsipalpihak ketiga. Kinerja operasional akan terus ditingkatkanmelalui pencapaian berbagai indikator penting, seperti tingkatpemenuhan pesanan dan pengiriman tepat waktu, sertamendorong pertumbuhan volume dengan meningkatkan jumlahpelanggan dan jumlah barang per transaksi. Kami juga akan terusmendorong integrasi dengan bidang usaha Kalbe lainnya gunamendukung pertumbuhan usaha mereka, baik melalui perluasanarea layanan maupun peningkatan ketersediaan produk.Pengelolaan rantai pasokan akan terus menjadi prioritas, melaluifokus pada inisiatif pengadaan strategis guna meraih peningkatanusaha obat generik tanpa merek, serta manajemen persediaan,pengelolaan pergudangan dan manajemen transportasi yanglebih baik.Akhirnya, Kalbe akan membangun usaha alat kesehatannyasebagai pendorong pertumbuhan di masa mendatang, antaralain melalui kerjasama dengan mitra-mitra global untukmengembangkan portofolio produk, serta dengan menawarkanproduk dan layanan holistik bekerjasama dengan Divisi ObatResep dan Divisi Nutrisi.The significant sales growth was contributed primarily by theaddition of PT Abbott Indonesia as Kalbe’s new principal inSeptember 2011. Approximately 86% of the Division’s total netsales was generated by distribution business, 64% of which wasderived from the distribution of Kalbe’s own products and theremaining 22% was generated by distribution services to thirdparty principals. Medical devices business contributed 7% ofthe Division’s total net sales, while the remaining 7% came fromraw material trading and other activities. On Kalbe’s accountingconsolidated basis, the Division’s gross profit margin was at 27.5%in 2012, lower compared to 30.7% recorded in year 2011.2013: Prospects and PrioritiesThe vast and widely dispersed Indonesia archipelago andpoor infrastructure will continue to offer both challenges andopportunities to the health product distribution business. Inaddition, high economy growth trends in the regions will resultin more widely distributed consumer base in Indonesia, furtherincreasing the strategic importance of Kalbe’s distributionbusiness.In the short to medium term, Kalbe will maintain its distributionexpansion trajectory with the opening of new Regional DistributionCenters and new branches. We will continue to upgrade Kalbe’sexisting branches’ capacity and facility, as well as improve ourIT system and increase our distribution fleet to support futuregrowth demands. New Mitrasana Clinics are to be opened nextyear, bringing the Company closer to its objective to become themost comprehensive healthcare solution provider in the country.Going forward, service improvement initiatives will continue,targeting both the internal and external principals. We will alsopay close attention on efforts to improve operational excellencethrough the achievement of our key indicators such as orderfulfillment rate and on-time delivery, while at the same timecontinue to drive volume growth through increasing the number ofcustomer accounts and items per transaction. We will strengthenthe internal alignment with Kalbe’s other businesses to supporttheir growth by expanding coverage area and increasing productavailability. Supply chain management will continue to be ourpriority, by focusing on strategic sourcing initiatives to supportexpansion in unbranded generics, inventory management, leanwarehouse and transportation management.Finally, Kalbe will also build its medical device business as thefuture growth driver, among others by forging collaborationwith global partners to expand product portfolio and by offeringholistic product and service offering in partnership with Kalbe’sPrescription Pharmaceuticals and Nutritionals Divisions.
  • 102. Performance HighlightsManagement ReportCompany ProfileManagement Discussion and AnalysisCorporate GovernanceCorporate Social ResponsibilityPT Kalbe Farma Tbk. • Laporan Tahunan 20121002Pusat Distribusi RegionalRegional Distribution Centers (RDC)65CabangBranchesPePeKalimantanJakartaSurabayaSumatraRDC JakartaRDC SurabayaCabang | BranchesSub-Distributors
  • 103. PT Kalbe Farma Tbk. • 2012 Annual Report 10182,000Jumlah PaletPallets84Penambahan Kerjasama Sub-Distribusi tahun 2012Additional Sub-Distributor Collaboration in 2012SulawesiPapua
  • 104. Performance HighlightsManagement ReportCompany ProfileManagement Discussion and AnalysisCorporate GovernanceCorporate Social ResponsibilityPT Kalbe Farma Tbk. • Laporan Tahunan 2012102Tahun 2013 membawa peluang potensi pertumbuhan yangbaik. Kami menilai prospek usaha Kalbe akan didukungoleh pertumbuhan ekonomi Indonesia yang mantapdan perkembangan emerging markets yang membukapeluang untuk makin memantapkan eksistensi di pasarregional. Pada tahun 2013, Kalbe akan mempertahankanpertumbuhan kinerja yang positif melalui inovasi yangberkelanjutan dan eksekusi yang prima atas strategi-strategi yang telah kami formulasikan. Dalam jangkapanjang, dengan fokus yang jelas dan eksekusi yangkonsisten, kami optimis akan mampu mempertahankanpertumbuhan yang berkelanjutan dalam perjalanananmewujudkan visi dan misi kami.Kami akan melaksanakan strategi-strategi berikut padatahun 2013:Year 2013 brings promising business growth potentials. We believe that Kalbe’sbusiness prospect will be driven by Indonesia’s solid economic growth and the growthof the emerging markets, providing opportunities to strengthen our existence in theregional market. In 2013, Kalbe will drive to sustain positive growth performance throughcontinuous innovation and excellent execution of strategies we have formulated. In thelong run, with clear focus and consistent execution, we believe that we can createsustainable growth in the journey to achieve our vision and mission.We will implement the following strategies in 2013:Performance HighlightsManagement ReportCompany ProfileManagement Discussion and AnalysisCorporate GovernanceCorporate Social ResponsibilityStrategi 20132013 StrategyPT Kalbe Farma Tbk. • Laporan Tahunan 2012102
  • 105. PT Kalbe Farma Tbk. • 2012 Annual Report 103Mempercepat Go Global denganmeluncurkan produk-produk Kalbe danmemperkuat jalur distribusi di pasar global,yang didukung oleh seluruh kekuatan didalam bisnis Grup Kalbe untuk mewujudkanGlobal Brand.Expediting Go Global through productlaunching and strengthening of distributionnetwork in the global market, supportedby all forces in Kalbe Group business toachieve Global Brand.1Memperkuat portofolio bisnismelalui inovasi produk, proses danbisnis serta pelaksanaan merger &acquisitions.Strengthening business portfoliothrough innovation in product,process and business, as well asmerger & acquisitions.2435Meningkatkan efektivitas pemasarandan penjualan melalui sinergi brand,membuka peluang pasar baru,serta memperkuat distribusi untukmemperluas ketersediaan dankeberadaan produk.Improving sales and marketingeffectiveness through brand synergy,opening of new market opportunities,and strengthening distribution toexpand product availability andpresence.Mengembangkan pemimpin yangkompeten dan berkarakter Panca SradhaKalbe secara berkesinambungan.Developing competent leaders with PancaSradha Kalbe characters continuously.Mengelola modal kerja secara efektifuntuk menjaga arus kas operasionalyang optimal.Managing working capital effectivelyto maintain optimal operational cashflows.
  • 106. Performance HighlightsManagement ReportCompany ProfileManagement Discussion and AnalysisCorporate GovernanceCorporate Social ResponsibilityPT Kalbe Farma Tbk. • Laporan Tahunan 2012104Tinjauan OperasionalOperational ReviewSejak awal pendiriannya di tahun 1966, Perseroan menyadaribahwa di sektor farmasi yang berbasis pengetahuan, kemampuanriset dan pengembangan yang solid merupakan elemen pentinguntuk meraih pertumbuhan. Kini, semangat inovasi ini telahmenjadi bagian tak terpisahkan dari Perseroan dan menjadi salahsatu penunjang utama keberhasilan menjadi perusahaan farmasiterbesar di Indonesia.Kegiatanrisetdanpengembangandilaksanakanuntukmendukungkeberadaan usaha Kalbe di segmen obat resep, obat bebas sertaproduk kesehatan dan nutrisi.Melalui pusat-pusat riset khusus, Perseroan juga aktif terlibatdalam kegiatan riset mutakhir di bidang pengembangan sistempenghantaran obat (drug delivery system) dan obat kanker, sertariset di bidang sel punca, pengujian genomik dan bioteknologi.Since Kalbe’s inception in 1966, the Company has been awarethat in the knowledge-based pharmaceutical sector, strongresearch and development is an essential element for growth.Today, this innovation spirit has become the very fabric of theCompany and a key contributor to its success to become thelargest pharmaceutical company in the country.Research and development activities are implemented to supportKalbe’s businesses in the prescription pharmaceuticals, over-the-counter drug as well as consumer health and nutritional productsegments.Through dedicated research centers, the Company is also activelyinvolved in state-of-the art research works in drug delivery systemand cancer drug development, as well as in stem cell, genomictest and biotechnology.Riset dan PengembanganResearch and DevelopmentMenumbuhkembangkan Inovasiuntuk Mendorong PertumbuhanNurturing Innovation to Drive Growth
  • 107. PT Kalbe Farma Tbk. • 2012 Annual Report 105Total biaya riset dan pengembangan pada tahun 2012 mencapaiRp91 miliar, stabil dibandingkan tahun sebelumnya. Rasio biayariset dan pengembangan terhadap total penjualan pada tahun2012 adalah sebesar 0,7%.Pengembangan Produk Baru Tahun 2012Sepanjang tahun, Kalbe terus aktif mengembangkan teknologi-teknologi baru serta meningkatkan kualitas pengembanganproduknya, tanpa mengesampingkan ketaatan kepada prinsip-prinsip proses produksi yang ramah lingkungan.Di segmen obat generik, kegiatan riset dan pengembanganmerupakan faktor penting dari implementasi strategi ‘first mover’Kalbe, untuk menjadi produsen pertama yang produsen obatpertama yang meluncurkan produk generik untuk obat yangtelah habis masa patennya. Perseroan juga terus berupayamerejuvenasi produk-produknya dengan senantiasa menawarkannilai-nilai tambahan baru ke pasar. Pada tahun 2012, KalbeTotal research and development expenses in 2012 amountedto Rp91 billion, relatively stable compared to the previous year.Ratio of research and development expense to total sales in 2012reached 0.7%.Key Product Development in 2012During the year, Kalbe continued to actively develop newtechnologies and to advance the quality of product development,while maintaining strict adherence to environmentally-friendlymanufacturing principles.In the generic drug segment, research and development is thedriver behind the implementation of Kalbe’s ‘first mover’ strategy,which aims to become the first manufacturer in the market tointroduce generic drugs for drugs that have reached their patentexpiration dates. The Company also strives to rejuvenate Kalbe’sexisting products to always bring unique value added to themarket. In 2012, the Company introduced a new product, TamolivRp0.7%Rasio Biaya Riset danPengembangan terhadapPenjualanRatio of Research andDevelopment Expense toSales91bnBiaya Riset dan Pengembangantahun 2012Research and DevelopmentExpense in 2012Di tahun 2012, Innogene Kalbiotech Pte. Ltd. berhasilmeraih penghargaan sebagai the Fastest Growing HomeGrown Company for Oncology Care dari Frost & SullivanAsia Pacific.In 2012, Innogene Kalbiotech Pte. Ltd. was awarded as the Fastest Growing Home GrownCompany for Oncology Care from Frost & Sullivan Asia Pacific.
  • 108. Performance HighlightsManagement ReportCompany ProfileManagement Discussion and AnalysisCorporate GovernanceCorporate Social ResponsibilityPT Kalbe Farma Tbk. • Laporan Tahunan 20121061000 mg, an intravenous solutions containing paracetamol,a widely used antipyretic (fever reducer) rarely available inintravenous solutions format.In 2012, a total of 18 new products were released in theprescription drug category. In addition, a number of new over-the-counter drugs and nutraceutical products were introduced,further cementing Kalbe’s presence in the healthcare market.2012 Innovation HighlightsAside from advances in new product formulation, Kalbe’s forayin breakthrough innovation also garnered important developmentin 2012.In the development of drug delivery system, Kalbe has put inplace a long term development strategy, aiming at introducingmore effective drug delivery approaches in its future products tomeet growing customer demand and address the increasinglycompetitive market.In this area, parenteral fat emulsion technology for small volumeinjection was the latest addition of new technology acquiredin 2012 in partnership with Doosan Corporation Glonet, SouthKorea. Also in the same year, the Company has successfullyimplemented liophilisation technology for its injection productsfor better quality, faster dissolving process and improved drugstability. Considerable progress has also been made in introducing‘sustained release’ and ‘fast disintegrating tablet’ drug deliverytechnologies into Kalbe’s marketed products to reduce potentialside effects and increase consumption convenience, therebyimproving patient’s drug taking compliance for a successfultherapy.Kalbe’s stem cell and cancer research activities are largelyconducted through its research center, Stem Cell and CancerInstitute (SCI). Since its establishment in 2006, SCI has grown tobecome a well recognized research center for its participation invarious international activities and is positioned to be the basisfor future therapy development to replace conventional drugs andtherapy. SCI actively conducts research on umbilical cord matrixas a new source of mesenchymal stem cells. Research findingsconcluded that mesenchymal stem cells have higher qualityand quantity compared to mesenchymal stem cells from othersources such as cord blood and fatty tissue. These findings willserve as a basis for further efforts to assess the clinical aspect oftherapies for cardiovascular and other degenerative diseases. Inthe cancer research area, SCI is more focused on lung and breastcancers.memperkenalkan produk barunya, Tamoliv 1000 mg, produk infusyang mengandung Paracetamol, suatu senyawa yang sudahsangat dikenal sebagai penurun panas, namun masih belumbanyak tersedia dalam bentuk sediaan infus.Sepanjang tahun 2012, total sebanyak 18 produk baru telahdiluncurkan untuk kategori obat resep. Selain itu, beberapaproduk obat bebas dan nutrisi juga telah diluncurkan sebagaiupaya untuk terus memperkuat kehadiran Kalbe di industrikesehatan.Pencapaian Inovasi 2012Selain pencapaian di bidang formulasi produk baru, upaya Kalbedi bidang inovasi terus meraih perkembangan penting selamatahun 2012.Di bidang pengembangan sistem penghantaran obat, Kalbetelah menyiapkan strategi pengembangan jangka panjang, yangbertujuan memperkenalkan pendekatan penghantaran obatyang lebih efektif untuk obat-obat baru guna memenuhi makinmeningkatnya tuntutan konsumen serta menghadapi makinketatnya peta persaingan.Di bidang ini, pada tahun 2012 Perseroan telah mengakuisisiteknologi parenteral fat emulsion untuk small volume injectionbekerja sama dengan Doosan Corporation Glonet, Korea Selatan.Di tahun yang sama, Perseroan juga telah berhasil menerapkanteknologi liofilisasi untuk sediaan injeksi guna meraih peningkatankualitas, proses pelarutan yang lebih cepat serta stabilitas obatyang lebih tinggi. Kemajuan berarti juga berhasil dicapai dalammenerapkan teknologi penghantaran obat ‘sustained release’dan ‘fast disintegrating tablet’ untuk obat-obat yang dipasarkanguna mengurangi potensi efek samping dan meningkatkankenyamanan penggunaan, yang pada akhirnya akan dapatmeningkatkan kepatuhan pasien demi keberhasilan terapi.Kegiatan Kalbe di bidang riset sel punca dan kanker dilaksanakanmelalui pusat risetnya, Stem Cell and Cancer Institute (SCI).Sejak didirikan tahun 2006, SCI telah tumbuh menjadi pusat risetyang diakui partisipasinya di berbagai kegiatan internasional,serta dirintis untuk menjadi basis pengembangan terapi masamendatang untuk menggantikan obat dan terapi konvensionalyang digunakan saat ini. SCI aktif terlibat dalam riset matriktali pusat sebagai sumber baru sel punca mesenkimal. Hasilpenelitian menyimpulkan bahwa sel punca mesenkimal memilikikualitas dan kuantitas yang lebih baik dibanding sel puncamesenkimal dari sumber lain seperti darah tali pusat dan jaringanlemak. Temuan ini akan menjadi dasar upaya selanjutnya untukmelihat aspek-aspek klinis bagi terapi penyakit kardiovaskuleratau penyakit degeneratif lainnya. Di bidang penelitian kanker,SCI lebih memfokuskan pada studi kanker paru dan payudara.
  • 109. PT Kalbe Farma Tbk. • 2012 Annual Report 107Kalbe Genomics (KalGen), established by SCI in 2009, is the firstsophisticated molecular diagnostic laboratory in Indonesia, onewhich aims to support pharmacogenetic services through genetictesting on patients to determine the most appropriate type ofmedication. Working closely with Agendia, a leading diagnosticcompany from the Netherlands, Kalgen has successfullydeveloped an examination method to screen 70 breast cancergenes, marketed under the Mammaprint trademark, which hasproven very helpful in determining the chemotherapy treatmentfor breast cancer patients.Regenerative and Cellular Therapy (ReGeniC) is Kalbe’s mostrecent business unit, set up in 2010 to provide stem-cellprocessing services carried out in clinics for the treatment ofvarious diseases. ReGeniC is currently focusing on therapies forosteoarthritis, a type of disease resulting from the breakdownor loss of joint cartilage which acts as buffer between bones,particularly on knees.Innogene Kalbiotech Pte. Ltd. (Innogene) is Kalbe’s biotechnologyresearch arm located in Singapore. Innogene is actively involved inthe acquisition, development and commercialization of products,one of the most prominent being TheraCIM, a monoclonal antibodyfor targeted cancer therapy. In 2012 TheraCIM has completed thesecond phase for head and neck cancer enrollment as well ascervix trial enrollment. Currently, Innogene is in the process ofrecruiting patients for phase 3 head and neck cancer as well asfor the 3rd phase study for Racotumomab phase in non-smallcell lung cancer (NSCLC). Also in the same year, TheraCIM hasreceived approval in Nigeria for the indication of nasopharyngealcancer (NPC), glioma and squamous cell cancer of the head andneck (SCCHN) cancers as well as in Thailand for indication ofadvanced SCCHN.For these achievements, in 2012, Innogene was awarded as ‘theFastest Growing Home Grown Company for Oncology Care’ fromFrost & Sullivan Asia Pacific.Research and development activities in the Consumer HealthDivision encompass a wide range of product category, includingover-the-counter, herbal products, food supplements and ready-to-drink, for local and international markets. The wide array ofproducts demand understanding and adjustment of developmentprocedure to each product category including regulations, productcharacteristics, product life cycle, in the development of formulaand process, packaging and analysis method. Adjustmentsto product category are expected to meet optimal productlaunching target for each category covering quality, time, cost,Kalbe Genomics (KalGen), yang didirikan oleh SCI pada tahun2009, merupakan laboratorium diagnostik molekuler canggihyang pertama di Indonesia, dengan tujuan memberikan layananpemeriksaan genetik sel kanker pasien untuk menentukan jenisobat yang tepat sasaran. Bekerja sama dengan Agendia, sebuahperusahaan diagnostik terkemuka dari Belanda, Kalgen telahberhasil mengembangkan metoda pemeriksaan 70 gen kankerpayudara, dengan merek dagang Mamaprint, yang terbuktisangat membantu dalam menentukan pengobatan kemoterapiyang paling tepat untuk para pasien kanker payudara.Regenerative and Cellular Therapy (ReGeniC) merupakan unitusaha terbaru Kalbe, yang didirikan pada tahun 2010 untukmemberikan layanan pemrosesan sel punca dalam klinik untukkebutuhan terapi berbagai penyakit. Saat ini, ReGeniC sedangmemfokuskan pada terapi untuk penyakit osteoarthritis, jenispenyakit yang disebabkan oleh rusaknya atau hilangnya tulangrawan pada sendi yang berperan sebagai bantalan antar tulang,terutama pada lutut.Innogene Kalbiotech Pte. Ltd. (Innogene) adalah pusat riset Kalbedi bidang bioteknologi yang berlokasi di Singapura. Innogeneaktif terlibat dalam kegiatan akuisisi, serta pengembangan dankomersialisasi produk. Salah satu produk unggulan adalahTheraCIM, produk antibodi monoklonal untuk terapi kanker secaraterarah. Pada tahun 2012 TheraCIM berhasil menyelesaikan faseke 2 registrasi kanker kepala dan leher, serta registrasi untuk ujiklinis kanker serviks. Saat ini, Innogene sedang dalam prosesmerekrut pasien untuk fase 3 kanker kepala dan leher, sertauji klinis fase 3 untuk fase Racotumomab bagi non-small celllung cancer (NSCLC). Di tahun yang sama, TheraCIM berhasilmemperoleh persetujuan di Nigeria untuk indikasi nasopharyngealcancer (NPC), glioma dan squamous cell cancer of the head andneck (SCCHN), serta di Thailand untuk indikasi SCCHN stadiumlanjut.Atas pencapaian-pencapaian di atas, di tahun 2012 Innogeneberhasil meraih penghargaan sebagai ‘the Fastest Growing HomeGrown Company for Oncology Care’ dari Frost & Sullivan AsiaPacific.Kegiatan Riset dan Pengembangan pada Divisi Produk Konsumenmenangani beragam kategori produk, mencakup obat bebas,produk herbal, suplemen pangan, dan produk minuman siap saji,baik untuk pasar lokal maupun internasional. Beragamnya kategoriproduk ini menuntut pemahaman dan penerapan prosedurpengembangan yang disesuaikan dengan kategori produkmasing-masing yang antara lain mencakup regulasi, karakteristikproduk, serta siklus hidup produk, baik dari segi pengembanganformula dan proses, kemasan serta metode analisis. Penyesuaianterhadap masing-masing kategori produk ini diharapkan dapat
  • 110. Performance HighlightsManagement ReportCompany ProfileManagement Discussion and AnalysisCorporate GovernanceCorporate Social ResponsibilityPT Kalbe Farma Tbk. • Laporan Tahunan 2012108mass manufacturability, compliance to regulations, consumeracceptance and innovation content.Development of new technology is also directed to consumeroriented technology, such as single consumption packaging,which has become a characteristic of the Consumer HealthDivision. Year 2012 was a milestone for the Company with thesuccessful adoption of the thermoformed single dose packaging.This packaging is manufactured through thermoforming processthat allows shaping of packaging using a mould (cavity mould).This packaging concept is the first in the market and has beenapplied for 2 new products launched in 2012; Komix DT andNitros.In the cough remedy category such as Komix DT, this packaginghas obtained the Packindo Star Awars 2011 from the IndonesianPackaging Federation and the Asia Star Awards 2011 from AsiaPackaging Federation. For Nitros, this is the first energy shotproduct in Indonesia that applies thermoforming technology whileother similar products are still using bottle packaging.In the Nutritionals Division, active research and developmentactivities resulted in the launching of new innovative products toaddress consumer needs.WeexpandedtheMorinagaLine tocaterto the specialty segment by introducing Morinaga Allergy TotalSolution. With the increasing prevalence of lactose intoleranceand cow milk protein allergy in infants, we have developed theMorinaga P-HP (Partially - Hydrolized Protein) for children withcow milk protein allergy risk and Morinaga Soya for children withconfirmed allergy to cow milk protein. Morinaga P-HP containscasein and whey protein which have been processed withenzymes to reduce the allergenic factor. Morinaga Soya contains100% high quality soy protein, free of lactose and cow milk proteinand therefore are safe for children with confirmed allergies.memenuhi sasaran peluncuran produk baru yang optimal untukmasing-masing kategori produk yang mencakup aspek kualitas,waktu, biaya, aspek produksi masal, kepatuhan terhadap regulasi,penerimaan konsumen, dan kandungan inovasi.Pengembangan teknologi baru juga diarahkan pada teknologiyang berorientasi pada konsumen, dalam hal ini teknologikemasan sekali pakai misalnya sachet, yang menjadi ciri khasproduk-produk Divisi Produk Konsumen. Tahun 2012 merupakantahun yang bersejarah bagi Perseroan dengan berhasildiadopsinya kemasan thermoformed single dose. Kemasan inidiproduksi dengan proses thermoforming yang memungkinkanuntuk membuat bentuk-bentuk kemasan yang beragam sesuaikeinginanmelaluisebuahcetakan(cavitymould).Konsepkemasanini adalah produk pertama di pasaran, dan telah digunakan pada2 produk baru yang diluncurkan pada tahun 2012 yaitu Komix DTdan Nitros.Khusus untuk kategori obat batuk seperti Komix DT, kemasan initelah berhasil memperoleh penghargaan Packindo Star Awards2011 dari Federasi Pengemasan Indonesia dan Asia Star Awards2011 dari Asia Packaging Federation. Sedangkan untuk Nitros,produk ini adalah produk minuman energi konsentrat pertamadi Indonesia, yang mengaplikasikan teknologi thermoformingdibandingkan dengan produk sejenis lain yang masihmenggunakan kemasan botol.Pada Divisi Nutrisi, aktivitas riset dan pengembanganmenghasilkan produk-produk baru yang inovatif untuk memenuhikebutuhan konsumen. Kami menambah varian produk Morinagauntuk menjawab kebutuhan segmen khusus dengan meluncurkanMorinaga Solusi Total Alergi. Dengan semakin meningkatnyaangka kejadian intoleransi laktosa dan alergi protein susu sapipada anak-anak, kami telah mengembangkan Morinaga P-HP(Protein – Hidrolisat Parsial) untuk anak-anak dengan risiko alergiprotein susu sapi dan Morinaga Soya untuk anak-anak yangtelah dipastikan mengalami alergi protein susu sapi. MorinagaP-HP mengandung protein susu sapi kasein dan whey yang telahdiproses dengan enzim untuk mengurangi faktor penyebab alergi.Morinaga Soya mengandung 100% protein kedelai berkualitastinggi, bebas laktosa dan protein susu sapi sehingga amandikonsumsi anak-anak yang mengidap alergi.
  • 111. PT Kalbe Farma Tbk. • 2012 Annual Report 109Another result of product development in the NutritionalsDivision was the new snack bar, Fitbar. With the increasing healthconsciousness and mobility, we identify the need for snackingalternative which is convenient for consumers with active lifestyle.Fitbar contains only 110 calories, zero cholesterol and zero trans-fat.We will continue to strengthen our research and developmentactivities across different areas, from PrescriptionPharmaceuticals, Consumer Health and Nutritionals. Throughcontinuous product launching, we believe we will be able toaddress consumers’ expanding needs, provide more value addedand convenience for consumers, and strengthen our competencein preparing for the future technology of medicine.Hasil lain pengembangan produk pada Divisi Nutrisi adalahproduk makanan ringan yang baru, yaitu Fitbar. Denganmeningkatnya kesadaran akan kesehatan dan tingkat mobilitas,kami melihat ada kebutuhan terhadap alternatif makanan ringanuntuk konsumen dengan gaya hidup aktif. Fitbar mengandung110 kalori, tanpa kolesterol maupun lemak trans.Kami akan terus memperkuat aktivitas riset dan pengembanganpada seluruh area mencakup Obat Resep, Produk Konsumendan Nutrisi. Dengan peluncuran produk baru yang berkelanjutan,kami percaya kami akan mampu memenuhi kebutuhan konsumenyang makin beragam, memberikan nilai tambah dan kenyamananbagi konsumen dan untuk memperkuat kompetensi kami untukmempersiapkan penguasaan teknologi pengobatan masadepan.Morinaga P-HP (Protein –Hidrolisat Parsial)Susu bubuk untuk anak-anakdengan risiko alergi proteinsusu sapiPowdered milk for children withcow milk protein allergy riskMorinaga SoyaSusu bubuk yang terbuat dari100% protein kedelai untukanak-anak yang menderitaalergi protein susu sapiPowdered milk made of 100%soy protein for children withcow milk protein allergy
  • 112. Performance HighlightsManagement ReportCompany ProfileManagement Discussion and AnalysisCorporate GovernanceCorporate Social ResponsibilityPT Kalbe Farma Tbk. • Laporan Tahunan 2012110Sebagai perusahaan farmasi dan produk kesehatan yangterintegrasi secara vertikal, kegiatan usaha Kalbe meliputi seluruhpergerakan dan penyimpanan bahan-bahan baku, persediaanbarang dalam proses dan barang jadi, dari proses awal hinggakonsumsi. Dengan portofolio yang mencakup 2.000 jenis produk,yang diproduksi di 10 sepuluh lokasi terpisah dan didistribusikanke sekitar 1 juta outlet di seluruh Indonesia, skala usaha Kalbesangat tergantung pada dukungan pengelolaan rantai pasokanyang unggul dan terintegrasi.Pengelolaan rantai pasokan telah menjadi fokus dari Kalbe dalambeberapa tahun terakhir, terutama seiring dengan pembentukanKelompok Kerja Rantai Pasokan di tahun 2008, yang bertanggungjawab atas aktivitas analisis dan penyempurnaan seluruh rantaipasokan Grup Kalbe. Sejak pendiriannya, Kelompok Kerjatersebut terus meraih pencapaian penting, serta berhasil secarasignifikan mengurangi rata-rata perputaran persediaan danmemperbaiki siklus operasional bersih seluruh rantai pasokan.As a vertically integrated pharmaceuticals and consumer healthcompany, Kalbe’s business activities span all movement andstorage of raw materials, work-in-process inventory and finishedgoods, from the point of origin down to the point of consumption.With a portfolio entailing 2,000 types of products manufactured in10 different sites and distributed to roughly 1 million outlets acrossthe nation, Kalbe’s business scale relies heavily on the support ofan integrated and superior supply chain management.Supply chain management has been a focus area for Kalbe overthe past few years, particularly with the formation of a dedicatedSupply Chain Task Force in 2008, responsible for studying andimproving the Group’s entire supply chain. Since its creation, theTask Force continues to bring significant achievements, reducesthe average inventory turnover and improving the entire supplychain’s net operating cycle.Tinjauan OperasionalOperational ReviewPengelolaan Rantai PasokanSupply Chain ManagementMengoptimalkan PengelolaanRantai Pasokan untukMeningkatkan EfisiensiOptimising Supply Chain Management toImprove Efficiency
  • 113. PT Kalbe Farma Tbk. • 2012 Annual Report 111Program Tahun 2012Selain terus berupaya mempertahankan tingkat efisiensipersediaan dan kinerja siklus operasional bersih, berbagai inisiatifbaru telah dilaksanakan untuk meningkatkan siklus persediaanproduk siap saji Hydro Coco serta efisiensi pengadaan bahan bakuobat generik, sehingga dapat menyumbang pada peningkatanpenjualan produk-produk siap saji dan obat generik Kalbe.Pada tahun 2012, kami berhasil meningkatkan prosespembelian dan perencanaan menjadi lebih terintegrasi, setelahpenggabungan rantai pasokan produk konsumen ke dalamsistem pengelolaan rantai pasokan Kalbe. Melalui integrasiini, kami bertujuan mencapai tingkat efisiensi yang lebih tinggidalam pengadaan dan perencanaan, yang pada akhirnya akanterus memperbaiki persediaan untuk mencapai tingkat yang lebihoptimal. Kami juga telah meningkatkan kapasitas pasokan produksiap saji Kalbe yang terbaru, Hydro Coco, sehingga Perseroandapat memenuhi tumbuhnya permintaan pasar pada produkyang makin populer ini.Programs in 2012On top of continuing efforts to maintain Kalbe’s inventoryefficiency and net operating cycle performance, new intitiativeswere initiated to improve the supply cycle for Hydro Coco ready-to-drink product and the raw material sourcing efficiency forgeneric drugs, thus contributing higher sales booking for Kalbe’sready-to-drink and generic drug products.In 2012, we registered better, more integrated procurement andplanning processing following the integration of the consumerhealth supply chain into Kalbe’s overall supply chain managementsystem. With this integration, we aim to achieve higher efficiencyin terms procurement and planning, which ultimately will continueto improve Kalbe’s inventory to a more optimum level. Wesucceeded to increase the supply capacity for Kalbe’s latestready-to-drink product, Hydro Coco, allowing the Company tobetter respond the growing demand for this increasing popularbeverage.44Perbaikan SiklusOperasional Bersih sejaktahun 2008 (hari)Improvement in NetOperating Cycle since 2008(days)114Siklus Operasional Bersih tahun2012 (hari)Net Operating Cycle in 2012 (days)Sejak pendiriannya di tahun 2008, Kelompok Kerja RantaiPasokan berhasil mengurangi rata-rata perputaranpersediaan dan memperbaiki siklus operasional bersihseluruh rantai pasokan.Since its creation in 2008, the Supply Chain Task Force has succeeded in reducing the averageinventory turnover and improving the entire supply chain’s net operating cycle.
  • 114. Performance HighlightsManagement ReportCompany ProfileManagement Discussion and AnalysisCorporate GovernanceCorporate Social ResponsibilityPT Kalbe Farma Tbk. • Laporan Tahunan 2012112Perseroan melanjutkan pelaksanaan kebijakan strategic sourcingdalam pengadaan pasokan bahan baku utama. Memanfaatkanprinsip meraih harga optimum melalui pembelian dalam jumlahbanyak dengan kontrak jangka panjang, program tersebutmensyaratkan koordinasi erat antara fungsi-fungsi pemasarandan produksi Kalbe, serta kerjasama dengan para pemasok diIndonesia atau negara asal. Pada tahun 2012, inisiatif tersebutterus berhasil mencapai kinerja positif dan secara signifikanmeningkatkan kemampuan bersaing Kalbe, terutama di segmenpasar obat generik, sebuah pencapaian penting mengantisipasimeningkatnya permintaan produk generik tanpa merek dengandilaksanakannya jaminan kesehatan sosial di tahun 2014.Setelah pembentukan satuan kerja pengelolaan rantai pasokanpada tahun 2008, Kalbe terus mencari peluang memperkuatrantai pasokan. Satuan kerja bertugas mempelajari detil aktivitasrantai pasokan Kalbe dari awal hingga akhir, dimulai daripengadaan bahan baku, produksi, pemasaran, penjualan, hinggake distribusi dan logistik. Setelah empat tahun, hasil yang dicapaitercermin dari perbaikan perputaran persediaan, yang menurundari 142 hari pada tahun 2008 menjadi 107 hari pada tahun 2012.Perkembangan ini telah memberikan kontribusi positif padaperbaikan siklus operasional bersih dari 158 hari pada tahun2008 menjadi 114 hari pada tahun 2012.Dibandingkan dengan tahun 2011, di akhir tahun, nilai perputaranpiutang membaik dari 50 hari menjadi 48 hari di tahun 2012.Angka-angka perputaran utang dan perputaran persediaanmencapai masing-masing sebesar 41 hari dan 107 hari, lebihbaik dari angka tahun sebelumnya sebesar 57 dan 115 hari,sedangkan total siklus operasional bersih mencapai 114 hari dari108 hari di tahun 2011.Pada tahun 2012, aliran arus kas tetap terjaga secara stabil denganarus kas operasional bersih mencapai Rp1.376 miliar. PerbaikanThe Company continued to implement the strategic sourcinginitiative in the procurement of selected key molecules. Basedon the principles of gaining optimum price through high volumepurchase with long-term contracts, the program requiresclose coordination between Kalbe’s marketing and productionfunctions, as well as collaboration with suppliers, both inIndonesia and in originating countries. In 2012, this initiativecontinued to deliver positive results and considerably increasesKalbe’s competitivenes especially in the generic drug market, animportant move to anticipate growing demands for unbrandedgeneric drugs with the nation-wide health insurance system setto take effect in 2014.After the inception of the supply chain management task forcein 2008, Kalbe continued to look for ways to strengthen oursupply chain. The task force is in charge of looking into Kalbe’ssupply chain activities in detail from end-to-end, starting fromraw material procurement, production, marketing, sales, up todistribution and logistics. After four years, the achievementshave been evident in the improvement of the average inventoryturnover, down from 142 days in 2008 to 107 days in 2012. Thisprogress has contributed positively to the improvement in the netoperating cycle, from 158 days in 2008 to 114 days in 2012.Compared to year 2011, by the end of the year, Kalbe’s days ofaccount receivables improved from 50 days to 48 days in 2012.Figures for days of account payables and days of inventoryreached 41 days and 107 days respectively, better than theprevious year’s figures of 57 and 115 days, while total netoperating cycle was 114 days from 108 days in 2011.In 2012, cash generation remained strong with net operating cashflows reaching Rp1,376 billion. Improvements in supply chainProses Pengelolaan Rantai PasokanSupply Chain Management ProcessPemasok VendorGudang Bahan Baku dan KemasanRaw Material and PackagingWarehouseFasilitas ProduksiProduction SiteGudang BarangJadi Finished GoodsWarehouseLEAD TIMEPLANNING CYCLEORDER CYCLESiklus PerencanaanSiklus Pemesanan
  • 115. PT Kalbe Farma Tbk. • 2012 Annual Report 113pada pengelolaan rantai pasokan dan siklus operasional bersihtelah secara langsung menciptakan kemampuan menghasilkanarus kas secara mantap dari tahun ke tahun.Dengan membangun rantai pasokan yang terintegrasi melaluiperbaikan terus menerus, Perseroan berupaya mendukungpeningkatan produktivitas dan arus kas, serta efisiensi biayaproduksi di masa mendatang, sementara pada saat yang samamenjaga kualitas produk dan jasa. Pengelolaan rantai pasokanyang terintegrasi diharapkan mampu menghasilkan nilai tambahdalam wujud biaya produksi yang kian efisien, proses produksiyang lancar serta arus kas yang kuat berikut perbaikan siklusoperasional bersih.Inisiatif Tahun 2013Di tengah berbagai tantangan eksternal, seperti meningkatnyakompetisi, kemungkinan pengendalian harga dan perubahanperaturan, rantai pasokan yang efisien menjadi semakin penting.Kondisi geografis Indonesia sebagai kepulauan, ditambah denganinfrastruktur yang kurang memadai, terus menunjukkan perlunyaupaya khusus untuk mempertahankan ketersediaan produk diseluruh pelosok. Sebagai pemain di sektor konsumen dengan 65cabang, target kami adalah mengatur persediaan pada tingkatyang optimal sambil tetap mempertahankan ketersediaan produk,dengan menurunkan tenggang waktu dan mengoptimalkanseluruh rantai pasokan dari pengadaan, manufaktur dan logistik.Pengelolaan rantai pasokan tetap menjadi salah satustrategi utama kami pada tahun 2013. Tidak hanya bertujuanmemperbaiki ketersediaan produk di seluruh wilayah negeri, kamijuga bergerak untuk memperkuat rantai pasokan dalam rangkamendukung ekspansi ke arah solusi kesehatan yang menyeluruh.Kami percaya rantai pasokan yang efisien adalah salah satukunci untuk memenangkan persaingan dan mempertahankanposisi kepemimpinan dalam industri kesehatan Indonesia. Rantaipasokan yang ringkas dan siklus operasional bersih yang optimalakan menghasilkan arus kas operasional yang dibutuhkan untukmemperkuat posisi keuangan dan mendukung perkembanganusaha di masa mendatang.management and net operating cycle have directly created solidoperating cash flow generation over the years.By building integrated management of the supply chain throughcontinuous improvement, the Company strives to supportproductivity increases and cash flow generation, as well as futureproduction cost efficiency, while at the same time maintainingthe quality of products and services. Integrated supply chainmanagement is expected to add value in the form of efficientproduction costs, smooth production process and steady cashflows, along with improvements in the net operating cycle.2013 InitiativesAmidst more challenges from external environment – heightenedcompetition, possible price control and regulation changes, anefficient supply chain is becoming increasingly crucial. Indonesia’sgeographical condition as an archipelago, coupled with poorinfrastructure, continue to call for special efforts to maintainproduct availability across the country. As player in consumerproduct sector with presence in 65 branches, our target is tomanage inventory at optimal level while maintaining productavailability, by reducing lead time and optimizing the entire supplychain from procurement, manufacturing, and logistics.Supply chain management will continue to be one of our topstrategies in 2013. Not only do we intend to continuously improveproduct availability across the nation, we also move to strengthenour supply chain to support our expansion into comprehensivehealthcare solution. We believe an efficient supply chain is a keyfactor to win the competition and maintain our leading positionin the Indonesian healthcare industry. A lean supply chain andoptimum net operating cycle will generate strong operationalcash flows needed to strengthen our financial position andsupport future business expansion.Pusat Distribusi RegionalRegional Distribution CenterCabangBranchLOGISTIC CYCLESiklus Logistik
  • 116. Performance HighlightsManagement ReportCompany ProfileManagement Discussion and AnalysisCorporate GovernanceCorporate Social ResponsibilityPT Kalbe Farma Tbk. • Laporan Tahunan 2012114Tinjauan OperasionalOperational ReviewSeiring meningkatnya persaingan dan pertumbuhan usaha GrupKalbe yang pesat, kemampuan merekrut, mengembangkan sertamempertahankan sumber daya manusia yang tepat menjadifaktor penting bagi Perseroan.Pengembangan sumber daya manusia (SDM) di Kalbe tidaksemata menjadi tanggung jawab Divisi SDM, melainkan menjaditanggung jawab dari jajaran manajemen seluruh anak perusahaanGrup Kalbe. Setiap anggota manajemen bertanggung jawabterhadap kegiatan pengembangan SDM, untuk menjagakesinambungan pertumbuhan seluruh lini usaha Kalbe.Divisi SDM berperan sebagai mitra strategis yang membantumanajemen menetapkan strategi pengembangan calon-calonpemimpin, serta membangun dan mengimplementasikan sistemSDM sesuai dengan strategi usaha Kalbe.The ever increasing competition and Kalbe Group’s rapid growthmean that the ability to attract, develop and retain suitable talentsis a crucial key success factor, firmly fixated on the Group’simportant agenda.Human resources (HR) development within Kalbe is not only theresponsibility of the Company’s HR Division, but of the widermanagement structure of all companies within the Kalbe Group.All members of management are responsible for HR developmentwith the overall aim of achieving sustainable growth of Kalbe’sentire line of businesses.TheHRDivisionactsasastrategicpartnerinassistingmanagementin developing a strategy for nurturing leader candidates, and fordeveloping and implementing its human resources system in linewith Kalbe’s business strategies.Sumber Daya ManusiaHuman ResourcesMengembangkan PemimpinKalbe Masa Depan demiMempertahankan PertumbuhanDeveloping Kalbe’s Future Leaders to SustainGrowth
  • 117. PT Kalbe Farma Tbk. • 2012 Annual Report 115Panca Sradha Kalbe sebagai Budaya KorporatYang MempersatukanSebagai perusahaan yang bergerak di bidang kesehatan, yangmencakup 4 divisi usaha dan terdiri dari 23 entitas usaha sertajumlah karyawan lebih dari 10.000 orang, Perseroan menyadaripentingnya membangun satu nilai korporat untuk mempersatukanseluruh karyawan Kalbe.Pada akhir tahun 2010, Kalbe menetapkan Panca Sradha Kalbesebagai nilai-nilai korporat, yang terdiri dari 5 nilai: saling percaya;kesadaran penuh; inovasi; bertekad menjadi yang terbaik; sertasaling keterkaitan. Sosialisasi yang intensif telah dilaksanakanpada tahun 2011 - 2012 di seluruh organisasi Kalbe. Saat ini,internalisasi Panca Sradha Kalbe masih terus berlangsung melaluiprogram pengembangan SDM, kegiatan-kegiatan kebersamaankaryawan dan aktivitas usaha sehari-hari untuk menjadikan PancaSradha Kalbe sebagai bagian dari cara kerja Perseroan.Panca Sradha Kalbe as a Unifying CorporateCultureAs a a highly diversified healthcare company with businessesspanning across 4 divisions, employing over 10,000 people in 23business entities under the Kalbe Group, it is paramount to ensurethat Kalbe’s employees is unified by a single corporate values,which serves as the identity of the entire Kalbe employees.In late 2010, Kalbe Group formally defined its corporate values,Panca Sradha Kalbe, reflecting five ideas: trust; mindfulness;innovation; striving to be the best; and interconnectedness.Intensive socialization initiatives then followed in 2011 and2012 to communicate Panca Sradha Kalbe values withinKalbe’s entire organization. Today, internalisation efforts haveincreasingly become part of Kalbe’s people development,employee engagement and day-to-day business activities, hencedeveloping into the Company’s way of life.Rp132Jumlah pelatihan yangdilakukan pada tahun 2012Number of trainingsconducted in 201220.6bnBiaya pelatihan tahun 2012Training expense in 2012Selain kegiatan rekrutmen dan pengembangan SDM, Kalbejuga memfokuskan pada terciptanya lingkungan kerja yangpositif serta mendorong para individu untuk hidup secarasehat dan seimbang.On top of attracting and developing talented individuals, Kalbe focuses on building a positiveworking environment and encouraging every individual to adopt a healthy and balanced life.
  • 118. Performance HighlightsManagement ReportCompany ProfileManagement Discussion and AnalysisCorporate GovernanceCorporate Social ResponsibilityPT Kalbe Farma Tbk. • Laporan Tahunan 2012116Menyediakan SDM Kompeten Untuk MendukungKeberlangsungan Pertumbuhan KalbeUntuk menjadi kelompok usaha di bidang kesehatan yangterkemuka di Indonesia dan di kawasan regional, Perseroan terusmembangun lingkungan kerja yang baik dengan menyediakanpeluang karir yang menantang agar setiap individu dapatbertumbuh sesuai dengan potensinya.Guna memenuhi kebutuhan SDM yang berkualitas dan siapbersaing dalam menghadapi perubahan bisnis yang makinkompetitif, Kalbe menerapkan proses seleksi dan rekrutmendengan melibatkan para pimpinan unit kerja dan unit usaha,untuk memastikan agar kompetensi dan karakter kandidat sesuaidengan kebutuhan Perseroan. Untuk menjaga obyektifitas prosesrekrutmen, Perseroan bekerja sama dengan pihak eksternal yangkompeten dalam mengidentifikasi calon-calon potensial melaluiproses penilaian.Untuk mendapatkan kandidat-kandidat yang potensial Kalbebekerjasama dengan universitas di Indonesia dan di luar negerimelalui program rekrutmen kampus dan program magang bagimahasiswa yang kualifikasinya sesuai dengan kebutuhan bisnisKalbe.Pada tahun 2012, Kalbe merekrut karyawan baru untuk mengisiposisi-posisi baru dan mempersiapkan kader organisasi sejalandengan pertumbuhan usaha dan mendukung perkembanganusaha Perseroan yang dinamis di masa mendatang.Dalam mengembangkan SDM nya, Kalbe menerapkan prinsip“Leader creates Leaders”, di mana setiap pemimpin bertanggungjawab mengembangkan calon pemimpin yang kompeten danberkarakter Panca Sradha Kalbe sesuai kebutuhan Perseroan.Prinsip ini diterapkan melalui program pengembangankepemimpinan untuk level Eksekutif yakni Kalbe GeneralManagement Program (KGMP) bekerjasama dengan NationalUniversity of Singapore (NUS) dan level Manajer yakni KalbeMiddle Management Program (KMMP) bekerjasama denganPrasetiya Mulya Business School dengan mensyaratkanpartisipasi aktif atasan langsung, jajaran manajemen dan DireksiKalbe sebagai pembimbing.Kedua program tersebut menggabungkan pembelajaran di dalamkelas selama 10 hari dan penugasan di perusahaan. Untuk KGMPpenugasan dilaksanakan secara grup dengan peserta lintasfungsi/perusahaan selama 6 bulan dan untuk KMMP penugasandilaksanakan secara individu selama 3 bulan. KGMP dan KMMPmasing-masing telah memasuki tahun ke 3 dan ke 2 yang diikutioleh peserta dari berbagai anak perusahaan Kalbe.Providing Talents to Support Kalbe’s SustainableGrowthTo become the premier healthcare group in Indonesia and in theregion, Kalbe needs to build a great working environment withexciting career opportunities, where individuals can grow to theirmaximum potentials.To meet the needs for qualified human resources and to addressincreasing competition, Kalbe runs an effective selection andrecruitment process, involving working units and businessleaders, who take part in ensuring that the competence andcharacter of the candidates are in line with organization needs.To ensure objective recruitment process, the Company workswith competent external parties that provide candidate lists andperform assessments.To source potential candidates, Kalbe work closely with prominentuniversities in Indonesia and overseas through on-campusrecruitment and apprenticeship programs for students who meetthe requirements of Kalbe’s business needs.By the end of 2012, Kalbe recruited new employees, both toreplace talents who had left the Company as well as to fill newpositions created by the Company’s business growth, as wellas supporting the Company’s dynamic business growth in thefuture.On people development, Kalbe adopts “Leader creates Leaders”principle, where every leader must be able to develop competentleader candidates with Panca Sradha Kalbe characters, inaccordance with Company’s requirements.ThisprincipleisevidentinthewayKalbedesigneditstwoleadershipdevelopment programs, namely Kalbe’s General ManagementProgram (KGMP) for Executive level in partnership with NationalUniversity of Singapore and Kalbe Middle Management Program(KMMP) for managerial level delivered in collaboration withPrasetiya Mulya Business School. Both programs require activeparticipation from direct supervisors, management and KalbeBoard of Directors as mentors.These programs combine in-class training session for a 10-day duration and on-the-job assignments. For KGMP, theassignment was conducted collectively through cross-functional/inter-company teams for 6 month duration while for KMMP theassignment was conducted individually for 3 month period. KGMPand KMMP have entered their 3rd and 2nd year respectively,joined by participants from various subsidiaries of Kalbe.
  • 119. PT Kalbe Farma Tbk. • 2012 Annual Report 117Pada tahun 2012, Kalbe telah menyelenggarakan 2 kelas KMMPyang diikuti oleh total 50 peserta dan 1 kelas KGMP yang diikutioleh 18 peserta dengan investasi sebesar Rp 4 miliar.Pada bulan September 2012, Perseroan meresmikan KalbeLearning Centre (KLC) sebagai fasilitas pelatihan teknis dibidang manufaktur farmasi. KLC mempunyai ruang belajar yangdilengkapi dengan ruang simulasi produksi untuk praktik kerjapeserta. Pelatihan yang diselenggarakan berupa pelatihan dasarkompetensi teknis bagi seleksi karyawan baru yang akan menjabatsebagai operator tablet dan teknisi. Metode pembelajarandiberikan selama 1 bulan yang terdiri dari pembelajaran di kelasmengenai pengetahuan dasar produksi beserta simulasinyaselama 2 minggu, dilanjutkan dengan praktik kerja di pabrikselama 2 minggu. Setelah itu peserta akan diuji oleh tim panelisuntuk menentukan kelulusan yang bersangkutan sebagaioperator tablet dan teknisi. Pelatihan ini sudah meluluskan 25orang operator tablet dan 12 orang teknisi maintenance dari totalpeserta pelatihan sebanyak 42 orang.Selain program pelatihan di atas, Perseroan juga memberikankesempatan kepada para karyawan untuk mengikuti programpelatihan manajemen dan teknis yang diselenggarakan olehinstitusi eksternal baik di dalam maupun di luar negeri. Padatahun 2012, Kalbe telah menyelenggarakan sebanyak 132kegiatan pelatihan bagi para karyawan.Sistem Manajemen KalbeSistem Manajemen Kalbe adalah suatu proses sistematisyang mencakup perencanaan, pelaksanaan, pengawasandan pengembangan aktivitas Perseroan pada seluruh levelorganisasi, berlandaskan Panca Sradha Kalbe sebagai nilai-nilaiperusahaan.Proses ini berawal dari pengembangan dan perencanaan strategiPerseroan baik jangka pendek maupun jangka panjang, yangkemudian diturunkan dan dijabarkan menjadi rencana kerjaindividu. Melalui pelaksanaan Sistem Manajemen Kalbe, Perseroanmelibatkan seluruh jenjang organisasi untuk berpartisipasi dariproses formulasi strategi Perseroan hingga menjabarkannyasebagai rencana kerja individu yang mudah dimengerti danditerapkan selaras dengan strategi Perseroan.Perencanaan dan pengawasan yang berkesinambunganmerupakan bagian dari Sistem Manajemen Kalbe untuk memantaukinerja organisasi dan menganalisis penyebab penyimpanganuntuk melakukan langkah perbaikan agar Perseroan bisa terusberkompetisi dengan perubahan dunia usaha yang makin cepatdan kompetitif.In 2012, Kalbe has implemented 2 KMMP classes with a total of50 participants and 1 batch of KGMP with 18 participants with atotal investment of Rp4 billion.In September 2012, the Company inaugurated Kalbe LearningCentre (KLC) as the facility to conduct technical training inpharmaceuticals manufacturing. KLC features class roomsequipped with production simulation room for practical training.Trainings conducted consist of basic competence technicaltraining for new employee selection to be positioned as TabletOperators and Technicians. Learning method applied for 1month comprising 2-week in-class session for production basicknowledge and simulations, followed by practical sessions on-the-job for 2 weeks. Subsequently, participants will be assessedby a panelist team to determine the candidate’s passing as Tabletoperators and technicians. This training has produced 25 tabletoperators and 12 maintenance technicians out of a total of 42participants.Aside from the above training, the Company also providesopportunities for employees to attend management and technicaltraining programs conducted by external institutions, both inIndonesia and abroad. In 2012, Kalbe has conducted 132 trainingfor employees.Kalbe Management SystemKalbe Management System is a systematic process comprisingplanning, implementing, monitoring and improving the Company’sbusiness activities at all levels of organization, based on the spiritof Panca Sradha Kalbe as our corporate values.The process begins with the development and planning of theCompany’s short-term and long-term strategies, which aresubsequently cascaded and elaborated to individual action plans.Through the implementation of Kalbe Management Systems,Kalbe embraces all levels of the organization to participate in theprocess of formulating the Company’s strategies and definingthem down to the individual work plans that would be easilyunderstood and implemented in line with the overall Companystrategies.Continuous planning monitoring are an integral part of KalbeManagement System to monitor the performance of theorganization, analyze the cause of deviations and take correctiveactions to ensure that the Company remains competitive amidstthe dynamic changes and increasing competitiveness of businessenvironment.
  • 120. Performance HighlightsManagement ReportCompany ProfileManagement Discussion and AnalysisCorporate GovernanceCorporate Social ResponsibilityPT Kalbe Farma Tbk. • Laporan Tahunan 2012118Program Continuous Improvement (CONIM), merupakan salahsatu program peningkatan kompetensi organisasi dalam kerangkasistem manajemen Kalbe. Melalui program kompetisi tahunanCONIM, Kalbe berupaya membangun budaya perbaikan yangberkesinambungan di seluruh organisasi dengan memberikanpenghargaan kepada karyawan yang terlibat. Lebih dari 39.000inisiatif CONIM telah dilaksanakan pada tahun 2012, meningkat40% dibandingkan pada tahun 2011 sejumlah 28.000 inisiatif.Inisiatif CONIM CONIM InitiativesNo Inisiatif CONIM 2012 2011 CONIM Initiatives1 SS (Suggestion System) 36,107 26,092 SS (Suggestion System)2 QCC (Quality Control Circle) 251 293 QCC (Quality Control Circle)3 QCP (Quality Control Project) 150 114 QCP (Quality Control Project)4 A3R (A3 Report) 2,762 1,583 A3R (A3 Report)5 PPS (Practical Problem Solving) 410 348 PPS (Practical Problem Solving)Total 39,680 28,430 TotalPrioritas 2013Tahun 2013 Kalbe tetap memprioritaskan pengembangan SDMdengan prinsip “Leader creates Leaders” untuk menyiapkanpemimpin-pemimpin Kalbe di masa depan yang mampubersinergi antar fungsi dan antar unit usaha di dalam Grup Kalbemelalui program pengembangan individu yang terencana, prosescoaching dan counselling serta mentoring dengan melibatkanjajaran manajemen.Selain itu, Perseroan juga terus mencari peluang perbaikan untukmenyempurnakan operasi SDMnya agar dapat memberikanpelayanan yang lebih baik bagi seluruh unit usaha di GrupKalbe.Mendorong Hidup Sehat dan SeimbangPerseroan juga fokus untuk mewujudkan lingkungan kerja yangpositif dengan mendorong karyawan hidup sehat dan seimbangmelalui berbagai kegiatan.Secara rutin Kalbe menyelenggarakan kegiatan olahraga, sosial,dan kesenian untuk membangun solidaritas dan kebersamaanantar karyawan dalam mewujudkan semangat menjadi yangterbaik. Kami telah menyelenggarakan berbagai kompetisitahunan, antara lain Kalbe Futsal Tournament, Kalbe Table TennisTournament, Kalbe Fun Bike serta Lomba Foto Grup Kalbe yangterbuka bagi seluruh karyawan. Sebagai wadah menyalurkanminat, kami telah membentuk berbagai komunitas dengankegiatan rutin seperti Klub Fotografi Grup Kalbe, serta berbagaiaktivitas olahraga. Kalbe juga menyelenggarakan layananpemeriksaan kesehatan gratis bagi karyawan, sebagai wujudkomitmen Perseroan pada kesehatan karyawan.Kalbe’s Continuous Improvement program, or CONIM,is another competence improvement program within theCompany’s management system framework. Through CONIMannual competition event, Kalbe strives to promote a culture ofcontinuous improvement within the organization and recognizesemployees involved in the improvement process. Over 39,000CONIM initiatives were conducted in 2012, up by 40% from over28,000 initiatives in 2011.2013 PrioritiesIn 2013, people development will remain a top priority of thehuman resources development based on the “Leader createsLeaders” principle to nurture future Kalbe business leaders whoare capable of creating cross functional and cross business unitsynergies within Kalbe Group through individual developmentplan, coaching and counselling as well as mentoring by involvingparticipation of the management.Last but not least, the Company will seek opportunities to furtherenhance its human resources operation to better serve the needsof Kalbe’s business units.Promoting a Healthy and Balanced LifeKalbe also focuses on building a positive working environmentand encouraging every individual to adopt a healthy and balancedlife.Sports, social, and art activities are regularly conducted to fostersolidarity and sense of togetherness in creating the passion tobe the best. We conduct various annual competition such asKalbe Futsal Tournament, Kalbe Table Tennis Tournament, KalbeFun Bike for employees as well as Kalbe Group PhotographyCompetition open to all Kalbe Group employees. As a forum foremployees to develop their interests, we form communities withregular activities such as Kalbe Group Photography Club, andvarious sports activities. Kalbe also organizes annual free medicalcheck up service for employees, underscoring the Company’scommitment to the well being of its people.
  • 121. PT Kalbe Farma Tbk. • 2012 Annual Report 119Melalui program Kalbe Berbagi, Kalbe mengundang segenapkaryawan untuk membangun rasa tanggung jawab sosial melaluipartisipasi di bidang pendidikan, kesehatan, perlindunganlingkungan dan pengembangan sarana. Sepanjang tahun 2012,Kalbe Berbagi melibatkan lebih dari 2.350 relawan Kalbe dariseluruh unit usaha.Kalbe juga menyediakan fasilitas intranet www.kalbefamily.comsebagai media untuk menyampaikan informasi terkini kegiatansemua unit usaha dalam Grup Kalbe dan berbagi informasi antarkaryawan untuk mendorong rasa kebersamaan dan iklim kerjayang positif di dalam organisasi.Finally, Kalbe invites employees to develop their sense of socialresponsibility through participation in Kalbe Berbagi’s education,healthcare, environmental protection and infrastructuredevelopment programs. In 2012, Kalbe Berbagi succeeded inattracting over 2,350 Kalbe volunteers from the entire Group.Kalbe’s intranet, www.kalbefamily.com serves as an effectivemedia for internal activity updates in Kalbe Group and forinformation sharing among employees, thereby promoting senseof togetherness and positive working climate within the entireorganization.7,1366,960Staf danNon StafStaff andNon Staff1,2251,00518 ≤ 25tahun18 ≤ 25years84> 55 tahun> 55 years80179246 ≤ 55tahun46 ≤ 55years2,8932,78936 ≤ 45tahun36 ≤ 45years5,1035,17626 ≤ 35tahun26 ≤ 35years10,0309,766TetapPermanent5,0247,670TidakTetapNonPermanent2,1622,075Officer/SupervisorOfficer/Supervisor631625ManajerManager106101JajaranEksekutifExecutiveStatistik Karyawan Berdasarkan GolonganEmployee Statistics by PositionStatistik Karyawan Berdasarkan UsiaEmployee Statistics by AgeStatistik Karyawan Berdasarkan StatusEmployee Statistics by Status6482SDElementarySchool138176SMPJuniorHighSchool3,8823,727SMASeniorHighSchool1,8241,723DiplomaDiploma3,9253,454S1Undergraduate191593S2PostGraduate611S3DoctorateStatistik Karyawan Berdasarkan PendidikanEmployee Statistics by Education20122011
  • 122. Performance HighlightsManagement ReportCompany ProfileManagement Discussion and AnalysisCorporate GovernanceCorporate Social ResponsibilityPT Kalbe Farma Tbk. • Laporan Tahunan 2012120Sharing Session 2012 2012 Sharing SessionsNo.TanggalDateProgramPembicaraSpeakerKeteranganNoteLokasiLocationCorporate Audit and Risk Management1 May 14 Control Assurance RSM AAJ Associates External Dankos Farma, Jakarta2 May 14 Motivation and Refreshment Gobind Vashdev External Dankos Farma, Jakarta3 August 13 Fraud AuditBagus D. Reksojoedo SH, M.H,ComExternal EPMT, Jakarta4 September 25Pernyataan Standar AkuntansiKeuangan (PSAK) 46 (Revisi 2010) -Pajak PenghasilanStatements of Financial AccountingStandard (SFAS) 46 (2010 Revision) -Income TaxIrawaty Halim, Meita Gunawan Internal Kalbe Farma, Jakarta5 October 18Aktivitas Sales ManagementSales Management ActivitiesAgus Supriyanto Internal Kalbe Farma, Jakarta6 October 30Marketing EffectivenessMeasurementSimon Jonathan Internal Bintang Toedjoe, JakartaCorporate Regulatory Affairs7 April 16Business Development Forum (FoodSupplement Regulation)Metty Susanti Internal Sanghiang Perkasa, Jakarta8 July 20Consumer Health Forum ExternalEnvironmentSie Djohan, Nurul Yusuf, MettySusanti, Mimi Yosiani, VirenaOzoraInternal Bintang Toedjoe, Jakarta9 December 21 Regulatory ForumSie Djohan, Nurul Yusuf, MettySusanti, Mimi Yosiani, VirenaOzoraInternal Kalbe Farma, JakartaCorporate Finance, Accounting, Tax, & Treasury13 February 3 Sosialisasi Matrix RoleVidjongtius, Bernadus KarminWinataInternal Kalbe Farma, Jakarta14 June 19 Effective Budgeting Thomas H. Secokusumo External Bintang Toedjoe, Jakarta15 July 23-24 Transfer Pricing Documentation Danny Darussalam External EPMT, Jakarta16 December 19 Personal Financial Planner Ligwina Hananto ExternalHotel Harris Kelapa Gading,JakartaCorporate Management System & Business Unit / Corporate Function17 January 12 Management System (MS) Forum I Sie Djohan, F. X. Widiyatmo Internal Bintang Toedjoe, Jakarta18 February 9 Management System (MS) Forum II Ongkie Tedjasurja Internal Bintang Toedjoe, Jakarta19 March 8 Management System (MS) Forum III Julian Foe External Bintang Toedjoe, Jakarta20 April 12 Management System (MS) Forum IV Budi Dharma Wreksoatmodjo Internal EPMT, Jakarta21 May 10 Management System (MS) Forum V Yuni Herawati Internal Sanghiang Perkasa, Jakarta22 June 14 Management System (MS) Forum VI Department Heads Internal Bintang Toedjoe, Jakarta23 July 20 Management System (MS) Forum VII Vidjongtius Internal Dankos Farma, Jakarta24 September 12 Management System (MS) Forum IX Simon Jonatan Internal Bintang Toedjoe, Jakarta25 December 12 Management System (MS) Forum X Johanes Berchman Apik Ibrahim Internal Bintang Toedjoe, JakartaCorporate Business Development26 January 20 Business Development (BD) Forum Luh Putu Chandra Astiti Internal Kalbe Farma, Jakarta27 March 9 Healthcare Outlook 2012 F. X. Widiyatmo Internal Kalbe Farma, Jakarta28 April 16 Business Development (BD) Forum Yuliana, Metty Susanti Internal Sanghiang Perkasa, Jakarta29 May 15 Business Development (BD) Forum Agnes Febrita Internal Kalbe Farma, Jakarta30 June 7 Consumer Trends Yongky Susilo External Bintang Toedjoe, Jakarta31 July 26 Consumer Insights Amalia Indri Internal Kalbe Farma, Jakarta32 August 8 Business Development (BD) ForumYuniar Linda, Yvone Astri, AuliaDian PermanaInternal Kalbe Farma, Jakarta33 December 11 ASEAN market Anand Srinivasan External Kalbe Farma, Jakarta
  • 123. PT Kalbe Farma Tbk. • 2012 Annual Report 121Pelatihan Umum 2012 2012 Public TrainingsNo.TanggalDateProgramPenyelenggaraInstitutionLokasiLocationKompetensi KepemimpinanLeadership Competence1February 11 -March 31Advanced Fundamental LeadershipProgramDale Carnegie Jakarta2 March 20 Leadership for Asia GML Performance Consulting Jakarta3 March 202012 Human Capital LeadershipConferenceBinus Business School Jakarta4December12-14Effective Supervisory Management PPM Manajemen JakartaKompetensi FungsionalFunctional Competence1 January 17-18Pemahaman Beberapa PSAK Penting 2011– 2012Understanding Important SFAS 2011-2012RSM AAJ Associates Jakarta2January 17 -April 12International Purchasing and Supply ChainManagement AdvancePrasetiya Mulya Jakarta3 January 25-26Laporan Keuangan Berstandar Internasional(IFRS) & Dampaknya Terhadap PerpajakanInternational Financial Reporting Standards(IFRS) and Its Impacts to TaxationKharisma Mitra Training Jakarta4 January 30-31Menulis Laporan Internal Audit Yang EfektifEffective Internal Audit Report WritingYayasan Pendidikan Internal Audit (YPIA) Jakarta5 February 1-2 Finance For Legal & LawyerLegal Business Institute Research andDevelopmentJakarta6 February 13-14 IFRS 1 Formasi Jakarta7 February 14-17 Fraud Auditing 1 Lembaga Pengembangan Fraud Auditing Jakarta8 February 15Solusi Atas Dampak Pelaksanaan Buku TarifKepabeanan Indonesia (BTKI) 2012 TerkaitLartas (Larangan dan Pembatasan)Solutions of the Impacts of theImplementation of 2012 Book of Indonesia’sCustom Tarriffs (BTKI) on Prohibition andLimitationKamar Dagang dan Industri DKI Jakarta Jakarta9 February 21-23Finon - Financial Management for NonFinance ManagerPrasetiya Mulya Jakarta10 February 22-23 Tax Planning Formasi Jakarta11 February 27-28International Conference On BiomedicalScience 2012Institut Teknologi Bandung Bandung12 March 6-7 Procurement Progress & Order Monitoring BMI (Bina Manajemen Indonesia) Training Jakarta13 March 7-8Kepabeanan dan Perpajakan DalamTransaksi Ekspor Impor Khusus KawasanBerikat (Bonded Zone)Customs and Taxation in Export-ImportTransaction in Bonded ZoneBMI (Bina Manajemen Indonesia) Training Jakarta14 March 9Delivering Happines - A Path To Profits(Sharing Experiences from Halo BCA inBuilding Reputable Services)PQM Consultants Jakarta15 March 5-9 IT Project Management Iverson Technology Jakarta16 March 14Training CGAP (General Affairs ProfesionalCertification)Human Resource Management Indonesia Jakarta17 March 15Studi Kasus Penghitungan PPH Pasal 21Masa 2012 dengan ExcelCase Study of Income Tax Article 21Calculation for 2012 using ExcelIkatan Konsultan Pajak Indonesia Tax Training Jakarta18 March 15 Value Stream Maping PQM Consultants Jakarta19 March 17-18Teknik Fotografi Kelas BasicBasic Photograph TechniquesDarwis Triadi Jakarta20 March 19-21 IT Infrastucture Library V.3.0 Iverson Technology Jakarta21 March 20 Leadership for Asia GML Performance Consulting Jakarta
  • 124. Performance HighlightsManagement ReportCompany ProfileManagement Discussion and AnalysisCorporate GovernanceCorporate Social ResponsibilityPT Kalbe Farma Tbk. • Laporan Tahunan 2012122Pelatihan Umum 2012 2012 Public TrainingsNo.TanggalDateProgramPenyelenggaraInstitutionLokasiLocation22 March 26Diklat Ahli KepabeananEducation and Training of CustomsLembaga Pendidikan dan Pelatihan Jakarta23 March 26-27 Enterprise Business Process Management Enterprise Architecture Service Jakarta24 March 27-28 Best Practice in Fixed Asset Accounting Kharisma Mitra Training Jakarta25 March 27-29 Supply Chain Management PPM Manajemen Jakarta26 April 11Program Kesehatan Karyawan PascaPelaksanaan Kesehatan SJSN (SistemJaminan Sosial Nasional) 1 Jan 2014Employee Health Benefit Post SJSN(National Social Security System)Commencement Jan 1, 2014CPE Indonesia Jakarta27 April 16-20 Oracle 10g : Administration Workshop 1 Iverson Technology Jakarta28 April 17-19Finon - Financial Management for NonFinance ManagerPrasetiya Mulya Jakarta29 April 18-19Indonesian Supply Chain ManagementSummit 2012 (ISCM 2012)Intipesan Jakarta30 April 24-26Seminar Nasional Internal Audit 2012National Seminar of Internal Audit 2012Yayasan Pendidikan Internal Audit (YPIA) Jakarta31 May 9-10Powerful Business Communication &Presentation Skills360 BSI Jakarta32 May 10Improve Productivity, Quality, andCompetencies for Corporate performanceImprovementIndonesia Productivity & Quality Institute(IPQI)Jakarta33 May 7-16Audit OperasionalOperational AuditPusat Pengembangan Akuntasi danKeuangan (PPAK)Sukabumi34 June 16-17Ujian Sertifikasi PajakTax CertificationIKPI (Ikatan Konsultan Pajak Indonesia) Jakarta35 June 13, 20, 21Indonesia Tax Court System Reformation :Improving the Settlement of Tax Dispute inthe Stage of Objection and AppealStudi Profesionalisme Akuntan (SPA) -Fakultas Ekonomi Universitas Indonesia(FEUI)Jakarta36 June 18-29Pelatihan Tingkat Dasar II - SertifikasiQualified Internal Auditor (QIA)Basic Training II - Qualified Internal Auditor(QIA)Yayasan Pendidikan Internal Audit (YPIA) Jakarta37 June 25-29Seminar dan Pengukuhan ProfessionalInternal Auditor (PIA)Seminar and Inauguration of ProfessionalInternal Auditor (PIA)Pusat Pengembangan Akuntasi danKeuangan (PPAK)Batam38 June 27-28Responding to Risks Effectively with KeyRisk IndicatorsRisk Workshop International Bali39 June 28Pembahasan PP No. 47 Tahun 2012 tentangTanggung Jawab Sosial dan LingkunganPerseroan TerbatasDiscussion of Government RegulationNo. 47 Yeaar 2012 on Corporate SocialResponsibilityLKDI (Lembaga Komisaris dan DirekturIndonesia)Jakarta40 July 5-6Seminar Jaminan Kesehatan NasionalSeminar of National Health SecurityPuri Communications Bali41 July 7 Workshop Microsoft SQL Server 2012 ASABA/ PT. Microsoft Indonesia Jakarta42 July 26Seminar Outsourcing IndonesiaSeminar of Indonesia’s OutsourcingPT Mitra Kelola Insani Jakarta43 August 28-31 Great Trainer in Action HR Excellency Jakarta44 August 30-31Metode & Teknik Penyusunan StandardOperating Procedure (SOP)Methods and Techniques of StandardOperating Procedure (SOP) DevelopmentTempo Jakarta45 September 3 Public Hearing Ikatan Akuntan Indonesia (IAI) Jakarta
  • 125. PT Kalbe Farma Tbk. • 2012 Annual Report 123Pelatihan Umum 2012 2012 Public TrainingsNo.TanggalDateProgramPenyelenggaraInstitutionLokasiLocation46September13-14Teknik Wawancara & PermintaanKeteranganTechniques of Interview and Data RequestLembaga Pengembangan Fraud Audit Jakarta47 September 18Mudah menghitung Gaji 2013:Menyongsong Penyesuaian Gaji 2013Sehubungan dengan Kenaikan UMP/UMKPayroll Made Easy 2013:Anticipating 2013 Salary Adjustment withRegards to the Increase of Minimum WagesPPM Manajemen Jakarta48 September 18 Your Journey To High Performance AON Hewitt Jakarta49 October 3-4Microsoft Excel 2007 (intermediate-Advance)ASABA / PT. Microsoft Indonesia Jakarta50 October 4-5Teknik dan Metode Penyusunan SOPTechniques and Methods of SOPDevelopmentSigma Conferences Jakarta51 October 1717 CEOs Andressing 8 Challenges Towardsa Better IndonesiaGML Performance Consulting Jakarta52 October 18 Building Business Acumen Dunamis Jakarta53 October 23-24 The Real CSR Intipesan Jakarta54 October 29-31Financial Modeling for Mergers andAcquisitionCoreventus (M) Sdn. Bhd. Jakarta55October 31 -November 2Project Management PPM Manajemen Jakarta56 November 3-17Brevet PajakTax CertificationIkatan Konsultan Pajak Indonesia (IKPI) Jakarta57 November 4-6 2012 ACFE Asia-Pacific Fraud ConferenceAssociation of Certified Fraud Examiners(ACFE)Hongkong58 November 20Alphaterra Digital Marketing Conference2012Majalah Marketing Jakarta59November20-21Penyusunan Annual Report Berbasis GCGdan CSRDrafting Annual Report with GCG and CSRBasisLex Mundus Jakarta60November21-22The 360oCommunication Summit 2012 MarComm Institute Jakarta61November21-22Building Management Intipesan Jakarta62November24-25Ujian Sertifikasi PajakTax CertificationIkatan Konsultan Pajak Indonesia (IKPI) Jakarta63November 26 -December 13Certified Internal Auditor (CIA) ReviewCourseYayasan Pendidikan Internal Audit (YPIA) Jakarta64 December 3-14Audit Internal Tingkat Lanjutan 1Advanced Internal Audit 1Yayasan Pendidikan Internal Audit (YPIA) Jakarta65 December 3-8Pelatihan Persiapan Uji KompetensiSertifikasi Certified Risk ManagementProfessional (CRMP) dan Ujian SertifikasiCertified Risk Management Professional(CRMP)Training of Certified Risk ManagementProfessional (CRMP) and Certified RiskManagement Professional (CRMP)LSPMR (Lembaga Sertifikasi ProfesiManajemen Risiko)Jakarta66December10-19Komunikasi dan Psikolog AuditCommunication and Psychology AuditPusat Pengembangan Akuntasi danKeuangan (PPAK)Sukabumi67December10-20Diklat Dasar-Dasar AuditEducation and Training of Basic AuditPusat Pengembangan Akuntasi danKeuangan (PPAK)Sukabumi68December11-13Project Management PPM Manajemen Jakarta
  • 126. Performance HighlightsManagement ReportCompany ProfileManagement Discussion and AnalysisCorporate GovernanceCorporate Social ResponsibilityPT Kalbe Farma Tbk. • Laporan Tahunan 2012124Pelatihan In-House 2012 2012 In-house TrainingNo.TanggalDateProgramPenyelenggaraInstitutionLokasiLocationKompetensi KepemimpinanLeadership Competence1 February 27Closing Kalbe Middle Management Program(KMMP) 2Prasetiya Mulya Jakarta2February 29 -March 01Final Project Presentation - Kalbe NUS NUS Business School Jakarta3 April 09-20 KMMP 3 Prasetiya Mulya Jakarta4April 30 - May11General Management Program NUS Business School Jakarta5 August 8-10 Project Presentation - KMMP 3 Prasetiya Mulya Jakarta6 August 14 Panel Presentation - KMMP 3 Prasetiya Mulya Jakarta7 August 16 Closing KMMP 3 Prasetiya Mulya Jakarta8 October 01-12 KMMP 4 Prasetiya Mulya JakartaKompetensi FungsionalFunctional Competence1 October 16Southeast Asia Pharma MarketOpportunitiesIMS Health Jakarta2 August 06Pandangan dan Analisis MakroekonomiIndonesiaIndonesia’s Macroeconomic View andAnalysisAviliani, S. E., M.Si (Economist at the Institutefor Development of Economics and Finance)Jakarta3 December 12 Kalbe Service Excellence Internal JakartaPelatihan Umum 2012 2012 Public TrainingsNo.TanggalDateProgramPenyelenggaraInstitutionLokasiLocation69December27-28Permenakertrans No. 19 Tahun 2012tentang OutsourcingRegulation of Ministry of Manpower andTransmigrations No. 19 Year 2012 onOutsourcingLAPKINDO (Lembaga Pemerhati Kinerja InsanIndonesia)JakartaKompetensi DasarBasic Competence1January 28 -March 17Conversation Club In English II English First Jakarta2 April 17-18Seni Berpikir Sistem dan AntisipatifThe Art of Systemic and AnticipativeThinkingPPM Manajemen Jakarta3 April 19 Achievement Motivation Training Potentia Institute Jakarta4April 30 -May 4Problem Solving and Decision Making PPM Manajemen Jakarta5 October 15-19 Problem Solving and Decision Making PPM Manajemen Jakarta6November21-23The 7 Habits of Highly Effective People -Signature ProgramDunamis Puncak
  • 127. PT Kalbe Farma Tbk. • 2012 Annual Report 125Pelatihan In-House 2012 2012 In-house TrainingNo.TanggalDateProgramPenyelenggaraInstitutionLokasiLocationKompetensi DasarBasic Competence1February 28 -March 02Coaching & Counseling Effectiveness (CCE) People Sight Jakarta2 March 16Training Juri CONIMCONIM’s Judge TrainingWahana Kendali Mutu Jakarta3 March 20 CONIM A3 Report GPI Jakarta4 March 28-29 New Employee Orientation Program (NEOP) Internal Jakarta5 April 11 Workshop 1 : A3 Report GPI Jakarta6 April 25 Workshop 2 : A3 Report GPI Jakarta7 May 2-3Delapan Langkah Tujuh Alat ( DELTA )Eight Steps Seven ToolsInternal Jakarta8 May 20-21 Training Practical Problem Solving ( PPS ) First Asia Consultants Jakarta10 May 30 Workshop 3 : A3 Report GPI Jakarta11 June 8 Workshop 1 : PPS First Asia Consultants Jakarta12 June 22 Workshop 2 : PPS First Asia Consultants Jakarta13 June 5-7 Personal Effectiveness Program (PEP) Internal Sukabumi14 June 13-15Persiapan PensiunPre-retirement PreparationStandar Plus Bandung15 July 16 & 18 Maximum Presentation Skill HeartSpeaks Jakarta16 August 6 LeadershipDr. Ir. Handry Satriago, M.M., M.B.A.(President and CEO, GE Indonesia)Jakarta17 September 19 Facilitation Skill QQ Jakarta18September26-28New Employee Orientation Program (NEOP) Internal Jakarta19 October 16-18 Personal Effectiveness Program (PEP) Internal Sentul20 October 23-24 Emotional Quality Management HR Excellency Bogor
  • 128. Performance HighlightsManagement ReportCompany ProfileManagement Discussion and AnalysisCorporate GovernanceCorporate Social ResponsibilityPT Kalbe Farma Tbk. • Laporan Tahunan 2012126Tinjauan OperasionalOperational ReviewTeknologi informasi dan komunikasi makin memegang peranyang strategis bagi Kalbe. Teknologi Informasi (TI) tidak sajamemberikan dukungan bagi operasi internal Perseroan, tetapijuga makin menjadi elemen penting untuk memperkokoh posisipersaingan Kalbe.Distribusi dan logistik merupakan faktor yang sangat penting untukmendukung keberhasilan Kalbe sebagai pemain sektor produkkonsumen kesehatan. Untuk memberikan pelayanan terbaik danmemimpinpersaingan,DivisiDistribusidanLogistikterusberupayameningkatkan efektivitas pengiriman, penjualan, penagihandan efisiensi biaya operasional. Kami berusaha meningkatkanteknologiinformasiuntukmengikutiperkembanganteknologiyangterus berubah dan tetap berada terdepan. Kami menggunakanaplikasi Oracle E-Business Solution yang tersentralisasi, suatuaplikasi teknologi informasi terintegrasi yang memberikan datareal-time dari dan kepada cabang distribusi. Distribusi kami jugamenggunakan sistem Enterprise Resource Planning (ERP) kelasTheroleofinformationandcommunicationtechnologyisbecomingmore strategically important for Kalbe. Information Technology(IT) does not only play an important role in accommodating theneeds of the Company’s internal operation, but is increasinglybecoming a critical component to strengthen Kalbe’s positionagainst competitors.Distribution and logistics is crucial to Kalbe’s success as aconsumer health player. To provide the best service and stay at theforefront of the competition, our Distribution and Logistics Divisionaspires to improve the effectiveness in delivery, sales, billingand operating cost efficiency. We strive to continue upgradingour information technology to keep up with the fast-changingtechnology and stay ahead of the competition. We utilize acentralized Oracle E-Business Solution application, an integratedinformation technology system that allows real-time data fromand to the distribution branches. Our distribution uses world-class Enterprise Resource Planning (ERP) system from Oracle forwarehouse management system and supply chain planning. TheTeknologi InformasiInformation TechnologyMengandalkan Teknologi Terkiniuntuk Meningkatkan Daya SaingRelying on State-of-the Art Technology to IncreaseCompetitiveness
  • 129. PT Kalbe Farma Tbk. • 2012 Annual Report 127dunia dari Oracle untuk kebutuhan sistem pengelolaan gudangdan perencanaan rantai pasokan. Sistem pengelolaan gudangtelah menggunakan sistem bar-code dengan pembaca bar-codemobile untuk menghilangkan duplikasi dan meningkatkan akurasioperasi. Tim penjualan kami dilengkapi dengan aplikasi mobilePDA untuk mendukung pencatatan pesanan dan proses informasiyang lebih cepat. Kami menggunakan sistem PDA e-mobile untukmendukung aktivitas tim penjualan, petugas pengantar dankolektor, sehingga memungkinkan informasi dan proses yanglebih cepat dan akurat.Kegiatan teknologi informasi Kalbe berada di bawah pengawasanunit TI Korporat Perseroan. Unit tersebut bertanggung jawabmenetapkan strategi jangka panjang, cetak biru serta prioritasinvestasi dan pengembangan teknologi informasi Kalbe.Di bawah unit TI Korporat, terdapat 5 fungsi, yakni fungsi-fungsiSistem Informasi, Manajemen Informasi, Infrastruktur & OperasiTI, Dukungan & Layanan TI, serta fungsi Arsitektur TI.warehouse management system uses bar-coding system withmobile bar-code readers to eliminate duplication and increaseoperation accuracy. Our sales force is equipped with mobileapplication (PDA) to allow faster order taking and informationprocessing time. We utilize e-mobile PDA system to support theactivities of our sales force, deliverymen and collectors, allowingfaster and more accurate process and information.Kalbe’s information technology activities are governed throughthe Company’s Corporate IT unit. This unit determines Kalbe’slong term strategy, blue print as well as information technologyinvestment and development priorities.There are 5 functions reporting to the Corporate IT unit, namely theInformation Systems, Information Management, IT Infrastructure &Operations, IT Support & Services, and IT Architecture functions.Upaya berkelanjutan telah dilaksanakan di 2012 untukmeningkatkan kinerja platform teknologi Kalbe di levelkorporat dan unit usaha, melalui penyederhanaan prosesbisnis dan konsolidasi infrastruktur agar dapat menyajikaninformasi terintegrasi, akurat dan tepat waktu.Ongoing efforts continued during 2012 to improve the performance of Kalbe’s technologyplatform at the corporate and business unit levels, through business process reengineeringand infrastructure consolidation to deliver well integrated, accurate and timely information.2,500Jumlah perangkat PDA yangdigunakan oleh tim salesman,petugas pengiriman danpetugas penagihanNumber of PDA used bysalesmen, deliverymen andcollectors116Cabang dan kantor terhubungdengan jaringanBranches and officesconnected by network
  • 130. Performance HighlightsManagement ReportCompany ProfileManagement Discussion and AnalysisCorporate GovernanceCorporate Social ResponsibilityPT Kalbe Farma Tbk. • Laporan Tahunan 2012128Fungsi Sistem Informasi bertanggung jawab atas pengelolaanaplikasi bisnis Perseroan di bidang perencanaan, keuangan,manufaktur, distribusi dan ritel, sedangkan fungsi ManajemenInformasi bertanggung jawab atas pengelolaan data bisnisuntuk mendukung proses analisis, pelaporan dan pengambilankeputusan. Fungsi Infrastruktur & Operasi TI bertanggung jawabatas seluruh fasilitas dan infrastruktur TI Grup Kalbe, sedangkanfungsi Dukungan & Layanan TI memberikan layanan dukunganbagi para pengguna TI Kalbe. Akhirnya, fungsi Arsitektur TIbertugas menyiapkan dan menyempurnakan kebijakan, prosedurdan standar TI Perseroan, serta bertanggung jawab ataspenyiapan anggaran TI.Pencapaian Penting 2012Sejalan dengan makin meningkatnya ketergantungan Kalbe atasdukungan teknologi informasi, Perseroan wajib memastikanbahwa Kalbe memiliki landasan teknologi dengan tingkatkehandalan, keamanan dan kehandalan yang dibutuhkan.Sejak tahun 2008, Kalbe telah membangun dan mengoperasikanfasilitas Data Center ramah lingkungan untuk memastikan aksesinformasi yang efektif dan aman. Kalbe juga memiliki fasilitas DataRecovery Center di Cikarang agar lebih dapat mengelola potensirisiko jika terjadi gangguan pada sistem informasi Perseroan.Berbagai upaya berkelanjutan telah dilaksanakan di 2012 untukmeningkatkan kinerja platform teknologi Kalbe baik di levelkorporat maupun unit usaha, antara lain melalui penyederhanaanproses bisnis dan konsolidasi infrastruktur agar dapat menyajikaninformasi terintegrasi, akurat dan tepat waktu.Di bulan Juli 2012, Kalbe telah menyelesaikan implementasisistem terintegrasi Oracle E-Business Suite untuk mendukungDivisi Obat Resep di Cikarang. Situs korporat, www.kalbe.co.id,telah disempurnakan dan diluncurkan di November 2012, yangkini menawarkan kemudahan akses berita terkini, kinerja daninformasi lainnya yang berkaitan dengan Perseroan.Berbagai aplikasi strategis lainnya yang telah diluncurkan antaralain adalah versi baru www.kalbestore.com yang menawarkanproses operasi yang lebih efisien, aplikasi Kalbe Medical Portal(www.kalbemedical.org) yang telah disempurnakan, sertapeluncuran situs-situs komunitas yang memanfaatkan teknologijejaring sosial (social media) yang populer guna membanguninteraksi yang lebih erat dengan konsumen. Akhirnya, tahun 2012juga ditandai dengan peresmian Kalbe Family Portal, sebuahaplikasi baru untuk mendukung komunikasi internal dalam GrupKalbe.The Information Systems function is responsible for managingKalbe’s business applications in planning, finance, manufacturing,distribution, dan retail, while the Information Managementfunction is tasked with the management of business data tosupport business users’ analysis, reporting and decision makingprocesses. IT Infrastructure & Operations function is in chargeof Kalbe Group’s entire IT facility and infrastructure, while theIT Support & Services function offers supports to Kalbe’s ITusers. Finally, the IT Architecture function is responsible for thepreparation and enhancement of the Company’s IT policies,procedures and standardization, as well as in charge of preparingIT related budgeting activities.Key Achievements 2012Along with Kalbe’s increasing dependence on informationtechnology support, the Company must ensure that it operates arobust technology backbone with the level of system resilience,security and reliability that the Company requires.Since 2008, Kalbe has built and operated its environmentallyfriendly Data Center that guarantees effective and secured accessto crucial information. A Data Recovery Center facility in Cikarangis also already in place to better manage risks arising from anypossible technology disruptions.Ongoingeffortscontinuedduring2012toimprovetheperformanceof Kalbe’s technology platform at the corporate and business unitlevels, through business process reengineering and infrastructureconsolidation to deliver well integrated, accurate and timelyinformation.In July 2012, Kalbe has completed the implementation of itsOracle E-Business Suite integrated system to support thePrescription Pharmaceuticals Division in Cikarang. An improvedcorporate web site, www.kalbe.co.id, was introduced in November2012, offering a more convenient access to up-to-date news,business performance and other important information about theCompany.Other strategic applications presented during the year includes anenhanced version of www.kalbestore.com with more streamlinedoperational process, a more robust Kalbe Medical Portal (www.kalbemedical.org), and the launching of community sites usingpopular social media technology to build closer relationshipswith consumers. Finally, 2012 was also marked with the officiallaunching of Kalbe Family Portal, a new application to promoteinternal communications within the Kalbe Group.
  • 131. PT Kalbe Farma Tbk. • 2012 Annual Report 129Prioritas 2013Sejalan dengan pertumbuhan usaha kami, kami menilai perlunyamengintegrasikan sistem teknologi informasi dengan platformyang sama. Oracle e-Business Suite telah diimplementasikanpada Divisi Distribusi dan Logistik serta Divisi Nutrisi. Memasukitahun2013untukbeberapatahunberikutnya,penerapanteknologiinformasi akan difokuskan pada pemanfaatan Oracle e-BusinessSuite untuk konsolidasi proses bisnis di lokasi fasilitas produksipada Divisi Obat Resep. Selanjutnya, kami akan melanjutkanintegrasi untuk mencakup Divisi Produk Konsumen.Berbagai inisiatif lain juga akan dijalankan, antara lain dalamhal meningkatkan pemanfaatan teknologi dalam pengolahandata untuk kebutuhan analisis, pelaporan dan pengambilankeputusan bisnis serta optimalisasi pemanfaatan data centeruntuk mendukung kebutuhan teknologi informasi bagi bisnisunit Grup Kalbe. Kami juga akan menjajaki peluang pemanfaatantrend teknologi baru, seperti teknologi komputasi awan (cloudcomputing), teknologi yang berhubungan dengan perangkatmobile (smartphone, tablet) dan jejaring sosial guna mendukungkegiatan pemasaran dan edukasi konsumen. Kemudahan dankeamananaksesteknologiinformasikorporasi,perbaikanprosedurdisaster recovery serta penyempurnaan dan penyelarasanarsitektur kebijakan tata kelola teknologi informasi sebagai bagiantak terpisahkan dari praktik GCG Kalbe akan terus menjadi fokusupaya pengembangan ke depan. Pada akhirnya, kami akan terusmengoptimalkan pemanfaatan teknologi informasi terkini untukmendukung aktivitas operasional Perseroan dalam menciptakankeunggulan dan memimpin persaingan.2013 PrioritiesAs our business continued to grow, we saw the need to integrateour information technology to use the same platform. Oraclee-Business Suite has been implemented in the Distributionand Logistics and Nutritionals Divisions, and last year hasbeen expanded to cover the Prescription Pharmaceuticals inCikarang. Entering 2013 for the next few years, informationtechnology development will focus on using Oracle e-BusinessSuite to consolidate the Prescription Pharmaceuticals’ businessprocesses at the production facilities. Subsequently, we willcontinue the integration to cover the Consumer Health Division.Several initiatives will be underway, including to improve theutilization of technology in data processing for analytical purposes,reporting and business decision making, as well as to optimizedata center utilization to support Kalbe Group informationtechnology needs. We will also explore opportunities to utilizenew technology such as cloud computing, mobile devices relatedtechnology (smartphone, tablet) and social media to supportmarketing and consumer education. Convenience and securityof corporate information technology access, disaster recoveryenhancements and the refinement and alignment of informationtechnology governance processes as an inseparable componentof Kalbe’s corporate-wide good corporate governance practiceswill continue to be the focus of future development. Finally, we willcontinue to leverage on state-of-the-art technology to supportthe operational activities of the Company to ensure the distinctiveedge to win competition.
  • 132. Performance HighlightsManagement ReportCompany ProfileManagement Discussion and AnalysisCorporate GovernanceCorporate Social ResponsibilityPT Kalbe Farma Tbk. • Laporan Tahunan 2012130Tinjauan OperasionalOperational ReviewKegiatan pemasaran senantiasa menjadi bagian penting dariaktivitas usaha Kalbe. Sebagai bagian dari upaya kami untukmemperkuat lini pemasaran, pada tahun 2012 kami membentukCorporate Marketing Office (CMO) dengan tujuan utamamengintegrasikan seluruh kegiatan pemasaran Grup Kalbe untukmeningkatkan baik efektivitas maupun efisiensi pemasaran. CMObertanggung jawab mengelola seluruh kegiatan pemasaran GrupKalbe secara tersentralisasi.Di bawah koordinasi CMO, Kalbe melanjutkan inisiatif CorporateBranding di tahun 2012, dengan menampilkan logo korporat padakemasan seluruh produk Kalbe, serta menampilkan logo dan jingleiklan di setiap iklan TV produk Kalbe. Inisiatif corporate brandingtelah mulai menghasilkan peningkatan brand awareness sertamenempatkan brand Kalbe sebagai produk kesehatan berkualitastinggi yang terpercaya. Untuk mengantisipasi pelaksanaanjaminan kesehatan nasional tahun 2014, keberhasilan ini akansangat bermanfaat bagi produk-produk generik tanpa merekMarketing activities have always been an important part ofKalbe’s business activities. As part of our efforts to strengthen ourmarketing line, in 2012 we established the Corporate MarketingOffice(CMO)aimedatintegratingtheentireKalbeGroupmarketingactivities to improve its effectiveness and efficiency. The CMO isresponsible for managing the Group’s entire marketing activitieson a centralized basis.Under the coordination of CMO, Kalbe continued the CorporateBranding initiative in 2012 by putting Kalbe’s corporate logoon all product packagings as well as by flashing the logo andbroadcasting Kalbe’s tune in all TV ads. Kalbe’s corporatebranding initiatives have started to generate higher consumerbrand awareness and associate the brand with high quality andwell trusted healthcare products. In anticipation of national healthinsurance implementation in 2014, this result is also expectedto benefit the Company’s unbranded generic products, byPemasaranMarketingHadir Semakin Dekat untukMenjangkau KehidupanMasyarakatMoving Closer to Touch People’s Lives
  • 133. PT Kalbe Farma Tbk. • 2012 Annual Report 131Perseroan, dengan menempatkan produk tanpa merek Kalbesebagai produk berkualitas dari perusahaan yang terpercaya.Melalui pendekatan sentralisasi, diharapkan juga terciptanyaupaya pemasaran yang lebih fokus dan terkoordinasi di seluruhGrup, serta dapat menciptakan skala ekonomis dan tingkatefisiensi melalui sentralisasi belanja media.Pada tahun 2012 Kalbe melanjutkan upaya mengembangkandan merevitalisasi titik temu dengan konsumen melalui berbagaimedia (multi channel customer touch points). Kami memulaiupaya mengembangkan customer touch points pada tahun 2008dengan membentuk layanan pelanggan untuk produk nutrisi,yang selanjutnya dikembangkan menjadi Kalbe Customer Carepada tahun 2012. Saat ini kami sedang mengintegrasikan produk-produk konsumen ke dalam Kalbe Customer Care. Melalui KalbeCustomer Care kami menyediakan jasa pelayanan pelanggan dimana petugas call center siap melayani pertanyaan konsumenseputar gizi, kesehatan, produk-produk Kalbe serta program danpositioning Kalbe’s unbranded products as high quality productsfrom a well-trusted company.With a centralized team, we also aim to create more focusedand concerted marketing efforts as a group, and benefit from thescale and efficiency coming from centralized media buying.In 2012 Kalbe progressed further in expanding and revitalizing themulti channel customer touch points. We commenced to developcustomer touch points with the inception of the customer care ofnutritionals products in 2008, which was subsequently expandedinto Kalbe Customer Care in 2012. We are currently in the processof integrating our consumer products under the Kalbe CustomerCare. Through Kalbe Customer Care, we provided customercare service where our call center attendants readily respondto consumer questions on nutritions, health, Kalbe products aswell as ongoing programs and promotions. Kalbe Customer Carecan be accessed through telephone number 0800-140-2000 (tollRp26.2%Rasio Biaya Penjualandan Pemasaran terhadapPenjualanRatio of Selling andMarketing Expense to Sales3,574bnBiaya Penjualan dan PemasaranSelling and Marketing ExpenseKalbe melanjutkan upaya untuk mengembangkan danmerevitalisasi titik temu dengan konsumen melaluiberbagai media (multi channel customer touch points)untuk membangun hubungan yang lebih dekat.Kalbe progressed further in expanding and revitalizing its multi channel customertouch points to build closer relationship.
  • 134. Performance HighlightsManagement ReportCompany ProfileManagement Discussion and AnalysisCorporate GovernanceCorporate Social ResponsibilityPT Kalbe Farma Tbk. • Laporan Tahunan 2012132promosi yang sedang berlangsung. Kalbe Customer Care dapatdihubungi pada nomor telepon 0800-140-2000 (nomor bebaspulsa) dan melalui e-mail : customer@kalbenutritionals.com sertamelalui pesan Blackberry PIN : 25DCA47C.Langkah pengembangan berikutnya adalah melaluipengembangan jasa layanan pengiriman Nutrition Home Deliverypada tahun 2008, yang kemudian dikembangkan menjadi KalbeHome Delivery pada tahun 2012. Konsumen dapat menghubunginomor telepon 500880 untuk memesan produk Kalbe denganlayanan pengiriman tanpa biaya. Dengan diluncurkannya situsbelanja online Kalbe e-store pada tahun 2011, konsumen jugadapat membeli produk nutrisi dan produk konsumen secaraonline dengan layanan pengiriman tanpa dikenakan biaya. Kalbee-store merupakan toko online produk nutrisi yang pertama diIndonesia, menggabungkan pembelian secara online denganlayanan antar secara gratis. Kami bertujuan memberikankemudahan bagi konsumen di kota-kota besar untuk membeliproduk Kalbe dengan mudah. Saat ini kami telah melayani 25kota besar di Indonesia.Kartu Kalbe Family Rewards Card adalah program loyalitaskonsumen yang diluncurkan tahun 2012, untuk menawarkanberbagai keuntungan bagi para pemegang kartu. Hal inimerupakan pengembangan lebih lanjut dalam membangun titiktemu dengan konsumen melalui Kalbe e-store. Para pemegangkartu dapat membeli produk-produk Kalbe dan mengumpulkanpoin untuk ditukarkan dengan berbagai hadiah. Kartu tersebutjuga dapat digunakan untuk berbelanja melalui Kalbe e-store,outlet online produk nutrisi dari Kalbe. Selain itu, para pemegangkartu juga dapat menikmati berbagai diskon menarik saatberbelanja di berbagai outlet mitra yang bertanda Kalbe Spot. Diakhir tahun, Kalbe Family Rewards Card telah menjalin kemitraandengan sekitar 110 merchant dan dapat digunakan di lebih dari500 outlet di sekitar 90 kota besar di 31 propinsi di Indonesia.free), e-mail : customer@kalbenutritionals.com and Blackberrymessenger PIN : 25DCA47C.Our next development was the launching the Nutrition HomeDelivery service in 2008, which was later expanded into KalbeHome Delivery in 2012. By calling telephone number 500880,consumers can order Kalbe products with free delivery service.With the launching of the online shopping website Kalbe e-storein 2011, consumers can purchase nutritionals and consumerproducts online with free delivery service. Kalbe e-store is the firstonline nutritional store in Indonesia, combining online purchasewith free home delivery. We hope to provide convenience toour customers in the big cities to purchase our products easily.Currently we have covered 25 major cities in Indonesia.Kalbe Family Rewards Card is the Company’s latest consumerloyalty building program launched in 2012, to present variousbenefits to cardholders. This is a further step in building touchpoints with customers, to continue on our earlier initiative withKalbe e-store. Cardholders can purchase Kalbe products andcollect points that can later be exchanged with a wide selection ofgifts. The card can also be used to shop Kalbe products throughKalbe e-store, the Company’s online nutritional store. In addition,cardholders can enjoy attractive discounts when shopping innumerous merchant partners bearing the Kalbe Spot signage. Bythe end of the year, Kalbe Family Rewards Cards have partneredwith roughly 110 merchant partners and can be used in morethan 500 outlets in close to 90 major cities across Indonesia’s31 provinces.Titik Temu dengan Konsumen Melalui Berbagai MediaMulti Channel Customer Touch Points
  • 135. PT Kalbe Farma Tbk. • 2012 Annual Report 133Berbagai kegiatan pemasaran above-the-line dan below-the-line menjadi pendukung dalam mencapai sasaran pertumbuhantahun 2012 serta mendekatkan produk-produk Kalbe ke hati parakonsumen.Tahun 2012 juga ditandai dengan berbagai kegiatan promosilangsung ke konsumen (direct-to-consumer) yang inovatif olehseluruh lini usaha Kalbe. Kegiatan-kegiatan ini tidak saja dirancanguntuk memperkokoh hubungan Kalbe dengan konsumen,melainkan juga merupakan sarana efektif untuk memperkenalkankepada masyarakat pentingnya menjalankan hidup yang sehat.Melalui program Kalbe Ethical Customer Care (KECC), Divisi ObatResep secara rutin menyelenggarakan simposium kesehatanbagi para profesional kesehatan serta program edukasi bagimasyarakat untuk meningkatkan kesadaran akan kesehatan.Salah satu aktivitas kami untuk praktisi medis adalah KalbeAcademia, yaitu kegiatan edukasi untuk dokter umum untukmemberikan informasi mengenai perkembangan medis dalamdiagnosis dan pengobatan dengan lebih dari 1.100 peserta padatahun 2012. Kegiatan juga diselenggarakan pada tahun 2012untuk memperingati hari-hari khusus, seperti Hari Kanker Dunia,Hari Ginjal Dunia, Hari Diabetes Dunia, Hari Osteoporosis Duniadan Hari Lanjut Usia Nasional, bekerja sama dengan berbagaikomunitas kesehatan. Secara keseluruhan, lebih dari 3.200peserta ambil bagian dalam berbagai acara ini.Divisi Produk Kesehatan juga aktif memasarkan produk-produknya melalui kegiatan pemasaran langsung ke konsumen.Kegiatan yang diselenggarakan antara lain adalah “GerakanLambung Sehat Indonesia” sejak tahun 2010 bekerja samadengan Promag, solusi Kalbe untuk gangguan lambung, “FatigonAksi Semangat Indonesia” untuk memberikan penghargaan padaindividu-individu yang memberi inspirasi dengan semangatnya,“Cerebrovit X-cellent Generation”, kegiatan bagi kaum mudaIndonesia untuk memperkenalkan gaya hidup sehat, dan “HydroCoco Fun Bike” yang diadakan di 11 kota besar di Indonesia.Lebih dari 150.000 berpartisipasi dalam acara-acara tersebut.Our various above-the-line and below-the-line marketing activitiescontinues to play a great role in ensuring the achievement of 2012top line growth ambition and to bring Kalbe’s products closer tothe heart of the consumers.The year 2012 was also marked with a series of innovative direct-to-consumer promotion events by Kalbe’s entire business lines.Events are designed not only to cement Kalbe’s relationship withits consumers, but are very effective in promoting to communitiesthe importance of living a healthy life.Through Kalbe Ethical Customer Care (KECC) program, thePrescription Pharmaceuticals Division holds routine healthsymposiums attended by medical professionals and educationprograms open to public to improve awareness on healthissues. One of our activities for medical professionals was KalbeAcademia, where we conduct educational events for generalpractitioners to provide updates on medical development ondiagnosis and treatment with over 1,100 participants in 2012.In 2012 various events were also organized in commemorationof special occasions, such as World Cancer Day, World KidneyDay, World Diabetes Day, World Osteoporosis Day and NationalSenior Citizen Day, in partnerships with various health relatedcommunities. In total, over 3,200 participants took part in theseevents.The Consumer Health Division was also active in presenting itsproducts through various direct-to-consumer marketing activities.Among the highlights were “Indonesia Gastric Health Movement”organized since 2010 in association with Promag, Kalbe’s solutionto stomach ailment, “Fatigon Spirit Action Indonesia (Fatigon AksiSemangat Indonesia)” to honor individuals that inspire the nationwith their spirit, and “Cerebrovit X-cellent Generation”, an eventthat targets Indonesian young generation to promote healthylifestyle, and “Hydro Coco Fun Bike” which was held in 11 majorcities in Indonesia. More than 150,000 participants took part inthese events.
  • 136. Performance HighlightsManagement ReportCompany ProfileManagement Discussion and AnalysisCorporate GovernanceCorporate Social ResponsibilityPT Kalbe Farma Tbk. • Laporan Tahunan 2012134Di tahun 2012, Divisi Nutrisi Kalbe telah menyelenggarakankegiatan “Prenagen & the City”, serangkaian acara yang efektifuntuk mempromosikan produk Prenagen kepada para ibu muda.Kegiatan lain yang diselenggarakan antara lain adalah “SeminarLovamil” untuk ibu hamil dan menyusui, serta “Dunia Morinagauntuk Generasi Platinum”, yang merupakan program pemasaranlangsung ke konsumen yang melibatkan sebanyak 221 kegiatanyang diselenggarakan di 40 kota besar di seluruh Indonesia.Kegiatan-kegiatan tersebut diikuti oleh lebih dari 200.000peserta.Kalbe International juga aktif dalam berbagai kegiatan pemasaranbelow-the-line di negara-negara Asia Tenggara dan beberapanegara Afrika. Di negara Filipina, Extra Joss sudah dikenalsebagai produk minuman energi berkualitas oleh konsumennya.Sepanjang tahun 2012, produk Extra Joss didukung oleh inisiatifpenjualan dan product sampling yang masif untuk memperkokohkehadirannya di pasar Filipina. Extra Joss juga cukup populersebagai minuman energi di Nigeria. Di tahun 2012, produk tersebuttelah menjadi co-sponsor penyelenggaraan turnamen sepakbolasetempat, Nigeria Federation Cup, yang makin memperkokohmerek Extra Joss di pasar Nigeria. Beberapa produk kesehatanseperti Mixagrip, Woods dan Procold terus melakukan kegiatanpemasaran di Vietnam dan Myanmar.Diakhirtahun2012,totalbiayapenjualandanpemasaranmencapaiRp3.574 miliar dari Rp2.905 miliar di tahun sebelumnya.Pada tahun 2013, Kalbe akan meneruskan ekspansi di kawasanAsia Tenggara dengan tambahan produk dari nutrisi sepertiDiabetasol dan Morinaga.Kalbe’s Nutritionals Division showcased its “Prenagen & the City”in 2012, effective series of events to promote Kalbe’s Prenagento young mothers-to-be. Other events during the year include“Lovamil Seminar” for expecting and lactating mothers, and“Morinaga World for the Platinum Generation” - a large scaledirect-to-consumer marketing program involving a total of 221events held in Indonesia’s 40 major cities. These events attractedthe participation of over 200,000 people.Kalbe International has also been very active in the launching ofbelow-the-line marketing activities in Southeast Asian countriesand some African countries. In the Philippines, Extra Joss hasbeen known as a quality energy drink product by its consumers.During 2012, the product was supported by massive selling andproduct sampling initiatives to further strengthen Extra Jossbrand in the Philippines market. Extra Joss is also a popularenergy drink in Nigeria and during the year the product becamethe co-sponsor of one of the country’s top football sport event,the Nigeria Federation Cup, further increasing the visibility ofExtra Joss brand in the Nigerian market. Health products suchas Mixagrip, Woods and Procold continue to carry out marketingactivities in Vietnam and Myanmar.By the end of the year, total selling and marketing expenditurewas Rp3,574 billion from Rp2,905 billion a year earlier.In 2013, Kalbe will continue expansion in Southeast Asia regionwith additional nutritional products such as Diabetasol andMorinaga.Kalbe e-storeSitus belanja online untukproduk nutrisi pertama diIndonesia dengan layananjasa pengiriman produk ke25 kota besar di IndonesiaFirst online nutritionalsstore in Indonesia withproduct delivery service to25 major cities in Indonesia
  • 137. PT Kalbe Farma Tbk. • 2012 Annual Report 135Saya didiagnosa menderita diabetes beberapa tahunyang lalu. Tapi saya bertekad untuk mengendalikanpenyakit ini dan tetap menikmati hidup aktif.Dengan menjaga pola makan sehat berolahraga danmengkonsumsi Diabetasol, saya bisa tetap hidupsehat dan produktif.”“I was diagnosed with diabetes a few years ago. ButI was determined to take control of my condition andbe able to enjoy an active life. By maintaining a healthydiet, exercising and consuming Diabetasol, I can live ahealthy and productive life.Kegiatan saya dalam berbagai aktivitas sosialkomunitas sangat padat. Kesibukan yang tinggiseringkali membuat pola makan menjadi tidakteratur dan penyakit maag menyerang. Promagselalu menjadi andalan saya untuk mengatasigangguan maag dan tetap beraktivitas.”“My involvement in community social activitiescan be very demanding. My busy schedule oftenleads to skipped meals, and eventually gastricproblems. Promag has been my trusted brandto overcome gastric problems and keep up withmy daily activities.Sebagai penderita gagal ginjal kronik tahap akhir, saya harusmenerima kenyataan bahwa penyakit ini tidak bisa disembuhkandan membutuhkan terapi pengganti ginjal seumur hidup. Sayatelah menjalankan terapi dialisis peritoneal dengan menggunakanproduk yang dipasarkan oleh Kalbe di Indonesia, berikut produksuplemen Virinon. Berkat rangkaian produk yang komprehensifdari Kalbe, saya mampu melakukan aktivitas rutin dengan nyamandan mempertahankan kualitas hidup saya sebagai penderita gagalginjal.As a patient with chronic advanced stage kidney failure, I have toaccept the fact that this is incurable and I have to rely on kidneyreplacement therapy for the rest of my life. I have undergone peritonealdialysis therapy using products marketed by Kalbe in Indonesia,including the supplement, Virinon. Thanks to Kalbe’s comprehensiveproduct range, I can still do my daily activities conveniently andmaintain my quality of life as a kidney failure patient.Kris BiantoroArtis veteran, penderita gagal ginjal kronisVeteran entertainer, chronic kidney failure patientdr. Dewi MayantiPraktisi kesehatanHealth practitionerDewi RositaIbu rumah tangga, aktivis kesehatanHousewife, health activist
  • 138. Performance HighlightsManagement ReportCompany ProfileManagement Discussion and AnalysisCorporate GovernanceCorporate Social ResponsibilityPT Kalbe Farma Tbk. • Laporan Tahunan 2012136Tinjauan KeuanganFinancial ReviewKinerja Keuangan di Tahun 2012Pembahasan dan analisis berikut mengacu pada LaporanKeuangan Konsolidasian Perseroan untuk tahun-tahun yangberakhir pada 31 Desember 2012 dan 2011, yang telah diauditoleh Kantor Akuntan Publik Kantor Akuntan Publik Purwantono,Suherman & Surja (perusahaan anggota Ernst & Young).Kinerja keuangan di tahun 2012 yang diperbandingkan dengantahun 2011 dapat dilihat pada Tabel Laporan Laba RugiKomprehensif Konsolidasian.Penjualan NetoPerseroan menutup tahun 2012 dengan kinerja yang positif,dengan meraih pertumbuhan penjualan sebesar 25,0% serta tetapmempertahankan pertumbuhan profitabilitas dengan peningkatanlaba bersih sebesar 17,0%. Di tahun 2012, penjualan netomencapai sebesar Rp13.636 miliar, tumbuh 25,0% dibandingkanpencapaian tahun 2011 sebesar Rp10.912 miliar. Dibandingkandengan sasaran pertumbuhan penjualan sebesar 20% - 25%yang ditetapkan sebelumnya, Perseroan berhasil mencapai targetdengan baik.Pertumbuhan penjualan neto di tahun 2012 diantaranyamerefleksikan pengaruh bergabungnya PT Abbott Indonesiasebagai prinsipal pihak ketiga Divisi Distribusi dan Logistik sejakFinancial Performance in 2012The following discussion and analysis refers to the Company’sConsolidated Financial Statements for the years 2012 and 2011,ending December 31, as audited by the Public Accounting Firmof Purwantono, Suherman & Surja (a member firm of Ernst &Young).The Company’s 2012 financial performance, as compared to itsperformance in 2011 can be found in the Consolidated Statementsof Comprehensive Income Table.Net SalesThe Company closed year 2012 with strong performance,achieving the targeted top line growth of 25.0% and at the sametime maintaining profitability growth with net income increaseof 17.0%. In 2012, the Company’s net sales reached Rp13,636billion, surging by 25.0% compared to 2011 figure of Rp10,912billion. Compared to the target of 20% - 25% revenue growthpreviously determined, the Company has successfully achievedthe growth target.Net sales growth in 2012 among others reflected the one timeimpact of the addition of PT Abbott Indonesia as our third partyprincipal in the Distribution and Logistics Division starting in theMemberikan Nilai Bagi ParaPemegang Saham denganKinerja yang PositifProviding a Shareholder Return that ReflectsOutstanding Performance
  • 139. PT Kalbe Farma Tbk. • 2012 Annual Report 137Perseroan menutup tahun 2012 dengan kinerja yangpositif, dengan pertumbuhan penjualan sebesar 25,0%serta mempertahankan pertumbuhan profitabilitasdengan peningkatan laba bersih sebesar 17,0%7,8779,08710,22710,91213,6362008 2009 2010 2011 2012Penjualan Bersih (Rp miliar)Net Sales (Rp billion)Kontribusi Penjualan Bersih per DivisiNet Sales Contribution by Division16%38%24%22%Divisi Obat Resep | Prescription Pharmaceuticals DivisionDivisi Produk Kesehatan | Consumer Health DivisionDivisi Nutrisi | Nutritionals DivisionDivisi Distribusi & Logistik | Distribution & Logistics DivisionLaporan Laba Rugi Komprehensif Konsolidasian Consolidated Statements of Comprehensive IncomeKeterangan2012 2011Naik (Turun)Increase (Decrease)DescriptionRp MiliarRp BillionRp MiliarRp BillionRp MiliarRp Billion%Penjualan Neto 13,636 10,912 2,725 25.0 Net SalesBeban Pokok Penjualan 7,103 5,361 1,742 32.5 Cost of Goods SoldLaba Bruto 6,533 5,551 982 17.7 Gross ProfitBeban Usaha 4,316 3,583 732 20.4 Operating ExpensesLaba Sebelum Manfaat (Beban) PajakPenghasilan2,308 1,987 321 16.1Income Before Income Tax Benefit(Expense)Manfaat (Beban) Pajak Penghasilan (533) (464) (69) 14.8 Income Tax Benefit (Expense)Laba Tahun Berjalan 1,775 1,523 252 16.6 Income for the YearPendapatan (Beban) Komprehensif Lain (3) 17 (20) -118.3Other Comprehensive Income(Expense)Laba Komprehensif Tahun Berjalan 1,772 1,540 232 15.1 Comprehensive Income for the YearLaba Tahun Berjalan yang DapatDiatribusikan Kepada Pemilik EntitasInduk1,734 1,482 252 17.0Income for the Year Attributable toEquity Holders of the Parent CompanyLaba per Saham Dasar yang DapatDiatribusikan Kepada Pemilik EntitasInduk (Rp) *37 32 5 17.0Basic Earnings per Share Attributableto Equity Holders of the ParentCompany (Rp) ** Setelah pemecahan nilai nominal saham (stock split) Adjusted to stock splitThe Company closed year 2012 with strong performance, achieving the targeted topline growth of 25.0% and at the same time maintaining profitability growth with netincome increase of 17.0%.
  • 140. Performance HighlightsManagement ReportCompany ProfileManagement Discussion and AnalysisCorporate GovernanceCorporate Social ResponsibilityPT Kalbe Farma Tbk. • Laporan Tahunan 2012138kuartal keempat tahun 2011. Secara keseluruhan, PT AbbottIndonesia memberikan kontribusi yang signifikan sebesar sekitar6% terhadap total penjualan Perseroan. Namun demikian,produk-produk Kalbe juga memberikan kontribusi yang positifdengan pertumbuhan yang kuat di atas 20% dibandingkan tahunsebelumnya.Tingkat pertumbuhan penjualan tahun 2012 terutama didukungoleh pertumbuhan volume, sedangkan peningkatan hargamemberi sumbangan yang lebih rendah, yaitu sebesar 3-5%,sementara pada tahun 2011, hampir seluruh pertumbuhanpenjualan didorong oleh pertumbuhan volumePenjualan neto disumbangkan oleh 4 Divisi Perseroan: DivisiObat Resep, Divisi Produk Kesehatan, Divisi Nutrisi, serta DivisiDistribusi dan Logistik. Di antara keempat Divisi tersebut, DivisiDistribusi dan Logistik memberikan kontribusi terbesar terhadapkinerja penjualan neto Perseroan, yakni sebesar 38,0%, diikutiDivisi Obat Resep sebesar 24,1%, Divisi Nutrisi sebesar 22,1%dan Divisi Produk Kesehatan sebesar 15,8%.Pertumbuhan penjualan neto masing-masing segmen usahadi atas dipengaruhi oleh beberapa faktor seperti diuraikan dibawah.Penjualan Neto Berdasarkan Segmen Bisnis Net Sales per Business SegmentKeterangan2012 2011Naik (Turun)Increase (Decrease)DescriptionRp MiliarRp Billion%Rp MiliarRp Billion%Rp MiliarRp Billion%Obat Resep 3,288 24.1 2,778 25.5 510 18.4PrescriptionPharmaceuticalsProduk Kesehatan 2,149 15.8 1,842 16.9 307 16.7 Consumer HealthNutrisi 3,012 22.1 2,420 22.2 592 24.5 NutritionalsDistribusi dan Logistik 5,188 38.0 3,873 35.5 1,315 34.0 Distribution and LogisticsTotal Penjualan Neto 13,636 100.0 10,912 100.0 2,725 25.0 Total Net SalesPenjualan Neto Divisi Obat ResepDivisi Obat Resep berhasil meraih penjualan neto sebesarRp3.288 miliar, menyumbang 24,1% terhadap total penjualanneto konsolidasian. Penjualan neto tahun 2012 tumbuh sebesar18,4% dibandingkan tahun 2011.Pertumbuhan penjualan ini didukung oleh pertumbuhan volumedari produk-produk yang ada, kenaikan harga serta peluncuranproduk-produk baru.Kalbe berhasil mempertahankan keunggulannya di pasar farmasiIndonesia yang sangat terfragmentasi, dengan pangsa pasarsebesar 12% (sumber: IMS Health 2012) di antara sebanyak 200perusahaan farmasi. Dengan mengandalkan berbagai pilihanproduk obat resep lisensi, generik bermerek dan generik tanpamerek yang lengkap, Kalbe melayani seluruh segmen ekonomimasyarakat. Layanan tersebut didukung oleh tim tenagapenjualan yang terbesar dan jaringan distribusi terluas di industrifourth quarter of 2011. Overall, PT Abbott Indonesia provided asignificant contribution of approximately 6% to total Company’ssales. Nonetheless, Kalbe’s products also provided positivecontribution with solid growth of over 20% compared to previousyear’s results.Strong sales growth in 2012 was mostly driven by volumegrowth, and price increase contributed to a lesser extent in therange of 3-5%, while in 2011, almost all of the sales growth wascontributed by volume growth.Net sales was contributed by our 4 Divisions: PrescriptionPharmaceuticals, Consumer Health, Nutritionals, and Distributionand Logistics Divisions. Among these four, the Distribution andLogistics Division shared the largest contribution to the Companynet sales, at 38.0%, followed by the Prescription PharmaceuticalsDivision by 24.1%, the Nutritionals Division at 22.1%, and finallythe Consumer Health Division at 15.8%.Net sales growth of each of the above business segments wasinfluenced by several factors as described below.Net Sales of Prescription Pharmaceuticals DivisionThe Prescription Pharmaceuticals Division recorded net salesof Rp3,288 billion, contributing 24.1% to total consolidated netsales. Net sales in 2012 grew 18.4% compared to 2011.This sales growth was supported by volume growth of existingproducts, price increase and the addition of new productlaunches.Kalbe maintained its dominance in the highly fragmentedIndonesian pharmaceuticals market, with a market share of12% (source: IMS Health 2012) among the 200 players. Witha complete product range of patented, branded generic andunbranded generic drugs, Kalbe caters to all income groups ofthe society. This is supported by the largest team of medicalrepresentative force, as well as the most extensive distributionnetwork in the pharmaceuticals market, with thorough coverage
  • 141. PT Kalbe Farma Tbk. • 2012 Annual Report 139farmasi, yang melayani rumah-rumah sakit, apotek dan toko obatdi seluruh Indonesia. Dalam rangka mengantisipasi pelaksanaanjaminan kesehatan nasional tahun 2014, kami terus memperkuateksistensi kami pada segmen obat generik tidak bermereksebagaimana tercermin dari peningkatan kontribusi segmentersebut selama beberapa tahun terakhir hingga kini mencapaisekitar 10% dari nilai penjualan Divisi Obat Resep.Penjualan Neto Divisi Produk KesehatanDivisi Produk Kesehatan mencatatkan penjualan neto sebesarRp2.149 miliar, menyumbang 15,8% dari total penjualan netokonsolidasian.Pertumbuhan Divisi Produk Kesehatan terutama didorong olehpeningkatan volume, selain juga disumbangkan oleh kenaikanharga dan peluncuran produk-produk baru.Divisi Produk Kesehatan berhasil terus meningkatkan kinerjanya,dengan pertumbuhan sebesar 16,7% pada tahun 2012.Pencapaian ini didukung oleh pertumbuhan positif di seluruhproduk yang ada, termasuk produk Extra Joss, produk minumanenergi yang berhasil melakukan transformasi dengan hasil yangmenggembirakan di tahun 2012 setelah harus melalui masayang penuh tantangan. Kami terus mendorong kinerja produkminuman energi dengan peluncuran produk Nitros, produkminuman energi pertama dalam format likuid konsentrat. Produk-produk obat bebas Kalbe, Promag, Neo Entrostop, Procold,Mixagrip, dan Komix, terus meraih kemajuan berarti, sertaberhasil mempertahankan posisinya di kelas terapinya masing-masing. Bidang usaha baru kami di sektor minuman siap sajiterus meraih hasil positif melalui produk Hydro Coco, minumandari air kelapa alami dan Tipco Fruit Juice, minuman sehat yangterbuat dari buah-buahan dan sayuran. Kalbe terus membangunkehadirannya di segmen baru ini dengan menambah lini produkOriginal Love Juice dalam portofolio produknya melalui akuisisiPT Hale International di tahun 2012.Penjualan Neto Divisi NutrisiDivisi Nutrisi berhasil meraih tingkat penjualan neto sebesarRp3.012 miliar, serta menyumbang 22,1% terhadap totalpenjualan neto konsolidasian. Pencapaian ini mengalamipertumbuhan sebesar 24,5% dibandingkan kontribusi Divisiterhadap kinerja Perseroan di tahun 2011. Seperti pencapaiandua Divisi sebelumnya, Divisi Nutrisi berhasil meraih peningkatansignifikan dibandingkan pertumbuhan sebesar 5,5% di tahun2011.Pertumbuhan volume dan kenaikan harga merupakan pendorongpertumbuhan utama Divisi Nutrisi.Dengan meraih pertumbuhan signifikan selama tahun 2012, KalbeterusmemperkokohkehadirannyadipasarsusububukdiIndonesiamelalui strategi Perseroan untuk terus membangun permintaanpasar serta penguatan merek dengan strategi fokus. Upayatersebut didukung oleh inisiatif pembaharuan, perluasan danin all channels including hospitals, pharmacies, and drug storesacross the nation. In anticipation of the implementation of thenational health insurance in 2014, we continue to strengthenour presence in the unbranded generic segment as reflected inthe growing contribution of this segment in the last few yearsreaching over 10% of Prescription Pharmaceuticals revenue.Net Sales of Consumer Health DivisionThe Consumer Health Division recorded net sales of Rp2,149billion, contributing 15.8% to total consolidated net sales.Consumer Health sales growth was mostly driven by volumegrowth and to a lesser extent by price increase and contributionof new products.The Consumer Health Division continued to improve itsperformance over time as evident by its 16.7% growth in 2012.This was supported by strong overall growth of existing products,including Extra Joss, the energy drink product, which has turnedaround with encouraging results in 2012 after facing its shareof challenging period. We continued to boost the energy drinkperformance by launching Nitros, the pioneer product in theformat of concentrated liquid energy drink. Kalbe’s over-the-counter brands Promag, Neo Entrostop, Procold, Mixagrip, andKomix continued to thrive, each maintaining stronghold in itstherapeutical classes. Our recent foray into the ready-to-drinkcontinued to yield positive results with our natural coconut waterproduct Hydro Coco and Tipco Fruit Juice, a healthy beveragemade of fruits and vegetables. Kalbe further built this newsegment by recently adding the Original Love Juice line into thisportfolio through the acquisition of PT Hale International in 2012.Net Sales of Nutritionals DivisionThe Nutritionals Division recorded net sales of Rp3,012 billion,contributing 22.1% to total consolidated net sales. Comparedto the Division’s 2011 contribution to the Company, it grew by24.5%. As the previous two Divisions, the Nutritionals Divisionalso achieved quite a stellar improvement from the 5.5% growthrecorded in 2011.Volume growth and price increase was the main growth driver ofNutritionals Division.With strong growth in 2012, Kalbe continued to deepen ourstronghold in the Indonesian powdered milk market through ourstrategy of continuous demand creation and brand activationwith focused strategy. This was coupled with diligent productrejuvenation, extension and new product development, which
  • 142. Performance HighlightsManagement ReportCompany ProfileManagement Discussion and AnalysisCorporate GovernanceCorporate Social ResponsibilityPT Kalbe Farma Tbk. • Laporan Tahunan 2012140peluncuran produk baru, yang seluruhnya berhasil meningkatkanportofolio dan daya saing Perseroan. Hal ini turut didukungdengan upaya memperluas dan memperdalam penetrasi. Sejalandengan strategi Perseroan untuk mengembangkan produk-produk dengan manfaat kesehatan, Kalbe telah meluncurkanproduk Fitbar, makanan ringan yang sehat, untuk melengkapiportofolio produk Perseroan. Didukung dengan komunikasi danpenempatan yang tepat, Perseroan meyakini bahwa strategitersebut sejalan dengan kondisi demografis Indonesia yangkondusif.Penjualan Neto Divisi Distribusi & LogistikDitahun2012,DivisiDistribusidanLogistikmeraihnilaipendapatanneto sebesar Rp5.188 miliar, serta mencatatkan pertumbuhanpenjualan dan kontribusi terbesar dibandingkan Divisi yang lain,yakni masing-masing sebesar 34,0% dan 38,0%.Secara akuntansi konsolidasian, penjualan neto Divisi Distribusidan Logistik merupakan penjualan kepada para prinsipal pihakketiga. Pertumbuhan penjualan yang positif ini merefleksikanpengaruh adanya penambahan prinsipal pihak ketiga baru,PT Abbott Indonesia, sejak kuartal terakhir tahun 2011. Gunamencapai efisiensi biaya yang lebih tinggi, strategi Perseroanadalah mengalokasikan kapasitas usaha distribusi yang belumdimanfaatkan bagi para prinsipal pihak ketiga. Selain dari usahadistribusi, kegiatan usaha Divisi ini juga mencakup perdaganganalat-alat kesehatan dan bahan baku, serta layanan kesehatandalam bentuk jaringan klinik Mitrasana.Kegiatan distribusi Kalbe dikelola melalui entitas anak, EPMT,yang mengoperasikan jaringan distribusi yang luas untuk produk-produk kesehatan di Indonesia, dengan keunggulan terutama disektor jaringan farmasi. Ketersediaan produk di seluruh wilayahIndonesia merupakan salah satu kunci keberhasilan untukmempertahankan keberadaan dan kepemimpinan di pasar. Kalbeakan terus meningkatkan ketersediaan produknya dengan terusmemperkuat infrastruktur distribusi dan kualitas layanannya.Beban Pokok PenjualanBeban pokok penjualan juga meningkat di tahun 2012, sejalandengan pertumbuhan penjualan. Beban pokok penjualanmencapai sebesar Rp7.103 miliar, meningkat 32,5% dibandingkanRp5.361 miliar di tahun 2011. Beban pokok penjualan Kalbeterdiri atas beban produksi dari produk-produk kami dan bebanpokok penjualan dari sisi distribusi. Seiring meningkatnyakontribusi penjualan dari Divisi Distribusi dan Logistik, bebanpokok penjualan distribusi juga mengalami peningkatan. Selainitu, seperti perusahaan farmasi Indonesia lainnya, beban pokokproduksi didominasi oleh beban bahan baku. Hampir semuakebutuhan bahan baku berasal dari impor, sehingga Perseroansangat dipengaruhi oleh risiko gejolak mata uang asing.Melemahnya nilai tukar Rupiah sebesar 6,6% di tahun 2012dari Rp9.068 per 1US$ tahun 2011 menjadi Rp9.670 di tahun2012 telah memberikan dampak bagi beban bahan baku dalamRupiah.altogether have rounded our portfolio and competitiveness. Ourefforts were supported by widening and deepening penetration.In keeping with our overall strategy to launch products withhealth benefits, we have added Fitbar, a healthy snack bar, to ourproduct portfolio. With proper positioning and communication,we believe our strategy will bode well with Indonesia’s conducivedemographic setting.Net Sales of Distribution & Logistics DivisionIn 2012, the Distribution and Logistics Division recorded netsales of Rp5,188 billion, achieving the highest sales growth aswell as contribution among other Divisions, at 34.0% and 38.0%,respectively.On an accounting consolidated basis, the net sales of theDistribution and Logistics Division represented the sales ofour third party principals. The Division’s strong sales growthreflected the impact of the addition of a new third party principal,PT Abbott Indonesia, since the last quarter of 2011. To achievehigher cost efficiency, our strategy is to share the excess capacitywith third party principals in the distribution business. Aside fromdistribution, this Division also caters to medical devices and rawmaterial trading, as well as retail healthcare service in the form ofchain clinic under the Mitrasana brand.Kalbe’s distribution activities are run by its subsidiary, EPMT, whichmanages a vast distribution network of consumer health productsin Indonesia with a particular dominance in pharmaceuticalschannels. The availability of products in all regions of Indonesiais one of the keys to success in securing market dominationand maintaining a position of leadership. Kalbe will continueto improve product availability by strengthening its distributioninfrastructure and service quality.Cost of Goods SoldCost of goods sold also increased in 2012, in line with the salesgrowth. Cost of goods sold amounted to Rp7,103 billion, rising by32.5% compared to Rp5,361 billion recorded in 2011. Kalbe’s costof goods sold consists of the manufacturing costs of our productsand the cost of goods sold on the distribution side. With the highersales contribution of Distribution and Logistics Division, the costof goods sold of distribution also rose accordingly. Meanwhile,as typical for Indonesian pharmaceuticals companies, the costof goods sold for manufacturing are dominated by raw materialscost. Raw materials are almost entirely imported, exposing theCompany to foreign exchange fluctuation risk. Weaker Rupiahexchange rate in 2012 by 6.6%, from Rp9,068 per 1US$ in2011 to Rp9,670 in 2012 has adversely affected the cost of rawmaterials in Rupiah.
  • 143. PT Kalbe Farma Tbk. • 2012 Annual Report 141Upaya untuk mengelola beban pokok penjualan antara laindilaksanakan melalui pengelolaan dampak nilai tukar mata uangdengan membangun cadangan kas dalam mata uang Dolar A.S.,upaya memperoleh harga bahan baku optimal melalui strategipembelian yang tersentralisasi, serta upaya berkelanjutan untukmeningkatkan produktivitas dan efisiensi, antara lain melaluiprogram lean manufacturing.Laba BrutoPada tahun 2012, Perseroan berhasil membukukan laba kotorsebesar Rp6.533 miliar, meningkat sebesar 17,7% dibandingpencapaian tahun 2011 sebesar Rp5.551 miliar. Akibat perubahanbauran bisnis seiring meningkatnya kontribusi Divisi Distribusidan Logistik yang memberikan marjin lebih rendah, sertaterjadinya depresiasi Rupiah di tahun 2012, marjin laba kotormengalami penurunan dari 50,9% di tahun 2011 menjadi sebesar47,9% tahun 2012. Guna mengurangi tekanan pada tingkat laba,Perseroan telah melaksanakan strategi peningkatan harga sertaupaya berkelanjutan untuk meningkatkan efisiensi produksi.Laba Bruto berdasarkan Segmen Bisnis Gross Profit by Business SegmentKeterangan2012 2011Naik (Turun)Increase (Decrease)DescriptionRp MiliarRp Billion%Rp MiliarRp Billion%Rp MiliarRp Billion%Obat Resep 2,032 31.1 1,830 33.0 202 11.0PrescriptionPharmaceuticalsProduk Kesehatan 1,186 18.2 1,039 18.7 147 14.2 Consumer HealthNutrisi 1,889 28.9 1,494 26.9 396 26.5 NutritionalsDistribusi dan Logistik 1,426 21.8 1,189 21.4 237 20.0 Distribution and LogisticsTotal Laba Kotor 6,533 100.0 5,551 100.0 982 17.7 Total Gross ProfitBeban Usaha dan Pendapatan (Beban) Lain-lainBeban penjualan dan pemasaran mencapai sebesar Rp3.574miliar dan merupakan 26,2% dari total penjualan neto, sertamerupakan komponen biaya kedua terbesar setelah bahanbaku dan kemasan. Beban penjualan dan pemasaran meningkat23,0% di tahun 2012 dari sebesar Rp2.905 miliar di tahun 2011.Hal ini merefleksikan pelaksanaan strategi untuk meningkatkanpermintaan, baik melalui media elektronik maupun mediacetak, serta kegiatan pemasaran langsung ke konsumen gunamempertahankan pertumbuhan penjualan ke depan. Selamatahun 2012, salah satu strategi utama Kalbe adalah meningkatkanefektivitas aktivitas pemasarannya. Hal ini dilaksanakan melaluikampanye terfokus, kegiatan yang langsung menjangkaukonsumen, serta inisiatif corporate branding yang terkoordinasiguna memanfaatkan kekuatan merek Kalbe di seluruh produkPerseroan sebagai produsen berkualitas dan terpercaya di sektorkesehatan.Our efforts to manage cost of goods sold involve managing theexchange rate impact through building cash reserve in U.S. Dollar,obtaining most optimum raw material prices under strategiccentralized procurement and continuous efforts to implementhigher productivity and efficiency, among others, through leanmanufacturing program.Gross ProfitIn 2012, the Company’s reached a gross profit of Rp6,533 billion,rising by 17.7% from Rp5,551 billion in 2011. Due to changes inbusiness mix driven by higher contribution of the lower-marginDistribution and Logistics Division and the depreciation of theRupiah in 2012, the Company’s gross profit margin declined from50.9% in 2011 to 47.9% in 2012. To minimize the downwardpressure on profitability, the Company implemented priceincrease strategy coupled with continuous efforts to improveproduction efficiency.Operating Expenses and Other Income(Expenses)Selling and marketing expense reached Rp3,574 billion andaccounted for 26.2% of net sales, making it the second largestcost component after raw and packaging materials. Selling andmarketing expense grew by 23.0% in 2012 from Rp2,905 billionin 2011. This reflected the implementation of demand creationstrategies, both through electronic and printed media, as wellas direct-to-consumer marketing activities, aimed at sustainingfuture sales growth. In 2012, one of Kalbe’s key strategies wasto increase the effectiveness of our marketing activities. This wasmanifested through targeted campaign, activation of direct-to-consumer activities and concerted corporate branding effortsto leverage the strength of Kalbe brand as a trusted qualityhealthcare producer to all of Kalbe’s products.
  • 144. Performance HighlightsManagement ReportCompany ProfileManagement Discussion and AnalysisCorporate GovernanceCorporate Social ResponsibilityPT Kalbe Farma Tbk. • Laporan Tahunan 2012142Beban Usaha dan Pendapatan (Beban) Lain-lain Operating Expenses and Other Income (Expenses)Keterangan2012 2011Naik (Turun)Increase (Decrease)DescriptionRp MiliarRp BillionRp MiliarRp BillionRp MiliarRp Billion%Beban Penjualan (3,574) (2,905) 668 23.0 Selling ExpenseBeban Umum dan Administrasi (651) (587) 65 11.1 General and Administrative ExpenseBeban Penelitian dan Pengembangan (91) (91) 0 -0.5 Research and Development ExpenseBeban Bunga dan Keuangan (18) (13) 4 33.0 Interest Expense and Financial ChargesLaba (Rugi) Selisih Kurs, Neto 20 (12) 32 260.4 Gain (Loss) on Foreign Exchange, NetPenghasilan Bunga 74 97 (22) -23.2 Interest IncomeLaba atas Penjualan Aset Tetap 19 6 13 228.4Gain on Sale of Property AndEquipmentRupa-Rupa, Neto (5) (58) 52 90.8 Miscellaneous, NetBeban umum dan administrasi mencapai Rp651 miliar, meningkat11,1% dari sebesar Rp586 miliar tahun 2011, sebagian besarakibat peningkatan tahunan beban gaji dan beban lainnya sepertibeban perjalanan, konferensi, serta beban pemeliharaan danperbaikan. Secara persentase terhadap penjualan neto, bebanumum dan adminstrasi mengalami penurunan dari sebesar 5,4%di tahun 2011 menjadi 4,8% tahun 2012, terutama didukungoleh tingginya pertumbuhan penjualan. Beban penelitian danpengembangan relatif stabil sebesar Rp91 miliar, sedikit menurunsebesar 0,5%, terutama seiring menurunnya pengeluaran untukkegiatan penelitian dan pengembangan. Secara persentaseterhadap penjualan neto, beban penelitian dan pengembangantetap stabil sebesar 0,7% di tahun 2012 dibandingkan sebesar0,8% tahun 2011.Penghasilan bunga menurun 23,2% mencapai Rp74 miliar ditahun 2012 seiring penurunan saldo kas dan suku bunga. Posisikas dan setara kas menurun dari sebesar Rp2.291 miliar di akhir2011 menjadi Rp1.860 miliar di akhir 2012 setelah peningkatanpembayaran dividen dan kebutuhan pengeluaran barang modalsepanjang tahun 2012. Beban bunga dan keuangan mengalamipeningkatan sebesar 33,0% mencapai Rp18 miliar di tahun 2012seiring meningkatnya pinjaman untuk kebutuhan modal kerja.Seiring terjadinya depresiasi nilai tukar mata uang Rupiah di tahun2012, laba selisih kurs - neto mencapai Rp20 miliar, dibandingkanrugi selisih kurs - neto sebesar Rp12 miliar tahun 2011, terutamadidukung oleh meningkatnya nilai tukar Dolar A.S. atas kasPerseroan dengan denominasi Dolar A.S. Laba atas penjualanaset tetap mencapai Rp19 miliar yang terutama berasal dari labapenjualan tanah dan bangunan di Banjarmasin dan dari penjualanmesin dan peralatan, perlengkapan kantor dan kendaraan di tahun2012. Beban rupa-rupa menurun menjadi Rp0,5 miliar di tahun2012 dari sebesar Rp58 miliar tahun 2011 akibat penurunan biayapenghapusan persediaan pada tahun 2012.Laba Sebelum Manfaat (Beban) Pajak Penghasilandan Laba Tahun BerjalanSejalan dengan peningkatan penjualan, laba sebelum manfaat(beban) pajak penghasilan tahun 2012 tumbuh mencapai Rp2.308General and administrative expense amounted to Rp651 billion,rising by 11.1% from Rp586 billion in 2011, mostly reflectingthe annual increase of salary expense and other expensessuch as travelling, conferences and convention and repairs andmaintenance. In terms of percentage to net sales, general andadministrative expense decreased from 5.4% in 2011 to 4.8%in 2012, mostly due to strong top line growth. Research anddevelopment was relatively stable at Rp91 billion, recording aslight decrease of 0.5%, mostly on account of lower spendingon research and development activities. As a percentage to netsales, research and development remained relatively stable at0.7% in 2012 compared to 0.8% in 2011.The Company recorded lower interest income by 23.2% toRp74 billion in 2012 on the back of lower cash balance alongwith decreasing interest rate. Cash and cash equivalent positiondeclined from Rp2,291 billion at the end of 2011 to Rp1,860 billionat the end of 2012 after the payment of higher dividend and capitalexpenditure requirements during the year. Interest expense andfinancial charges increased by 33.0% to Rp18 billion in 2012 onaccount of higher borrowing for working capital purposes. Alongwith the depreciation of the Rupiah exchange rate in 2012, gainon foreign exchange – net reached Rp20 billion, compared to aloss on foreign exchange – net of Rp12 billion in 2011, mostlydue to the impact of the stronger U.S. Dollar exchange rate onthe Company’s cash denominated in U.S. Dollar. The Companyrecorded gain on sale of property and equipment of Rp19 billionmostly arising from gain on disposal of land and property inBanjarmasin, as well as disposal of machinery and equipment,office furniture and fixtures, and vehicles in 2012. Miscellaneousexpenses decreased to Rp0.5 billion in 2012 from Rp58 billion in2011 on lower inventory write-off expense in 2012.Income before Income Tax Benefit (Expense) andIncome for the YearAlong with increase in sales, income before income tax benefits(expenses) in 2012 improved to Rp2,308 billion, a rise by 16.1%
  • 145. PT Kalbe Farma Tbk. • 2012 Annual Report 143compared to Rp1,987 billion recorded in 2011. The increase inincome before income tax benefits (expense) was resulted fromhealthy sales and gross profit growth. Income tax expense - netconsequently rose from Rp464 billion to Rp533 billion in 2012.miliar, meningkat 16,1% dari sebesar Rp1.987 miliar di tahun2011. Peningkatan ini didukung oleh pertumbuhan penjualandan laba bruto yang sehat. Beban pajak penghasilan – neto jugameningkat dari Rp464 miliar menjadi Rp533 miliar di tahun 2012.Laba Sebelum Manfaat (Beban) Pajak Penghasilan dan LabaTahun BerjalanIncome before Income Tax Benefit (Expense) and Incomefor the YearKeterangan2012 2011Naik (Turun)Increase (Decrease)DescriptionRp MiliarRp BillionRp MiliarRp BillionRp MiliarRp Billion%Laba Sebelum Manfaat (Beban) PajakPenghasilan2,308 1,987 321 16.1Income Before Income Tax Benefit(Expense)Manfaat (Beban) Pajak Penghasilan (533) (464) (69) 14.8 Income Tax Benefit (Expense)Laba Tahun Berjalan 1,775 1,523 252 16.6 Income for the YearLaba tahun berjalan tumbuh 16,6% dari Rp1.523 miliar di tahun2011 menjadi sebesar Rp1.775 miliar di tahun 2012. Setelahmengalokasikan sebesar Rp41 miliar sebagai bagian laba tahunberjalan yang diatribusikan untuk kepentingan non-pengendali,Perseroan membukukan laba tahun berjalan yang dapatdiatribusikan kepada pemilik entitas induk sebesar Rp1.734miliar, meningkat sebesar 17,0% dari tahun sebelumnya.Jika dibandingkan dengan target, pertumbuhan laba tahunberjalan yang dapat diatribusikan kepada pemilik entitas indukPerseroan pada tahun 2012 sebesar 17,0% berada pada kisaransasaran yang ditetapkan sebelumnya sebesar 16% - 20%.Kalbe terus mencapai peningkatan kinerja untuk para pemegangsaham, seiring terus meningkatnya pertumbuhan laba per saham.Di tahun 2012, setelah pelaksanaan pemecahan saham (stocksplit) dengan rasio 1 banding 5, laba per saham dasar mencapaiRp37,0. Laba per saham dasar terus meningkat dari tahun ketahun dari sebesar Rp14,4 di tahun 2008, Rp19,4 tahun 2009,Rp27,4 tahun 2010 hingga mencapai Rp31,7 tahun 2011, setelahdisesuaikan dengan pengaruh pemecahan saham.Beban komprehensif lain mencapai Rp3 miliar di tahun 2012,dibandingkan pendapatan komprehensif lain sebesar Rp17 miliartahun 2011. Beban komprehensif lain sebagian besar terkaitdengan rugi yang belum direalisasikan dari penurunan nilai pasarinvestasi di PT Champion Pacific Indonesia Tbk. (dahulu PTKageo Igar Jaya Tbk.), di mana Perseroan memegang kepemilikansaham sebesar 5% saham.Target Tahun 2013Kami optimis akan mampu mempertahankan momentumpertumbuhan yang baik. Kami mentargetkan pertumbuhanpenjualan bersih pada kisaran 15% - 18%, yang diikutipertumbuhan profitabilitas di mana laba bersih per saham jugaditargetkan meningkat pada kisaran 15% - 18%.The Company’s income for the year grew by 16.6%, fromRp1,523 billion in 2011 to Rp1,775 billion in 2012. After allocatingRp41 billion as part of the income for the year attributable tonon-controlling interest, the Company booked Rp1,734 billion asincome for the year attributable to equity holders of the parentcompany, growing by a healthy 17.0% from the previous year.Compared to the target, the income for the year growth in 2012of 17.0% was within the range of target determined previously of16% - 20%.Kalbe continued to generate improving results for shareholders,as evident from strong earnings per share growth over time. In2012, after the stock split with the ratio of 1 to 5, earnings pershare was recorded at Rp37.0. Earnings per share steadily grewover the past few years from Rp14.4 in 2008, Rp19.4 in 2009,Rp27.4 in 2010, reaching Rp31.7 in 2011, on adjusted basis forstock split impact.The Company recorded other comprehensive expense of Rp3billion in 2012, compared to a total of other comprehensiveincome of Rp17 billion in 2011. Other comprehensive expense in2012 were mostly related to unrealized losses from the decreasein market value of investments in PT Champion Pacific IndonesiaTbk. (previously PT Kageo Igar Jaya Tbk.), whereby the Companyholds a 5% stake.2013 OutlookWe are confident that we will be able to maintain the stronggrowth momentum. We are targeting to grow net sales by 15% -18%, which is to be followed by profitability growth with earningsper share also targeted to grow by 15% - 18%.
  • 146. Performance HighlightsManagement ReportCompany ProfileManagement Discussion and AnalysisCorporate GovernanceCorporate Social ResponsibilityPT Kalbe Farma Tbk. • Laporan Tahunan 2012144Sejalan dengan komitmen Perseroan untuk terus meningkatkanimbalhasildannilaibagipemegangsaham,kamimempertahankankebijakan dividen untuk membagikan sekurang-kurangnya 50%dari laba bersih Perseroan sebagai dividen tunai.Laporan Posisi Keuangan KonsolidasianKalbe tetap memfokuskan pada tercapainya posisi keuanganyang solid dan sehat, karena Perseroan percaya bahwamanajemen keuangan yang berhati-hati merupakan landasanuntuk mendukung perluasan usaha ke depan serta kekuatan untukmenghadapi gejolak eksternal sejalan dengan ketidakpastiankondisi makroekonomi dunia.Laporan Posisi Keuangan Statements of Financial PositionKeterangan2012 2011Naik (Turun)Increase (Decrease)DescriptionRp MiliarRp BillionRp MiliarRp BillionRp MiliarRp Billion%Aset Lancar 6,442 5,994 448 7.5 Current AssetsAset Tidak Lancar 2,976 2,281 696 30.5 Non-current AssetsTotal Aset 9,418 8,275 1,143 13.8 Total AssetsLiabilitas Jangka Pendek 1,892 1,631 261 16.0 Current LiabilitiesLiabilitas Jangka Panjang 155 128 27 20.8 Non-current LiabilitiesTotal Liabilitas 2,046 1,759 288 16.4 Total LiabilitiesEkuitas, Neto 7,372 6,516 856 13.1 Total Equity, NetTotal Liabilitas dan Ekuitas 9,418 8,275 1,143 13.8 Total Liabilities and EquityAsetPer tanggal 31 Desember 2012, total aset Perseroan tumbuh13,8% mencapai sebesar Rp9.418 miliar, dibandingkan total asetper 31 Desember 2011 sebesar Rp8.275 miliar. Peningkatan initerutama didorong oleh peningkatan pertumbuhan aset tidaklancar, seperti diuraikan dalam analisis akun-per-akun berikut.Aset Lancar Current AssetsKeterangan2012 2011Naik (Turun)Increase (Decrease)DescriptionRp MiliarRp Billion%Rp MiliarRp Billion%Rp MiliarRp Billion%Kas dan Setara Kas 1,860 28.9 2,291 38.2 (432) -18.8Cash and CashEquivalentsPiutang Usaha, Neto 1,805 28.0 1,530 25.5 275 18.0 Trade Receivables, netPiutang Lain-Lain 133 2.1 105 1.8 28 26.2 Others ReceivablesAset Keuangan LancarLainnya239 3.7 114 1.9 125 109.2Other Curent FinancialAssetsPersediaan, Neto 2,115 32.8 1,705 28.4 410 24.1 Inventories, netPajak Pertambahan NilaiDibayar Dimuka31 0.5 21 0.3 10 47.0 Prepaid Value Added TaxAset Lancar Lainnya danBiaya Dibayar di Muka258 4.0 227 3.8 32 14.0Other Current Assets andPrepaid ExpensesTotal Aset Lancar 6,442 100.0 5,994 100.0 448 7.5 Total Current AssetsIn line with our commitment to continue to enhance totalshareholders return and values, we maintain our dividend policyto distribute at least 50% of our net profit as cash dividend.Consolidated Statements of Financial PositionAchieving a solid and healthy financial position continues to beone of Kalbe’s main focus, as we believe that prudent financialmanagement will be a foundation to support future businessexpansion and absorb any external fluctuations given the currentlyuncertain global macroeconomic condition.AssetsAs of December 31, 2012, the Company’s total assets increasedby 13.8% to reach Rp9,418 billion, compared to total assets asper December 31, 2011, reaching Rp8,275 billion. The increasewas mostly driven by higher growth of non-current assets, asdescribed in further details in the following account-by-accountanalysis.
  • 147. PT Kalbe Farma Tbk. • 2012 Annual Report 145Aset LancarAset lancar Perseroan meningkat menjadi Rp6.442 miliar tahun2012, dibandingkan Rp5.994 miliar tahun sebelumnya, ataumeningkat sebesar 7,5%.Kas dan Setara KasKas dan setara kas terdiri atas kas, kas pada bank, call depositdan deposito berjangka (pihak ketiga), baik dalam mata uangRupiah, Dolar A.S. maupun mata uang asing lainnya. Kas dansetara kas mengalami penurunan sebesar 18,8% dari Rp2.291miliar tahun 2011 menjadi Rp1.860 miliar di tahun 2012, terutamaakibat meningkatnya kebutuhan pembayaran dividen sertapengeluaran barang modal di tahun 2012.Piutang UsahaSeiring kenaikan penjualan yang signifikan di tahun 2012, piutangusaha mengalami peningkatan sebesar 18,0% dari Rp1.530 miliartahun 2011 menjadi Rp1.805 miliar di tahun 2012, masing-masingsetelah dikurangi cadangan penurunan nilai sebesar Rp11 miliardan Rp18 miliar di tahun 2012 dan 2011.Analisis Piutang Usaha berdasarkan Umur Piutang Aging Analysis of the Trade ReceivablesKeterangan2012 2011DescriptionRp MiliarRp BillionRp MiliarRp BillionLancar 1,347 1,107 CurrentLewat Jatuh Tempo Overdue1-30 Hari 373 334 1-30 Days31-60 Hari 44 61 31-60 Days61-90 Hari 28 29 61-90 DaysLebih dari 90 Hari 24 18 Over 90 DaysJumlah 1,816 1,549 TotalDikurangi Cadangan Penurunan Nilai (11) (18) Less Allowance for ImpairmentPiutang Usaha, Neto 1,805 1,530 Trade Receivables, NetKolektibilitas Piutang Di tahun 2012, rata-rata perputaran piutang menurun 2 hari dari50 hari di tahun 2011 menjadi 48 hari. Manajemen Perseroanberkeyakinan bahwa piutang Perseroan dapat ditagihkan sesuaijadwal dan jumlah penyisihan piutang ragu-ragu senilai Rp11miliar cukup memadai untuk menutup kemungkinan kerugianatas tidak tertagihnya piutang usaha.Piutang Lain-lainPiutang lain-lain terutama terdiri dari piutang atas klaim pembelianpotongan penjualan dan lainnya, serta piutang karyawan. Piutanglain-lain Perseroan meningkat 26,2% dari Rp105 miliar tahun2011 menjadi sebesar Rp133 miliar di tahun 2012.Aset Keuangan Lancar LainnyaAset keuangan lancar lainnya mengalami peningkatan sebesar109% mencapai Rp239 miliar dari Rp114 miliar di tahun 2011,terutama didorong peningkatan investasi surat berharga sepertiCurrent AssetsThe Company’s current assets grew to Rp6,442 billion in 2012,compared to the previous year’s figure of Rp5,994 billion, whichshowed a rise of 7.5%.Cash and Cash EquivalentsThe Company’s cash and cash equivalents consisted of cash onhand and in the bank as well as call and time deposits (third parties)whether in Rupiah, U.S. Dollars, or other foreign currencies. Cashand cash equivalents declined by 18.8%, from Rp2,291 billion in2011 to Rp1,860 billion in 2012, mostly due to higher requirementsfor dividend payment and capital expenditure in 2012.Trade ReceivablesReflecting strong sales growth in 2012, Kalbe’s trade receivablesincreased by 18.0%, from Rp1,530 billion in 2011 to Rp1,805 billionin 2012, after deducting allowance for impairment amounting toRp11 billion and Rp18 billion consecutively in 2012 and 2011.Collectability of Receivables In 2012, the average turnover of receivables decreased by 2days,from 50 days in 2011 to 48 days. The Company’s managementbelieves that receivables could be collected as scheduled, andthe allowance for impairment amounting to Rp11 billion wasadequate to cover possible losses that may arise from the non-collection of the accounts.Other ReceivablesOther receivables of third parties consist of receivables forcustomers’ claims, sales discount and other, and employeereceivables. The Company’s other receivables increased by26.2%, from Rp105 billion in 2011 to Rp133 billion in 2012.Other Current Financial AssetsOther current financial assets rose by 109% to Rp239 billion fromRp114 billion in 2011, mainly caused by higher investments inmarketable securities such as mutual funds, and bonds, as well
  • 148. Performance HighlightsManagement ReportCompany ProfileManagement Discussion and AnalysisCorporate GovernanceCorporate Social ResponsibilityPT Kalbe Farma Tbk. • Laporan Tahunan 2012146reksadana, obligasi serta dana yang dibatasi penggunaannyaterkait dengan fasilitas Letter of Credit (LC) pada salah satuentitas anak.Persediaan, NetoPersediaan meningkat 24,1% di tahun 2012 menjadi Rp2.115miliar, mencerminkan peningkatan kebutuhan bahan baku,persediaan barang dalam proses dan barang jadi seiring denganpertumbuhan penjualan neto yang signifikan. Di tahun 2012, rata-rata perputaran persediaan mengalami penurunan sebanyak 8hari, dari 115 hari menjadi 107 hari.Pajak Pertambahan Nilai Dibayar Di MukaPajak pertambahan nilai dibayar di muka meningkat 47% dariRp21 miliar di tahun 2011 menjadi Rp31 miliar di tahun 2012,sejalan dengan pertumbuhan usaha Perseroan.Aset Lancar Lainnya dan Biaya Dibayar di MukaAset lancar lain-lain terdiri dari uang muka pembelian asettetap, uang muka pembelian bahan baku dan barang jadi,biaya dibayar di muka, serta lain-lain. Di tahun 2012 aset lancarlain-lain meningkat 14% dari Rp227 miliar tahun 2011 menjadiRp258 miliar. Peningkatan ini terutama disebabkan pembayaranuang muka untuk pembelian aset tetap terkait tanah dan mesinproduksi.Aset Tidak LancarAset tidak lancar Perseroan meningkat 30,5% dari Rp2.281 miliartahun 2011 menjadi Rp2.976 miliar di tahun 2012. Peningkatanaset tidak lancar terutama didorong oleh peningkatan aset tetapserta aset tidak berwujud.Aset Tidak Lancar Non-current AssetsKeterangan2012 2011Naik (Turun)Increase (Decrease)DescriptionRp MiliarRp Billion%Rp MiliarRp Billion%Rp MiliarRp Billion%Investasi pada EntitasAsosiasi49 1.6 54 2.4 (5) -8.9Investment in AssociatedEntityAset Pajak Tangguhan, Neto 56 1.9 38 1.6 19 49.9 Deferred Tax Assets, NetTagihan Restitusi PajakPenghasilan26 0.9 28 1.2 (2) -7.0Claims for Income TaxRefundAset Tetap, Neto 2,255 75.8 1,860 81.6 394 21.2Property, Plant AndEquipment, NetAset Tidak Berwujud, Neto 341 11.5 233 10.2 108 46.4 Intangible Assets, NetAset Tidak Lancar Lainnya 249 8.4 68 3.0 181 267.0 Other Non-current AssetsTotal Aset Tidak Lancar 2,976 100.0 2,281 100.0 696 30.5 Total Non-current AssetsLiabilitasPada tahun 2012, total Liabilitas Perseroan meningkat dariRp1.759 miliar menjadi Rp2.046 miliar. Peningkatan ini terutamadisumbangkan oleh peningkatan liabilitas jangka pendek yangmencapai sebesar Rp1.892 miliar, atau mencapai 92,4% daritotal liabilitas. Liabilitas jangka panjang mencapai Rp0,15 miliaratau 7,6% dari total liabilitas.as restricted funds related to Letter of Credit (LC) facility in oneof the subsidiaries.Net InventoriesInventories increased by 24.1% in 2012 to reach Rp2,115 billion,reflecting higher requirements for raw materials, work in processand finished goods inventories in line with the strong growth ofnet sales. In 2012, average turnover of inventory decreased by 8days, from 115 days to 107 days.Prepaid Value Added TaxPrepaid value added tax increased by 47% from Rp21 billion in2011 to Rp31 billion in 2012, in line with the Company’s businessgrowth.Other Current Assets and Prepaid ExpensesOther current assets comprise advance payment for purchase ofproperty, plant and equipment, advance payment for purchaseof raw material and finished goods, prepaid expenses, as wellas others. Other current assets in 2012 increased by 14%, fromRp227 billion in 2011 to Rp258 billion. The increase was mainlydriven by advance payment for purchase of property, plant andequipment in relation with acquisition of land and productionmachineries.Non-current AssetsThe Company’s non-current assets increased by 30.5% fromRp2,281 billion in 2011 to Rp2,976 billion in 2012. The increase innon-current assets was mostly accounted for by the increase inproperty, plant and equipment as well as by increase of intangibleassets.LiabilitiesIn 2012, total liabilities increased from Rp1,759 billion to reachRp 2,046 billion. This was mostly contributed by the increase incurrent liabilities which amounted to Rp1,892 billion, or equivalentto 92.4% of total liabilities. Non-current liabilities amounted toRp0.15 billion, or 7.6% of total liabilities.
  • 149. PT Kalbe Farma Tbk. • 2012 Annual Report 147Liabilitas Jangka PendekLiabilitas lancar meningkat sebesar 16,0% menjadi Rp1.892miliar pada tahun 2012 dibandingkan Rp1.631 miliar pada tahunsebelumnya.Liabilitas Jangka Pendek Current LiabilitiesKeterangan2012 2011Naik (Turun)Increase (Decrease)DescriptionRp MiliarRp Billion%Rp MiliarRp Billion%Rp MiliarRp Billion%Utang Bank 204 10.8 140 8.6 64 45.8 Bank LoansUtang Usaha 809 42.8 850 52.2 (42) -4.9 Trade PayablesUtang Lain-lain 291 15.4 202 12.4 89 43.8 Other PayablesBeban Akrual 362 19.1 263 16.1 99 37.6 Accrued ExpensesUtang Pajak 196 10.4 154 9.5 42 26.9 Taxes PayableLiabilitas Imbalan KerjaJangka Pendek29 1.6 20 1.2 9 46.3Short-Term Liabilities forEmployees’ BenefitBagian Jangka PendekUtang Sewa Pembiayaan0.3 0.0 0.3 0.0 0 2.9Current Maturities ofObligations Under FinanceLeasesTotal Liabilitas JangkaPendek1,892 100.0 1,631 100.0 261 16.0 Total Current LiabilitiesUtang BankSecara keseluruhan, Perseroan mencatat rasio utang terhadapekuitas yang rendah sebesar 2,8%, cukup stabil dibandingkan2,2% pada tahun 2011. Di tahun 2012, utang bank meningkat45,8% mencapai Rp204 miliar dari Rp140 miliar di tahun 2011.Peningkatan ini berasal dari utang bank untuk kebutuhan modalkerja, di mana pinjaman jangka pendek dalam mata uang Rupiahdiperoleh dari PT Bank CIMB Niaga Tbk., fasilitas cerukan(overdraft) dari PT Bank Central Asia Tbk. dan PT Bank PermataTbk. Kredit berjangka dalam mata uang asing diperoleh dari TheHong Kong and Shanghai Banking Corporation Ltd. cabangJakarta dan PT Bank Central Asia Tbk. dalam Dolar A.S., sertapinjaman tetap dalam mata uang Dolar Singapura dari DBSBank.Utang UsahaUtang usaha timbul dari pembelian bahan baku dan barangjadi dari prinsipal pihak ketiga di bidang usaha distribusi. Utangusaha mengalami penurunan mencapai Rp809 miliar di tahun2012, menurun 4,9% dari Rp850 miliar di tahun 2011. Rata-rataperputaran utang usaha mengalami penurunan sebesar 16 hari,dari 57 hari tahun 2011 menjadi 41 hari pada tahun 2012.Utang Lain-lainUtang lain-lain terutama terdiri dari utang kepada agen periklanandan perusahaan ekspedisi. Utang lain-lain Perseroan padatahun 2012 juga mengalami peningkatan sebesar 43,8% dariRp202miliar pada tahun 2011 menjadi Rp291 miliar pada tahun2012.Current LiabilitiesCurrent liabilities increased by 16.0% to Rp1,892 billion in 2012,compared to Rp1,631 for the previous year.Bank LoansOverall, the Company recorded low debt to equity ratio of2.8%, relatively stable compared to 2.2% in 2011. Bank loansincreased by 45.8% in 2012 to reach Rp204 billion, from Rp140billion in 2011. The increase was related to higher borrowings forworking capital requirements, whereby bank loans in Rupiah wereobtained from PT Bank CIMB Niaga Tbk., overdrafts facility fromPT Bank Central Asia Tbk. and PT Bank Permata Tbk. Short termloans in foreign currencies included revolving credit received fromThe Hong Kong and Shanghai Banking Corporation Ltd. Jakartabranch and PT Bank Central Asia Tbk. in U.S. Dollar, and fixedloans received from DBS Bank in Singapore Dollars.Trade PayablesTrade payables comprised purchases of raw materials andfinished goods from third party principals under the distributionbusiness. Trade payables declined to Rp809 billion in 2012, ordown by 4.9% from Rp850 billion in 2011. The average turnoverof trade payables decreased by 16 days, from 57 days in 2011 to41 days in 2012.Other PayablesOther payables consist of payables to advertising agencies andexpedition companies. Other payables in 2012 also underwenta rise by 43.8% from Rp202 billion in 2011 to Rp291 billion in2012.
  • 150. Performance HighlightsManagement ReportCompany ProfileManagement Discussion and AnalysisCorporate GovernanceCorporate Social ResponsibilityPT Kalbe Farma Tbk. • Laporan Tahunan 2012148Beban AkrualBeban akrual terdiri dari akrual untuk biaya-biaya penjualan,royalti, rapat kerja dan biaya lain-lain. Perseroan mencatatadanya peningkatan biaya masih harus dibayar sebesar 37,6%,dari Rp263 miliar tahun 2011 menjadi Rp362 miliar di tahun 2012.Peningkatan ini terutama disebabkan oleh naiknya beban akrualuntuk biaya promosi.Utang PajakUtang pajak Perseroan meningkat 26,9% dari Rp154 miliar ditahun 2011 menjadi Rp196 miliar di tahun 2012, terutama akibatpeningkatan taksiran utang pajak penghasilan – pasal 29.Bagian Jangka Pendek Utang Sewa PembiayaanDi tahun 2012, bagian jangka pendek utang sewa pembiayaanmeningkat 2,9% dari Rp0,285 miliar di tahun 2011 menjadiRp0,293 miliar tahun 2012.Liabilitas Jangka PanjangLiabilitas jangka panjang meningkat sebesar 20,8% mencapaiRp155 miliar pada tahun 2012 dibandingkan Rp128 miliar padatahun sebelumnya.Liabilitas Jangka Panjang Non-current LiabilitiesKeterangan2012 2011Naik (Turun)Increase (Decrease)DescriptionRp MiliarRp Billion%Rp MiliarRp Billion%Rp miliarRp Billion%Liabilitas Pajak Tangguhan,Neto11 7.1 10 7.7 1 11.1Deferred Tax Liabilities,NetUtang Sewa PembiayaanSetelah Dikurangi BagianJangka Pendek0.1 0.1 0.4 0.3 (0.3) -78.6Obligations Under FinanceLeases Net of CurrentMaturitiesLiabilitas Imbalan KerjaJangka Panjang144 92.9 118 92.0 26 21.9Long-term Liabilities forEmployees BenefitsTotal Liabilitas JangkaPanjang155 100.0 128 100.0 27 20.8 Total Non-current LiabilitiesLiabilitas Pajak Tangguhan - NetoDi tahun 2012 liabilitas pajak tangguhan - neto meningkat 11%dari Rp10 miliar di tahun sebelumnya menjadi Rp11 miliar.Utang Sewa Pembiayaan Setelah Dikurangi BagianJangka PendekDi tahun 2012, utang sewa pembiayaan setelah dikurangi bagianjangka pendek ptercatat sebesar Rp0,08 miliar, menurun sebesar78,5% dari sebesar Rp0,36 miliar pada tahun 2011.Liabilitas Imbalan Kerja Jangka PanjangDi tahun 2012, Perseroan membukukan kenaikan estimasiliabilitas imbalan kerja karyawan sebesar 21,9% menjadi Rp144miliar dibandingkan Rp118 miliar pada tahun 2011.Accrued ExpensesAccrued expenses cover accruals for selling, royalty, trainingconvention and other expenses. The Company recorded anincrease in accrued expenses, by 37.6% from Rp263 billionin 2011 to the Rp362 billion of 2012. This increase was mainlyattributable to increase in accrual for promotional expenses.Taxes PayablesThe Company’s taxes payables increased by 26.9%, going fromRp154 billion in 2011 to Rp196 billion in 2012, which was mainlycaused by an increase in estimated income tax payable – article29.Current Maturities of Obligations under FinanceLeasesCurrent maturities of obligations under finance leases in 2012increased by 2.9%, from Rp0.285 billion in 2011 to Rp0.293billion in 2012.Non-current LiabilitiesNon-current liabilities increased by 20.8% to Rp155 billion in2012, compared to Rp128 billion from the previous year.Deferred Tax Liabilities – NetIn 2012 deferred tax liabilities – net increased by 11% from Rp10billion in the previous year to Rp11 billion.Obligations under Finance Leases Net of CurrentMaturitiesThe Company’s obligations under finance leases net of currentmaturities in 2012 was recorded at Rp0.08 billion, a decline by78.5% from Rp0.36 billion in 2011.Long-term Liabilities for Employees’ BenefitsIn 2012 the Company recorded an increase for estimated liabilitiesfor employees’ service entitlement benefits by 21.9%, amountingto Rp144 billion compared to the previous Rp118 billion in 2011.
  • 151. PT Kalbe Farma Tbk. • 2012 Annual Report 149EkuitasEkuitas Perseroan meningkat sebesar 13,1% mencapai Rp7.372miliar dari Rp6.515 miliar di tahun 2011. Peningkatan tersebutterutama disumbangkan oleh akumulasi saldo laba yangmencapai sebesar Rp7.251 miliar di tahun 2012 dari Rp6.407miliar tahun 2011, atau meningkat sebesar 13,2%. Sehubungandengan program pembelian kembali saham, jumlah saham yangdibeli kembali oleh Perseroan dikurangi porsi yang dijual padatahun 2010 mencapai sebanyak 3.904.950.000 saham (setelahpemecahan nilai nominal saham) dengan nilai perolehan sebesarRp687 miliar.Ekuitas EquitiesKeterangan2012 2011Naik (Turun)Increase (Decrease)DescriptionRp MiliarRp Billion%Rp MiliarRp Billion%Rp MiliarRp Billion%Modal Saham 508 6.9 508 7.8 - 0.0 Capital StockTambahan Setoran Modal (32) -0.4 (32) -0.5 - 0.0 Additional Paid-in CapitalSelisih Transaksi denganPihak Non-Pengendali(3) 0.0 (3) 0.0 - 0.0Differences Arising fromTransaction with Non-Controlling InterestSaldo Laba Retained EarningsTelah DitentukanPenggunaannya77 1.0 62 1.0 15 23.8 AppropriatedBelum DitentukanPenggunaannya7,174 97.3 6,345 97.4 828 13.1 UnappropriatedModal Treasuri (687) -9.3 (687) -10.5 - 0.0 Treasury StockPendapatan (Beban)Komprehensif Lainnya:Other ComprehensiveIncome (Expenses):Selisih Kurs AtasPenjabaran LaporanKeuangan3 0.0 2 0.0 1 52.8Differences Arisingfrom Foreign CurrencyTranslationsLaba (Rugi) BelumDirealisasi atas Kenaikan(Penurunan) Nilai PasarInvestasi, Neto15 0.2 20 0.3 -5 -26.0Unrealized Gains(Losses) on Appreciation(Decline) in MarketValues Of Investments,NetSub-total 7,054 6,215 Sub-totalKepentingan Non-pengendali318 4.3 301 4.6 16 5.5 Non-controlling InterestEkuitas, Neto 7,372 100.0 6,516 100.0 856 13.1 Equity, NetPada tahun 2012, Perseroan meningkatkan pembayaran dividentunai atas laba tahun 2011 menjadi Rp95 per lembar saham,naik dari Rp70 per lembar saham. Hal ini menunjukkan rasiopembayaran dividen sebesar 60%, lebih tinggi dari kebijakandividen Perseroan sebesar 50% yang dibayarkan pada tahunsebelumnya.Likuiditas dan Struktur PermodalanManajemen tetap menekankan pentingnya menjaga tingkatlikuiditas untuk mendukung aktivitas dan pertumbuhan usaha.Total kas dan setara kas mencapai Rp1.860 miliar di akhir 2012.Kalbe mempertahankan kemampuannya untuk menghasilkanarus kas operasional yang solid selama tahun 2012, yangEquitiesThe Company’s equities increased by 13.1%, reaching Rp7,372billion, from Rp6,516 billion in 2011. The increase was mostlyaccounted for by retained earnings accumulation which reachedRp7,251 billion in 2012 from Rp6,407 billion in 2011, or risingby 13.2%. In relations with the share repurchase program, upto December 31, 2012, number of shares repurchased by theCompany less the portion sold in 2010 was 3,904,950,000 shares(after stock split) at a total cost of Rp687 billion.In 2012, the Company increased its cash dividend payment onfiscal year 2011 profit amounting to Rp95 per share, up from Rp70per share. This represented a dividend payout ratio of up to 60%,from our dividend policy of 50% applied in the previous year.Liquidity and Capital StructureManagement continued to underline the importance ofmaintaining liquidity in supporting business activities and growth.Cash and cash equivalents reached Rp1,860 billion at the end of2012. Kalbe maintained strong operating cash flow generation in2012, which was subsequently used to finance various funding
  • 152. Performance HighlightsManagement ReportCompany ProfileManagement Discussion and AnalysisCorporate GovernanceCorporate Social ResponsibilityPT Kalbe Farma Tbk. • Laporan Tahunan 2012150kemudian digunakan untuk membiayai berbagai kebutuhanpendanaan dan investasi, termasuk belanja modal, pembayaranutang, pembayaran dividen serta kegiatan penggabungan usahadan akuisisi.Dengan dibentuknya tim khusus untuk menangani pengelolaanrantai pasokan, secara konsisten Perseroan telah berhasilmemperbaiki siklus operasional bersihnya mencapai 114 hari,termasuk perputaran persediaan mencapai 107 hari. Pencapaiantersebut menunjukkan perbaikan yang signifikan dibandingkankondisi di tahun 2008 sebelum dibentuknya tim khusus, di manasiklus operasional bersih dan perputaran persediaan masing-masing sebesar 158 hari dan 142 hari.Perseroan mempertahankan rasio pinjaman terhadap ekuitasyang sangat rendah sebesar 2,8%. Rasio tersebut relatif stabildibandingkan pencapaian tahun 2011 sebesar 2,2%. Rasiobeban bunga pinjaman tercatat sebesar 139x, lebih rendah daripencapaian tahun 2011 sebesar 164x akibat lebih tingginya saldopinjaman dan beban bunga, namun secara keseluruhan masihsangat solid. Rasio tersebut menunjukkan tingginya kemampuanPerseroan dalam membayar kewajiban bunga pinjamannya.Dengan jumlah pinjaman yang rendah serta arus kas yang solid,Kalbe berhasil mempertahankan posisi kas netonya di akhir tahun2012 sebesar Rp1.655 miliar.Walaupun Perseroan memiliki saldo kas yang solid, jika adakebutuhan untuk meningkatkan pendanaan, Perseroan dapatmemperoleh pembiayaan dari sektor perbankan, institusikeuangan, melalui penerbitan surat hutang atau melalui pasarmodal dengan penawaran umum terbatas. Selama tahun 2012,Perseroan telah memperoleh fasilitas pinjaman dalam mata uangRupiah, Dolar A.S. dan Dolar Singapura dari beberapa bank,termasuk PT Bank CIMB Niaga Tbk., PT Bank Central Asia Tbk.,PT Bank Permata Tbk., The Hong Kong and Shanghai BankingCorporation Ltd. dan DBS Bank Singapore. Suku bunga fasilitaspinjaman tersebut berkisar antara 1,92% - 9,50% per tahun dimana pinjaman bank tersebut dipergunakan untuk mendukungkebutuhan modal kerja Perseroan.Laporan Arus Kas KonsolidasianLaporan Arus Kas Konsolidasian Consolidated Statements of Cash FlowsTahun YearKeterangan2012 2011Naik (Turun)Increase (Decrease)DescriptionRp MiliarRp BillionRp MiliarRp Billion%Kas Neto Diperoleh dari AktivitasOperasi1,376 1,473 (97) -6.6Net Cash Provided by OperatingActivitiesKas Neto Digunakan untuk AktivitasInvestasi(915) (631) (284) 44.9 Net Cash Used in Investing ActivitiesKas Neto Digunakan untuk AktivitasPendanaan(921) (407) (514) 126.4 Net Cash Used in Financing Activitiesand investments requirements including capital expenditures,debt service needs, dividend payment as well as mergers andacquisitions.With a focus task force concentrating on supply chainmanagement, the Company has consistently improved its netoperating cycle, currently at 114 days, including inventoryturnover of 107 days. Significant improvement has been achievedcompared to the condition in 2008 prior to the formation of thetask force, where operating cycle and inventory turnover was 158days and 142 days, respectively.The Company maintains very low debt to equity ratio at 2.8%.The ratio has been stable compared to 2.2% recorded in 2011.Interest coverage ratio was recorded at 139x, lower comparedto 164x recorded in 2011 due to higher outstanding borrowingand interest expense, but overall stil considered very solid. Thisratio revealed the strength of the Company’s ability to meetinterest payments obligation. With low debt and strong cash flowgeneration, Kalbe maintained a net cash position at the end of2012 at Rp1,655 billion.Aside from the Company’s strong cash balance, should there berequirements to raise capital; avenues are open to raise financingfrom banks, financial institutions, bonds issuance or through thecapital markets in the form of rights issue. In 2012, the Companyobtained loan facilities in Rupiah, U.S. Dollar and Singapore Dollarfrom several banks, including PT Bank CIMB Niaga Tbk, PT BankCentral Asia Tbk., PT Bank Permata Tbk., The Hong Kong andShanghai Banking Corporation Ltd. and DBS Bank Singapore.Interest rates for these loan facilities ranged between 1.92% -9.50% per year, and these bank loans were utilized to support theCompany’s working capital needs.Consolidated Statements of Cash Flows
  • 153. PT Kalbe Farma Tbk. • 2012 Annual Report 151Kemampuan Perseroan untuk menghasilkan arus kas yangsehat merupakan bukti kinerja keuangan yang positif danmenjadi landasan untuk mendukung perluasan usaha. Kalbeterus mengambil langkah-langkah untuk meningkatkankemampuannya dalam menghasilkan arus kas melalui upayapeningkatan produktivitas dan memperkokoh siklus arus kasnyamelalui perbaikan rantai pasokan secara berkelanjutan yang telahmenghasilkan level siklus operasional bersih yang lebih optimal.Kas Neto Diperoleh dari Aktivitas OperasiDi tahun 2012, arus kas dari aktivitas operasi mencapai Rp1.376miliar, menurun 6,6% dari Rp1.473 miliar yang dicapai tahun2011. Perseroan mencatat peningkatan pada penerimaankas dari pelanggan dan pembayaran kas ke pemasok dan kekaryawan selama tahun 2012, yang merefleksikan pertumbuhanpenjualan yang mendorong peningkatan kebutuhan modal kerjauntuk mendukung pertumbuhan. Pembayaran kepada pemasokmeningkat sebagaimana tercermin dari perputaran utang yangmenurun ke tingkat 41 hari pada akhir tahun 2012, dibandingkan57 hari pada tahun sebelumnya. Pembayaran pajak penghasilanmeningkat 24,0% terutama sehubungan dengan pertumbuhanusaha, sedangkan pembayaran untuk beban operasi lainnyamengalami peningkatan sebesar 6,6%, terutama terkait denganpeningkatan beban penjualan dan pemasaran.Kas Neto Digunakan untuk Aktivitas InvestasiPengeluaran untuk aktivitas investasi meningkat dari Rp631miliar di tahun 2011 menjadi Rp915 miliar tahun 2012, terutamaseiring peningkatan perolehan aset tetap dan akuisisi atasPT Hale International. Akuisisi aset tetap meningkat 67,0%mencapai Rp783 miliar. Peningkatan belanja modal di tahun 2012terutama didorong oleh pelaksanaan ekspansi jaringan distribusiserta pengeluaran untuk pembangunan fasilitas untuk obat-obatkhusus di Pulogadung, Jakarta yang diperkirakan akan selesai ditahun 2013.Kas Neto Digunakan untuk Aktivitas PendanaanArus kas untuk aktivitas pendanaan tercatat meningkat 126,4% ditahun 2012 menjadi Rp921 miliar dari Rp407 miliar di tahun 2011.Peningkatan ini terutama didorong oleh peningkatan pembayarandividen kas sebesar Rp95 per saham dari Rp70 per saham.Dengan demikian rasio pembagian dividen khusus mencapaihingga 60% dibandingkan sebesar 51% yang diberlakukan ditahun sebelumnya.PemasaranKegiatan pemasaran senantiasa menjadi pendukung penting bagipertumbuhan penjualan Kalbe yang berkelanjutan. Selama tahun2012, Perseroan terus meluncurkan strategi pemasaran yangterfokus agar dapat meningkatkan efektivitas pemasarannyaserta membangun hubungan lebih erat dengan para konsumen.Keempat Divisi mengelola tim penjualan dan pemasaran yangcukup besar serta jaringan distribusi yang luas guna melayaniarea kepulauan Indonesia.Healthy cash flows generation remain a top priority for theCompany as a sign of solid financial performance and a foundationto support business expansion. Kalbe continued to take actionsto improve its cash generation through productivity improvementmeasures and efforts to strengthen its cash generation cyclethrough continuous supply chain management improvements,which has resulted in more optimal net operating cycle.Net Cash Provided by Operating ActivitiesIn 2012, cash flows from operating activities reached Rp1,376billion, down by 6.6% from Rp1,473 billion achieved in 2011. TheCompany recorded higher cash received from customers andhigher payment to suppliers and employees in 2012, reflectingsales growth along with higher working capital requirements tosupport the growth. Higher payment to suppliers was reflectedon the lower days of payable of 41 days at the end of 2012,compared to 57 days in the previous year. Payment of incometaxes increased by 24.0% mainly related to business growth,while payment for other operating expenses increased by 6.6%mostly related to increase in selling and marketing expense.Net Cash Used in Investing ActivitiesExpenditures for investing activities increased from Rp631 billionin 2011 to Rp915 billion in 2012, mostly attributable to increasein acquisitions of property, plant and equipment, as well as theacquisition of PT Hale International. Acquisitions of property,plant and equipment increased by 67.0% to reach Rp783 billion.Higher capital expenditures in 2012 was mainly resulted fromthe expansion of distribution network and spending for theconstruction of facility for specialty drugs in Pulogadung, Jakartathat will be completed in 2013.Net Cash Used in Financing ActivitiesCash flows used in financing activities increased by 126.4% in2012 to Rp921 billion from Rp407 billion in 2011. This increasewas mostly due to higher payment for cash dividend amountingto Rp95 per share, up from Rp70 per share. This represented aspecial dividend payout ratio of up to 60%, from 51% as appliedin the previous year.MarketingMarketing activities have always been important contributor toKalbe’s sustainable sales growth. During 2012, the Companycontinued to introduce a well targeted marketing strategy aimingat improving its marketing effectiveness and building closerrelationship with consumers.Kalbe’s four Divisions manage large sales and marketing teamsas well as an extensive distribution channel to cover Indonesiaarchipelago.
  • 154. Performance HighlightsManagement ReportCompany ProfileManagement Discussion and AnalysisCorporate GovernanceCorporate Social ResponsibilityPT Kalbe Farma Tbk. • Laporan Tahunan 2012152Divisi Obat Resep didukung oleh tim penjualan dan pemasaranyang terbesar di sektor farmasi Indonesia, yang terdiri dari lebihdari 2.300 medical representatives dan menguasai pangsa pasarfarmasi, baik di apotek maupun rumah sakit di Indonesia. DivisiProduk Kesehatan mengelola lebih dari 1.000 tenaga pemasaranyang menangani lebih dari 150.000 outlet secara langsung serta1 juta outlet secara tidak langsung. Divisi Nutrisi didukung olehsekitar 1.000 tenaga pemasaran, termasuk tim telemarketing,yang secara aktif berinteraksi dengan para konsumen. DivisiDistribusi dan Logistik mengoperasikan 65 cabang di 47 kota diIndonesia.Laporan lengkap kegiatan pemasaran Kalbe selama tahun 2012dapat dilihat di bagian Tinjauan Pemasaran di Laporan Tahunanini.ProduksiKemampuan produksi Perseroan yang solid didukung olehtotal sebanyak 11 fasilitas produksi, 10 diantaranya berada diIndonesia dan 1 berlokasi di Nigeria. Di tahun 2012, Perseroanmeresmikan fasilitas produksi khusus untuk obat generik tanpamerek dengan kapasitas produksi 87 juta tablet per bulan untukmendukung strategi Kalbe untuk memperkuat kehadirannya disegmen obat generik tanpa merek. Melalui proses akuisisi, padatahun 2012 Perseroan memperoleh fasilitas produksi pertamauntuk pembuatan minuman siap saji. Melalui fasilitas tersebut,Kalbe berharap dapat mempercepat proses ekspansinya disegmen minuman kesehatan.Fasilitas produksi Perseroan telah memenuhi persyaratan-persyaratan nasional tentang standar Cara Pembuatan Obat yangBaik (CPOB) yang ditetapkan oleh Badan Pengawas Obat danMakanan (BPOM). Fasilitas-fasilitas Perseroan juga telah meraihsertifikasi dengan standar yang diakui secara internasional sepertiISO 9001 untuk Sistem Manajemen Kualitas, ISO 14001 untukStandar Manajemen Lingkungan, OHSAS 18001 unuk Kesehatandan Keselamatan Kerja, HACCP atau Hazard Analysis and CriticalControl Points untuk analisis keamanan makanan dan ISO 22000untuk manajemen keamanan makanan.Saat ini Perseroan sedang dalam proses finalisasi pembangunanfasilitas produksi untuk obat kanker yang diperkirakan akanselesai pada tahun 2013. Fasilitas tersebut akan menjadi pabrikproduk obat kanker Kalbe pertama di Indonesia guna mendukungstrategi Kalbe untuk meningkatkan ketersediaan obat kankerdengan harga terjangkau bagi masyarakat Indonesia.Investasi Barang ModalGuna mendukung pertumbuhan organik, Perseroan senantiasamengalokasi sebagian dari dananya untuk kebutuhan investasibarang modal. Di tahun 2012, Perseroan menginvestasikan danasejumlah Rp783 miliar untuk kebutuhan pembelian aset tetap,termasuk investasi untuk pembangunan pabrik obat kanker sertaperluasan infrastruktur distribusi dan logistik Perseroan. Selamatahun 2012, EMPT terus melaksanakan rencana perluasannyaKalbe’s Prescription Pharmaceuticals Division is supportedby the largest team of sales and marketing in the country’spharmaceuticals sector, comprising over 2,300 medicalrepresentatives and leading pharmaceutical market share inIndonesia, both in pharmacy and hospital. The Consumer HealthDivision manages more than 1,000 salespeople, who directlycover more than 150,000 outlets and another 1 million outletsindirectly. The Nutritionals Division is supported by roughly 1,000salespeople, which includes the telemarketing team who interactactively with the consumers. Finally, the Distribution and LogisticsDivision operates 65 branches in 47 cities across Indonesia.A full report of Kalbe’s marketing activities during 2012 is availablein the Marketing Review section of this Annual Report.ManufacturingKalbe’s strong manufacturing capability is supported by a totalof 11 production facilities, 10 of which are located in Indonesiaand 1 located in Nigeria. In 2012, we inaugurated 1 productionfacility dedicated for unbranded generics with a capacity of 87million tablets per month to support the Company’s strategy tostrengthen its presence in unbranded generic segment. Throughacquisition, in 2012 we obtained our first production facilityfor beverage production. By obtaining this facility we hope toaccelerate our expansion into the health beverage segment.Our production facilities comply with local requirements forcurrent Good Manufacturing Practice (GMP) standard for drugmaunfacturing issued by the National Agency of Food and DrugControl (BPOM). Our facilities are certified with internationallyrecognized standards such as ISO 9001 for Quality ManagementSystem, ISO 14001 for Environmental Management Standard,OHSAS 18001 for Occupational Health and Safety, HACCPor Hazard Analysis and Critical Control Points for food safetyanalysis, and ISO 22000 for food safety management.The Company is currently in the process of finalising theconstruction of a manufacturing facility for oncology drugs,which is expected to be completed in 2013. This facility will beKalbe’s first cancer drug manufacturer in Indonesia to supportKalbe’s strategy to improve the availability of oncology productsfor Indonesian people at a more affordable price.Capital ExpendituresTo support organic growth, the Company continuously setsaside a portion of fund to finance capital expenditures. In 2012,the Company spent Rp783 billion for acquisition of property,plant and equipment including expenditures spent on theconstruction of the oncology factory as well as the expansion ofour distribution and logistics infrastructure. In year 2012, EPMTcontinued its expansion plan to upgrade several branches as
  • 155. PT Kalbe Farma Tbk. • 2012 Annual Report 153dengan melakukan peremajaan beberapa cabangnya sertapembelian tanah untuk penambahan cabang dan investasipembaharuan infrastruktur TI. Pengeluaran barang modaltahun 2012 juga dipergunakan untuk proses pemeliharaan danperemajaan mesin-mesin produksi, pembelian mesin produksidan peralatan laboratorium baru untuk kebutuhan unit penelitiandan pengembangan, peremajaan perangkat TI, perluasan aplikasibisnis dan infrastruktur TI terpadu serta pembelian lainnya sepertiperlengkapan perkantoran.Ikatan Material untuk Investasi Barang ModalSelama tahun 2012, tidak terdapat ikatan material untuk investasibarang modal yang dilakukan Perseroan.Kebijakan DividenKalbe memiliki komitmen untuk membagikan dividen tunai setiaptahun dalam rangka meningkatkan nilai bagi pemegang sahamyang dilakukan dengan mempertimbangkan laba yang diperoleh,kondisi keuangan Perseroan, kewajiban pembentukan danacadangan sesuai dengan peraturan yang berlaku serta rencanaperluasan usaha Perseroan. Kebijakan dividen Perseroan adalahuntuk membagikan paling sedikit 50% dari labanya.Dividen untuk Tahun Fiskal Dividend for Fiscal YearsKeterangan 2011 2010 2009 2008 2007 DescriptionDividen Tunai (Rp/lembar)* 95.0 70.0 25.0 12.5 10.0 Cash Dividend (Rp/share)Rasio Pembagian Dividen (%) 60 51 26 17 14 Dividend Payout Ratio (%)*Sebelum pemecahan nilai nominal saham (stock split)Before stock splitBerdasarkan Rapat Umum Pemegang Saham Tahunan (RUPST)tanggal 23 Mei 2012, Perseroan memutuskan untuk membagikandividen tunai kepada para pemegang saham sebesar Rp95per saham (sebelum pemecahan nilai nominal saham), tidaktermasuk saham yang telah dibeli kembali oleh Perseroan, atausejumlah Rp 891 miliar yang dibayarkan pada tanggal 17 Juli2012. Pada tahun 2012, rasio pembagian dividen mencapai 60%seiring keputusan Perseroan untuk membagikan dividen khusussejalan dengan saldo kas Perseroan yang kuat. Pada tahun 2011,Perseroan membagikan dividen sebesar Rp70 per lembar sahamatau setara dengan Rp656 miliar.Realisasi Penggunaan Dana Hasil PenawaranUmumBerdasarkan persetujuan RUPS EPMT pada tanggal 2 Maret2011, EPMT melakukan Penawaran Umum Terbatas I kepadapara pemegang saham dalam rangka penerbitan hak memesanefek terlebih dahulu sejumlah 428.640.000 saham dengan nilainominal Rp50 per saham. Total perolehan dana tercatat sebesarRp300 miliar, atau sebesar Rp298 miliar setelah dikurangi biayapenerbitanhakmemesanefekterlebihdahulu.Danayangdiperolehdirencanakan akan digunakan untuk membiayai pembangunanPusat Distribusi Regional, pembelian tanah, peremajaan cabang,dan pembaharuan struktur teknologi informasi. Sampai dengan31 Desember 2011, saldo dana tercatat sebesar Rp260 miliar.well as purchase lands for additional branches and investmentin IT infrastructure upgrade. Capital expenditure in 2012 wasalso used for maintenance and renewal of manufacturingmachineries, the purchase of both new machinery and laboratoryequipment for the research and development unit, renovation ofIT hardware, expansion of business applications and integratedIT infrastructures and other purchases for items such as officesupplies.Material Ties for Investment of Capital GoodsDuring 2012, there were no material ties for investment of capitalgoods.Dividend PoliciesKalbe is committed to distribute dividend payment to shareholdersevery year to increase total shareholders’ return. Determinationof dividend is conducted after taking into account the incomefor the year, the Company’s financial condition, the obligationsto allocate reserves in accordance with laws and regulation, aswell as the Company’s expansion plan. The Company’s dividendpolicy is to distribute at least 50% of its net income.Based on Annual General Meeting of Shareholders (AGMS) heldon Wednesday, May 23, 2012, the Company decided to distributecash dividends to the shareholders amounting to Rp95 per share(before stock split), excluding the Company’s treasury shares, orequivalent to Rp 891billion which was paid on July 17, 2012. In2012, our dividend payout reached 60% as the Company decidedto distribute special dividend on account of strong cash balance.In previous year, the Company paid dividend of Rp 70 per shareor equivalent to Rp 656 billion.Usage of Proceeds from Rights IssueBased on the approval by the GMS of EPMT, dated March 2, 2011,EPMT conducted Rights Issue I to shareholders in in relation withthe issuance of pre-emptive rights of 428,640,000 shares, at a parvalue of Rp50 per share. Total proceeds received were recordedas amounting to Rp300 billion, or Rp298 billion after rights issuecost deductions. Proceeds were to be directed for financing theconstruction of additional Regional Distribution Centers, landpurchases, branch renovations, and updates of informationtechnology structure. As of December 31, 2011, the fund balancewas recorded at Rp260 billion. In 2012 EPMT continued with theexpansion plan for branches upgrading, purchase of land and
  • 156. Performance HighlightsManagement ReportCompany ProfileManagement Discussion and AnalysisCorporate GovernanceCorporate Social ResponsibilityPT Kalbe Farma Tbk. • Laporan Tahunan 2012154Sepanjang tahun 2012, EMPT melanjutkan rencana perluasanusahanya melalui upaya peremajaan cabang, pembelian tanahdan pembaharuan Teknologi Informasi (TI). Per 31 Desember,2012 saldo dana dari penerbitan saham dengan hak memesandahulu adalah sebesar Rp160 miliar.Transaksi Material dan Kejadian Luar BiasaPada tanggal 6 Juli 2012, Perseroan merampungkan akuisisi atasPT Hale International senilai Rp98.6 miliar untuk memperkuatbasis produksi dalam segmen minuman siap saji. Tidak terdapattransaksi yang material lainnya dalam bentuk investasi, ekspansi,divestasi, akuisisi atau restrukturisasi utang/modal maupunkejadian luar biasa di dalam Perseroan selama tahun 2012.Transaksi yang Mengandung BenturanKepentingan dan Transaksi Dengan PihakBerelasiSelama tahun 2012, tidak terdapat transaksi yang mengandungbenturan kepentingan yang dilakukan Perseroan.Dalam kegiatan usaha normal, Grup Kalbe melakukan transaksidengan pihak berelasi tertentu, yaitu PT Asuransi Mitra Maparya(AMM) sebagai pihak yang berelasi, dan Orange Kalbe Limited(OKL), entitas asosiasi. AMM merupakan entitas sepengendalisementara OKL merupakan entitas asosiasi di mana Perseroanmemiliki penyertaaan sebesar 30%.Perseroan membeli polis asuransi dari AMM dengan totalkeseluruhan nilai pertanggungan asuransi sejumlah Rp3.842miliar, US$43,3 juta, SGD108 ribu, JP¥750 ribu dan EUR5,2juta pada tanggal 31 Desember 2012, dan sejumlah Rp3.278miliar, US$42,2 juta, SGD108 ribu dan JP¥750 ribu pada tanggal31 Desember 2011. Polis asuransi tersebut untuk melindungisebagian persediaan dan aset tetap Perseroan dari risiko kerugianakibat kebakaran, kebanjiran dan risiko lainnya.Entitas Anak Perseroan melakukan pembelian barang jadidari OKL dengan total nilai pembelian masing-masing sebesarUS$1.068.782 (atau setara Rp10,07 miliar) and US$1.276.831(atau setara Rp11,20 miliar) di tahun 2012 dan 2011.Kejadian Setelah Tanggal NeracaTidak terdapat kejadian antara tanggal 31 Desember 2012 dantanggal penyampaian laporan tanggal 8 Maret 2013 yang perludilaporkan.Perubahan Peraturan Perundang-undanganSelama tahun 2012, terdapat beberapa perubahan peraturanyang diberlakukan Pemerintah, yang dapat memberikan dampakpenting bagi kegiatan usaha Perseroan, termasuk sebagaiberikut:1. Keputusan Menteri Kesehatan Nomor 092/Menkes/SK/II/2012 tentang Harga Eceran Tertinggi Obat Generik Tahun2012, menggantikan Keputusan Menteri Kesehatan No. 632/Menkes/ SK/III/ 2011.Information Technology (IT) upgrade. As of December 31, 2012the fund balance from rights issue amounted to Rp160 billion.Material Transactions and Extraordinary EventsOn July 6, 2012, the Company completed acquisition of PT HaleInternational of Rp98.6 billion to strengthen production basis ofready-to-drink segment. No other material transactions in theform of investment, expansion, divestment, acquisition and debt/capital restructuring or extraordinary events took place in theCompany during 2012.Transactions Containing Conflict of Interest andTransactions with Related PartiesDuring 2012, no transactions containing conflict of interest wereundertaken.Kalbe Group, in its regular conduct of business, engages intransactions with certain related parties, PT Asuransi MitraMaparya (AMM), a related party, and Orange Kalbe Limited(OKL), associated entity. AMM is an entity under common control,while OKL is associated entity whereby the Company has a 30%stake.The Company obtained insurance policies from AMM, withcombined insurance coverage amounting to Rp3,842 billion,US$ 43.3 million, SGD 108 thousand, JP¥ 750 thousand andEUR 5.2 million as of December 31, 2012, and Rp3,278 billion,US$42.2 million, SGD108 thousand and JP¥750 thousand as ofDecember 31, 2011. The said insurance policies covered portionsof inventories and property, plant and equipment against risks oflosses by fire, flood and other risks, on a blanket basis.The Company’s Subsidiary purchased finished goods from OKLwith total purchase of US$1,068,782 (equivalent to Rp10.07billion) and US$1,276,831 (equivalent to Rp11.20 billion) in 2012and 2011, respectively.Subsequent EventsThere is no subsequent event to be reported between December31, 2012 and the date of the report issuance on March 8, 2013.Changes in Laws and RegulationsIn 2012, there were changes in the regulations enacted by theGovernment, that may have a significant impact on the Company’sbusiness activities, included the following:1. Ministry of Health Decree No. 092/Menkes/SK/II/2012concerning Price Caps on Key Generic Drugs in 2012,replacing the previous Ministry of Health Decree No. 632/Menkes /SK/III/2011.
  • 157. PT Kalbe Farma Tbk. • 2012 Annual Report 155 Peraturan ini diterbitkan pada tanggal 23 Februari 2012yang menetapkan harga jual eceran tertinggi untuk 498 jenisobat generik di apotek, rumah sakit, dan fasilitas kesehatanlainnya yang berlaku di seluruh di Indonesia. Bersamaandengan keputusan tersebut, telah diterbitkan pada tanggalyang sama Keputusan Menteri Kesehatan Nomor 094/Menkes/ SK/II /2012 yang mengatur perbedaan harga obattertinggi untuk berbagai daerah, untuk kebutuhan obat padafasilitas kesehatan yang dimiliki oleh Pemerintah. Peraturanini menggantikan Keputusan Menteri Kesehatan Nomor 633/Menkes/ SK/III/2011.2. Peraturan Menteri Perdagangan Nomor 59/M-DAG/ PER/ 9/2012 tentang Perubahan atas Peraturan Menteri PerdaganganNomor 27 tentang Ketentuan Angka Pengenal Impor (API) Mengatur persyaratan untuk memperoleh Angka PengenalImpor yang dibedakan antara distributor dan produsen.Peraturan ini secara efektif membatasi import produk jadi olehprodusen.3. Keputusan Presiden Nomor 101 Tahun 2012 tentang PenerimaBantuan Iuran Jaminan Kesehatan Menetapkan bahwa kriteria masyarakat tidak mampu yangberhak menerima subsidi kesehatan akan ditetapkan olehKementerian yang bertanggung jawab pada kesejahteraansosial berkorodinasi dengan kementerian dan institusiterkait. BPJS Kesehatan sebagai penentu kebijakan yangbertanggung jawab atas sistem tunjangan kesehatan nasionalakan menerbitkan nomor identifikasi unik bagi para penerimatunjangan. Anggaran untuk tunjangan akan menggunakananggaran Pemerintah.Perubahan Kebijakan AkuntansiAset TetapEfektif tanggal 1 Januari 2012, Grup Kalbe menerapkanPernyataan Standar Akuntansi Keuangan (PSAK) No. 16 (Revisi2011), “Aset Tetap” dan Interpretasi Standar Akuntansi Keuangan(ISAK) No. 25, “Hak atas Tanah”.Adopsi PSAK No. 16 yang direvisi tidak memberikan pengaruhyang signifikan terhadap pelaporan keuangan dan pengungkapandari Grup Kalbe.ISAK No. 25 menetapkan bahwa biaya pengurusan legal hakatas tanah dalam bentuk Hak Guna Usaha (HGU), Hak GunaBangunan (HGB) dan Hak Pakai (HP) ketika tanah diperolehpertama kali diakui sebagai bagian dari biaya perolehan tanahpada akun “Aset Tetap” dan tidak diamortisasi. Sementara biayapengurusan atas perpanjangan atau pembaruan legal hak atastanah dalam bentuk HGU, HGB dan HP diakui sebagai bagiandari akun “Beban Tangguhan” pada laporan posisi keuangankonsolidasian dan diamortisasi sepanjang mana yang lebihpendek antara umur hukum hak dan umur ekonomi tanah. This regulation was issued on February 23, 2012 anddetermines the selling and retail price caps on 498 genericdrugs for pharmacies, hospitals and other healthcareinstitutions throughout Indonesia. Together with this, Ministryof Health Decree No. 094/Menkes/ SK/II /2012 was issued onthe same date and regulated different price caps, based ondifferent regions, for government procurement in governmenthealthcare facilities. This regulation replaced Ministry of HealthDecree No. 633/ Menkes/ SK/III/2011.2. Regulation of the Minister of Trade No. 59/M-DAG/ PER/ 9/2012 regarding The Change in the Minister of Trade RegulationNo. 27 regarding Import Identification Number (API) Regulating the requirement to obtain Import IdentificationNumber which is differentiated for distributor and producer.This regulation effectively restricts import of finished productsby producers.3. Presidential Decree No. 101 Year 2012 regarding The Recipientof Subsidy for Healthcare Insurance Regulating that the criteria of poor population membersentitled to receive healthcare subsidy will be determined bythe Minister in charge of social affairs in coordination with therelated ministry and institution. BPJS Health as the regulatorybody in charge of national healthcare insurance systemwill provide single identification number to the recipientsof subsidy. Budget for subsidy will be sourced from thegovernment budget.Changes in Accounting PoliciesProperty, Plant and EquipmentEffective on January 1, 2012, Kalbe Group applies Statements ofFinancial Accounting Standards (PSAK) No. 16 (Revised 2011),“Fixed Assets” and Interpretations to Financial AccountingStandards (ISAK) No. 25, “Land Rights”.Adoption of the revised PSAK No. 16 has no significant impact onthe financial reporting and disclosures of Kalbe Group.ISAK No. 25 prescribes that the legal cost of land rights in theform of Business Usage Rights (Hak Guna Usaha or HGU),Building Usage Right (Hak Guna Bangunan or HGB) and UsageRights (Hak Pakai or HP) when the land was acquired initially arerecognized as part of the cost of the land under the “Fixed Assets”account and not amortized. Meanwhile, the extension or the legalrenewal costs of land rights in the form of HGU, HGB and HPwere recognized as part of “Deferred Charges” account in theconsolidated statements of financial position and were amortizedover the shorter of the rights’ legal life and land’s economic life.
  • 158. Performance HighlightsManagement ReportCompany ProfileManagement Discussion and AnalysisCorporate GovernanceCorporate Social ResponsibilityPT Kalbe Farma Tbk. • Laporan Tahunan 2012156Sesuai dengan ketentuan transisi ISAK No. 25 tersebut, saldobiaya yang belum diamortisasi dari pengurusan awal legal hakatas tanah dalam bentuk HGU, HGB dan HP diakui sebagaibagian dari akun “Beban Tangguhan” pada laporan posisikeuangan konsolidasian sebelum tanggal 1 Januari 2012 sebesarRp7.561.411.489 direklasifikasi ke akun “Aset Tetap” danamortisasinya dihentikan pada tanggal 1 Januari 2012.Aset tetap, kecuali tanah, dinyatakan sebesar biaya perolehandikurangi penurunan nilai, jika ada. Biaya perolehan termasukbiaya penggantian bagian aset tetap saat biaya tersebut terjadi,jika memenuhi kriteria pengakuan. Selanjutnya, pada saatinspeksi yang signifikan dilakukan, biaya inspeksi itu diakui kedalam jumlah tercatat (“carrying amount”) aset tetap sebagaisuatu penggantian jika memenuhi kriteria pengakuan. Semuabiaya pemeliharaan dan perbaikan yang tidak memenuhi kriteriapengakuan diakui sebagai laba rugi pada saat terjadinya.Grup Kalbe umumnya menghitung penyusutan denganmenggunakan metode garis lurus (“straight-line method”), (kecualiuntuk aset tetap Entitas Anak tertentu PT Bintang Toedjoe dan PTTri Sapta Jaya), berdasarkan estimasi masa manfaat ekonomisaset tetap yang bersangkutan dengan rincian sebagai berikut:Depresiasi DepreciationKeteranganTahunYearsDescriptionBangunan dan Prasarana 10 - 20 Buildings and ImprovementsBangunan Kantor disewa 3 - 8 Leasehold ImprovementsMesin dan Peralatan 2 - 20 Machinery and EquipmentsPerlengkapan Kantor 2 - 8 Office Equipments, Furnitures and FixturesKendaraan dan Alat Transportasi 2 - 8 Vehicles and Transportation EquipmentsPeralatan Kesehatan 5 Medical EquipmentsPT Bintang Toedjoe, selain untuk bangunan dan prasarana,menghitung penyusutan dengan menggunakan metode saldomenurun ganda (“double-declining balance method”). Nilai bukuaset tetap yang dimiliki Entitas Anak tersebut adalah sekitar2,34% dan 1,83% dari nilai buku aset tetap konsolidasian,masing-masing pada tanggal 31 Desember 2012 dan 2011.PT Tri Sapta Jaya menghitung penyusutan kendaraan danperlengkapan kantor dengan menggunakan metode saldomenurun ganda (“double-declining balance method”). Nilai bukukendaraan dan perlengkapan kantor yang dimiliki Entitas Anaktersebut adalah sekitar 0,24% dan 0,52% dari nilai buku asettetap konsolidasian, masing-masing pada tanggal 31 Desember2012 dan 2011.Jumlah tercatat aset tetap dihentikan pengakuannya pada saatdilepaskan atau saat tidak ada manfaat ekonomis masa depanyang diharapkan dari penggunaan atau pelepasannya. Labaatau rugi yang timbul dari penghentian pengakuan aset (dihitungIn accordance with the transitional provision of ISAK No. 25,the unamortized balance of the initial legal costs in the form ofHGU, HGB and HP which were recognized as part of “DeferredCharges” account in the consolidated statements of financialposition prior to January 1, 2012 amounting to Rp7,561,411,489were reclassified to “Fixed Assets” account and ceased to beamortized on January 1, 2012.Property, plant and equipment, except land, are stated at costless any impairment in value, if any. Such cost includes the costof replacing part of the property, plant and equipment whenthat cost is incurred, if the recognition criteria is met. Likewise,when a major inspection is performed, its cost is recognized inthe carrying amount of the property, plant and equipment as areplacement if the recognition criteria is satisfied. All other repairsand maintenance costs that do not meet the recognition criteriaare recognized as profit or loss as incurred. Kalbe Group generally computes depreciation using the straight-line method (except for the certain Subsidiaries’ property, plantand equipment of PT Bintang Toedjoe and PT Tri Sapta Jaya),based on the estimated useful lives of the property, plant andequipment as follows: PT Bintang Toedjoe, except for building and improvements,computes depreciation using the double-declining balancemethod. The net book value of property, plant and equipment ofthe aforesaid subsidiary accounted for about 2.34% and 1.83% ofthe consolidated net book value of property, plant and equipmentas of December 31, 2012 and 2011, respectively.PT Tri Sapta Jaya computes the depreciation of its vehicles andoffice equipment using the double-declining balance method.The net book value of the aforesaid fixed assets accounted forabout 0.24% and 0.52% of the consolidated net book value ofproperty, plant and equipment as of December 31, 2012 and2011, respectively.An item of property, plant and equipment is derecognized upondisposal or when no future economic benefits are expected fromits use or disposal. Any gain or loss arising on derecognition ofthe asset (calculated as the difference between the net disposal
  • 159. PT Kalbe Farma Tbk. • 2012 Annual Report 157sebagai perbedaan antara jumlah neto hasil pelepasan danjumlah tercatat dari aset) diakui sebagai laba rugi pada tahun asettersebut dihentikan pengakuannya.Pada setiap akhir tahun buku, nilai residu, umur manfaat danmetode penyusutan ditelaah, dan jika sesuai dengan keadaan,disesuaikan secara prospektif.Tanah dinyatakan sebesar biaya perolehan dan tidak diamortisasikarena manajemen berpendapat bahwa kemungkinan besar hakatas tanah tersebut dapat diperbaharui/diperpanjang pada saatjatuh tempo.Aset dalam pengerjaan dinyatakan sebesar biaya perolehandan disajikan sebagai bagian dari “Aset Tetap” pada laporanposisi keuangan konsolidasian. Akumulasi biaya perolehan akandipindahkan ke masing-masing aset tetap yang bersangkutanpada saat aset tersebut selesai dikerjakan dan siap untukdigunakan.SewaEfektif tanggal 1 Januari 2012, Grup menerapkan PSAK No.30 (Revisi 2011), “Sewa”. Revisi terhadap PSAK No. 30 inimenetapkan bahwa klasifikasi dari setiap elemen sebagai sewapembiayaan atau sewa operasi secara terpisah bagi suatuperjanjian sewa yang mengandung elemen tanah dan bangunan.Adopsi PSAK No. 30 yang direvisi tidak memberikan pengaruhyang signifikan terhadap pelaporan keuangan dan pengungkapandari Grup Kalbe.Grup mengklasifikasikan sewa berdasarkan sejauh mana risikodan manfaat yang terkait dengan kepemilikan aset sewaan beradapada lessor atau lessee, dan pada substansi transaksi daripadabentuk kontraknya, pada tanggal pengakuan awal.Sewa Pembiayaan – sebagai LesseeSuatu sewa diklasifikasikan sebagai sewa pembiayaan jikasewa tersebut mengalihkan secara substansial seluruh risikodan manfaat yang terkait dengan kepemilikan aset sewa. Sewatersebut dikapitalisasi sejak awal masa sewa sebesar nilai wajaraset sewaan atau sebesar nilai kini dari pembayaran sewaminimum, jika nilai kini lebih rendah dari nilai wajar. Pembayaransewa minimum harus dipisahkan antara bagian yang merupakanbeban keuangan dan bagian yang merupakan pelunasanliabilitas, sedemikian rupa sehingga menghasilkan suatu tingkatsuku bunga periodik yang konstan atas saldo liabilitas. Bebankeuangan dibebankan langsung pada laba rugi.Jika terdapat kepastian yang memadai bahwa lessee akanmendapatkan hak kepemilikan pada akhir masa sewa, asetpembiayaan disusutkan selama masa penggunaan aset yangdiestimasi berdasarkan umur manfaat aset tersebut. Jika tidakterdapat kepastian tersebut, maka aset pembiayaan disusutkanproceeds and the carrying amount of the asset) is recognized asprofit or loss in the year the asset is derecognized.The asset’s residual values, useful lives and methods ofdepreciation are reviewed, and adjusted prospectively ifappropriate, at each financial year end.Land is stated at cost and not amortized as the management is ofthe opinion that it is probable that the title of the land rights canbe renewed/extended upon expiration.Constructions in progress are stated at cost and presented as partof “Property, Plant and Equipment” account in the consolidatedstatements of financial position. The accumulated costs will bereclassified to the appropriate property, plant and equipmentaccount when the construction is completed and the asset isready for its intended use.LeasesEffective on January 1, 2012, Kalbe Group applies PSAK No. 30(Revised 2011), “Lease”. The revised PSAK No. 30 prescribesseparate classification of each element as finance lease oroperating lease if lease comprises land and buildings.Adoption of the revised PSAK No. 30 has no significant impact onthe financial reporting and disclosures of Kalbe Group.The Group classifies leases based on the extent to which risks andrewards incidental to the ownership of a leased asset are vestedupon the lessor or the lessee, and the substance of transactionrather than the form of the contract, at inception date.Finance Lease - as LesseeA lease is classified as a finance lease if it transfers substantiallyall the risks and rewards incidental to ownership of the leasedassets. Such leases are capitalized at the inception of the leaseat the fair value of the leased assets or, if lower, at the presentvalue of the minimum lease payments. Minimum lease paymentsare apportioned between the finance charges and reduction ofthe lease liability so as to achieve a constant rate of interest onthe remaining balance of liability. Finance charges are chargeddirectly to profit or loss.If there is a reasonable certainty that the lessee will obtainownership by the end of the lease term, then, the leased assetsare depreciated over their useful life. If not, then the capitalizedleased assets are depreciated over the shorter of the useful lifeof the asset or the lease term. Gain or loss on a sale and finance
  • 160. Performance HighlightsManagement ReportCompany ProfileManagement Discussion and AnalysisCorporate GovernanceCorporate Social ResponsibilityPT Kalbe Farma Tbk. • Laporan Tahunan 2012158selama periode yang lebih pendek antara umur manfaat asetsewaan atau masa sewa. Laba atau rugi yang timbul daritransaksi jual dan sewa kembali ditangguhkan dan diamortisasiselama sisa masa sewa.Sewa Operasi – sebagai LesseeSuatu sewa diklasifikasikan sebagai sewa operasi jika sewa tidakmengalihkan secara substansial seluruh risiko dan manfaat yangterkait dengan kepemilikan aset. Dengan demikian, pembayaransewa diakui sebagai beban di tahun berjalan pada operasidengan menggunakan metode garis lurus (straight-line method)selama masa sewa.Transaksi dan Saldo Mata Uang AsingPada tanggal 1 Januari 2012, Grup Kalbe menerapkan PSAK No.10 (Revisi 2010), ”Pengaruh Perubahan Kurs Valuta Asing”. PSAKNo. 10 yang direvisi tersebut terutama mengatur penentuan matauang fungsional, penjabaran akun dalam mata uang asing kemata uang fungsional dan penggunaan mata uang penyajian yangberbeda dengan mata uang fungsional. Pada tanggal tersebut,Grup Kalbe menentukan bahwa mata uang fungsionalnyaadalah Rupiah, sehingga penerapan awal PSAK No. 10 yangdirevisi tersebut tidak memberikan pengaruh terhadap pelaporankeuangan Grup Kalbe.Transaksi dalam mata uang asing dicatat ke dalam Rupiahberdasarkan kurs yang berlaku pada saat transaksi dilakukan.Pada akhir periode pelaporan, aset dan liabilitas moneter dalammata uang asing disesuaikan berdasarkan rata-rata kurs jualdan beli yang diterbitkan Bank Indonesia pada tanggal transaksiperbankan terakhir untuk tahun yang bersangkutan. Laba ataurugi selisih kurs yang terjadi dikreditkan atau dibebankan padaoperasi tahun berjalan. Pada tanggal 31 Desember 2012 dan2011, nilai kurs yang digunakan masing-masing adalah sebagaiberikut:Keterangan 2012 2011 Description1 Euro / Rupiah 12,810 11,739 EUR 1 / Rupiah1 Dolar A.S. / Rupiah 9,670 9,068 U.S. Dollar 1 / Rupiah100 JP¥ / Rupiah 11,197 11,680 JP¥ 100 / Rupiah1 SGD Dolar / Rupiah 7,907 6,974 SGD Dollar 1 / Rupiah1 MYR / Rupiah 3,160 2,852 MYR 1 / RupiahTransaksi dalam mata uang asing lainnya dinilai tidak signifikan.Dana Pensiun dan Liabilitas Imbalan Kerja JangkaPanjangEfektif tanggal 1 Januari 2012, Grup Kalbe menerapkan PSAKNo. 24 (Revisi 2010), “Imbalan Kerja”.PSAK No. 24 (Revisi 2010), “Imbalan Kerja” menetapkanakuntansi dan pengungkapan untuk imbalan kerja. Revisiterhadap PSAK memperbolehkan entitas untuk menerapkanmetode yang sistematis atas pengakuan yang lebih cepatleaseback transaction is deferred and amortized over the leaseterm.Operating Lease - as LesseeA lease is classified as an operating lease if it does not transfersubstantially all the risks and rewards incidental to ownership ofthe leased assets. Accordingly, the related lease payments arerecognized as expense in the current year operations using thestraight-line method over the lease term. Foreign Currency Transactions and BalancesOn January 1, 2012, Kalbe Group adopted PSAK No. 10 (Revised2010), “The Effects of Changes in Foreign Exchange Rates”.The revised PSAK No. 10 principally establishes functionalcurrency determination, account translation in foreign currencyto functional currency and the use of presentation currency whichare different with the functional currency. At that date, KalbeGroup determined that its functional currency is Rupiah, andtherefore the initial adoption of the revised PSAK No. 10 has noimpact on Kalbe Group’s financial reporting.Transactions in foreign currencies are recorded in Rupiah at therates of exchange prevailing on the date of the transactions.At the end of reporting period, monetary assets and liabilitiesdenominated in foreign currencies are adjusted to reflect theaverage of the selling and buying rates of exchange prevailingat the last banking transaction date of the year, as publishedby Bank Indonesia. The resulting net foreign exchange gains orlosses are credited or charged to current year operations. As ofDecember 31, 2012 and 2011, the exchange rates used were asfollows.Transactions in other foreign currencies are considered notsignificant.Pension fund and long-term liabilities foremployees’ benefitsEffective on January 1, 2012, Kalbe Group applies PSAK No. 24(Revised 2010), “Employee Benefits”.PSAK No. 24 (Revised 2010), “Employee Benefits” establishesthe accounting and disclosures for employee benefits. Therevised PSAK permits entitites to adopt certain systematicmethods of faster recognition, which include, among others,
  • 161. PT Kalbe Farma Tbk. • 2012 Annual Report 159dari kerugian/keuntungan aktuarial, yang antara lain adalahpengakuan langsung dari seluruh keuntungan/kerugian aktuarial.Karena Grup Kalbe tidak memilih metode ini namun tetapmenggunakan metode pengakuan keuntungan/kerugian aktuarialyang jatuh di luar koridor seperti diuraikan lebih lanjut berikut ini,maka penerapan awal PSAK No. 24 (Revisi 2010) tersebut tidakmemberikan pengaruh atas laporan keuangan konsolidasianGrup Kalbe kecuali untuk pengungkapan terkait.Grup Kalbe mencatat penyisihan untuk estimasi liabilitas imbalankerja jangka panjang menurut Undang-undang KetenagakerjaanNo. 13/2003 tanggal 25 Maret 2003. Penyisihan tersebutdiestimasikan berdasarkan perhitungan aktuaria yang dilakukanoleh aktuaris independen dengan menggunakan metode“Projected Unit of Credit”. Laba atau kerugian aktuaria diakuisebagai pendapatan atau beban jika akumulasi keuntungan ataukerugian aktuaria melebihi 10% dari nilai kini kewajiban imbalanpasti.Laba atau kerugian aktuaria yang melebihi 10% tersebutdiamortisasi selama sisa rata-rata masa kerja karyawan denganmenggunakanmetodegarislurus.Biayajasamasalaludibebankanlangsung apabila imbalan tersebut menjadi hak atau vested, dansebaliknya, akan diakui sebagai beban dengan metode garislurus selama periode rata-rata sampai imbalan tersebut menjadivested. Selain itu, biaya jasa masa kini dibebankan langsung keoperasional tahun berjalan.Selain itu, Grup Kalbe menyelenggarakan program pensiunmanfaat pasti untuk seluruh karyawan tetapnya yangpendanaannya dilakukan seluruhnya oleh Grup Kalbe. Kewajibanimbalan pensiun tersebut merupakan nilai kini kewajiban imbalanpasti pada akhir periode pelaporan dikurangi dengan nilai wajaraset program dan penyesuaian atas keuntungan atau kerugianaktuarial dan biaya jasa lalu yang belum diakui. Kewajibanimbalan pasti dihitung setiap tahun oleh aktuaris independendengan menggunakan metode Projected Unit Credit.Nilai kini kewajiban imbalan pasti ditentukan denganmendiskontokan estimasi arus kas di masa depan denganmenggunakan tingkat bunga obligasi pemerintah jangka panjangpada akhir periode pelaporan dalam mata uang Rupiah sesuaidengan mata uang dimana imbalan tersebut akan dibayarkandan yang memiliki jangka waktu yang sama dengan kewajibanimbalan pensiun yang bersangkutan.PerpajakanEfektif tanggal 1 Januari 2012, Grup Kalbe menerapkan PSAKNo. 46 (Revisi 2010), “Pajak Penghasilan”. Revisi PSAK No. 46tersebutmenetapkanperlakuanakuntansiuntukpajakpenghasilandalam menghitung konsekuensi pajak kini dan masa depan untukpemulihan (penyelesaian) jumlah tercatat aset (liabilitas) di masadepan yang diakui pada laporan posisi keuangan konsolidasian;serta transaksi-transaksi dan kejadian-kejadian lain pada periodeberjalan yang diakui pada laporan keuangan konsolidasian.immediate recognition of all actuarial gains/losses. Since KalbeGroup opted not to apply this method but to continuously usethe previous actuarial gain/loss recognition method whichfalls outside the corridor as further disclosed below, the initialadoption of PSAK No. 24 (Revised 2010) has no impact on KalbeGroup’s consolidated financial statements except for the relateddisclosures.Kalbe Group recognizes provisions for the estimated long-termliabilities for employees’ benefits in accordance with Labor LawNo. 13/2003 dated March 25, 2003. The provision is estimatedbased on actuarial calculations prepared by an independent firmof actuaries using the “Projected Unit of Credit” method. Actuarialgains or losses are recognized as income or expense when thecumulative actuarial gains or losses exceed 10% of the presentvalue of defined benefit obligation.The aforesaid actuarial gains or losses in excess of the 10%threshold are amortized over the expected average remainingservice years of the employees using the straight-line method.Past services cost is recognized immediately to the extent thatthe benefits are already vested, otherwise, it is amortized on astraight-line method over the average period until the benefitsbecome vested. On the other hand, current service costs arecharged directly to the current year operations.Besides, Kalbe Group has defined benefit pension plans coveringsubstantially all of their permanent employees which pensioncosts are funded by Kalbe Group. The pension benefit obligationis the present value of the defined benefit obligation at end ofthe reporting period less the fair value of plan assets, togetherwith adjustments for unrecognised actuarial gains or losses andpast service costs. The defined benefit obligation is calculatedannually by an independent actuary using the Projected UnitCredit method.The present value of the defined benefit obligation is determinedby discounting the estimated future cash outflows using the yieldat end of the reporting period of long-term government bondsdenominated in Rupiah in which the benefits will be paid and thathave terms to maturity similar to the related pension obligation.TaxationEffective on January 1, 2012, Kalbe Group applies PSAK No.46 (Revised 2010), “Income Taxes”. The revised PSAK No. 46prescribes the accounting treatment for income taxes to accountfor the current and future tax consequences of the future recovery(settlement) of the carrying amount of assets (liabilities) that arerecognized in the consolidated statement of financial position;and transactions and other events of the current period that arerecognized in the consolidated financial statements.
  • 162. Performance HighlightsManagement ReportCompany ProfileManagement Discussion and AnalysisCorporate GovernanceCorporate Social ResponsibilityPT Kalbe Farma Tbk. • Laporan Tahunan 2012160Penerapan awal PSAK yang direvisi tersebut memberikanpengaruh terhadap pengungkapan terkait dalam laporankeuangan konsolidasian.Pajak KiniBeban pajak penghasilan merupakan jumlah dari pajakpenghasilan badan yang terutang saat ini dan pajak tangguhanAset dan liabilitas pajak kini untuk tahun berjalan diukur sebesarjumlah yang diharapkan dapat direstitusi dari atau dibayarkankepada otoritas perpajakan. Tarif pajak dan peraturan pajakyang digunakan untuk menghitung jumlah tersebut adalah yangtelah berlaku atau secara substantif telah berlaku pada tanggalpelaporan.Penghasilan kena pajak berbeda dengan laba yang dilaporkandalam laporan laba rugi komprehensif konsolidasian karenapenghasilan kena pajak tidak termasuk bagian dari pendapatanatau beban yang dikenakan pajak atau dikurangkan di tahun-tahun yang berbeda, dan juga tidak termasuk bagian-bagianyang tidak dikenakan pajak atau tidak dapat dikurangkan.Pajak TangguhanPajak tangguhan diakui dengan menggunakan metode liabilitasatas perbedaan temporer pada tanggal pelaporan antara dasarpengenaan pajak dari aset dan liabilitas dan jumlah tercatatnyauntuk tujuan pelaporan keuangan pada tanggal pelaporan.Liabilitas pajak tangguhan diakui untuk semua perbedaantemporer yang kena pajak, kecuali bagi liabilitas pajak tangguhanyang berasal dari:i. pengakuan awal goodwill; atauii. pada saat pengakuan awal aset atau liabilitas dari transaksiyang: (1) bukan transaksi kombinasi bisnis; dan (2) pada waktutransaksi, tidak mempengaruhi laba akuntansi dan laba kenapajak/rugi pajak.Aset pajak tangguhan diakui untuk seluruh perbedaan temporeryang dapat dikurangkan dan akumulasi rugi pajak belumdikompensasi, bila kemungkinan besar laba kena pajak akantersedia sehingga perbedaan temporer dapat dikurangkan, danrugi pajak belum dikompensasi, dapat dimanfaatkan, kecualijika aset pajak tangguhan timbul dari pengakuan awal aset atauliabilitas dalam transaksi yang:i. bukan transaksi kombinasi bisnis; danii. tidak mempengaruhi laba akuntansi maupun laba kena pajak/rugi pajak.Liabilitas pajak tangguhan diakui atas perbedaan temporer kenapajak terkait dengan investasi pada entitas anak dan asosiasi,kecuali yang waktu pembalikannya dapat dikendalikan dankemungkinan besar perbedaan temporer tersebut tidak akandibalik di masa depan yang dapat diperkirakan.The initial adoption of the revised PSAK has an impact on therelated disclosures in the consolidated financial statements.Current TaxIncome tax expense represents the sum of the corporate incometax currently payable and deferred tax.Current income tax assets and liabilities for the current yearare measured at the amount expected to be recovered from orpaid to the taxation authority. The tax rates and tax laws usedto compute the amount are those that have been enacted orsubstantively enacted as at the reporting dates.Taxable profit differs from profit as reported in the consolidatedstatement of comprehensive income because it excludes itemsof income or expense that are taxable or deductible in otheryears and it further excludes items that are neither taxable nordeductible.Deferred TaxDeferred tax is provided using the liability method on temporarydifferences at the reporting date between the tax bases of assetsand liabilities and their carrying amounts for financial reportingpurposes at the reporting date.Deferred tax liabilities are recognized for all taxable temporarydifferences, except for the deferred tax liability arising from:i. the initial recognition of goodwill; orii. an asset or liability in a transaction that is: (1) not a businesscombination; and (2) at the time of the transaction, affectsneither the accounting profit nor taxable profit or loss.Deferred tax assets are recognized for all deductible temporarydifferences and carry forward of unused tax losses, to the extentthat it is probable that taxable profits will be available againstwhich deductible temporary differences, and the carry forwardof unused tax losses can be utilized, unless the deferred taxasset arises from the initial recognition of an asset or liability in atransaction that is:i. not a business combination; andii. at the time of the transaction, affects neither the accountingprofit nor taxable profit or loss.Deferred tax liabilities are recognized in respect of taxabletemporary differences associated with investments in subsidiariesand associates, except where the timing of the reversal of thetemporary differences can be controlled and it is probable that thetemporary differences will not reverse in the foreseeable future.
  • 163. PT Kalbe Farma Tbk. • 2012 Annual Report 161Nilai tercatat aset pajak tangguhan ditelaah pada setiap tanggalpelaporan dan nilai tercatat aset pajak tangguhan tersebutditurunkan apabila laba fiskal mungkin tidak memadai untukmengkompensasi sebagian atau semua manfaat aset pajaktangguhan. Pada setiap tanggal pelaporan, Perseroan menilaikembali aset pajak tangguhan yang tidak diakui. Perseroanmengakui aset pajak tangguhan yang sebelumnya tidak diakuiapabila besar kemungkinan bahwa laba fiskal pada masa yangakan datang akan tersedia untuk pemulihannya.Aset dan liabilitas pajak tangguhan diukur dengan menggunakantarif pajak yang diharapkan akan berlaku pada tahun saat asetdipulihkan atau liabilitas diselesaikan berdasarkan tarif pajak danperaturan pajak yang berlaku atau yang telah secara substantiftelah berlaku pada tanggal pelaporan.Aset pajak tangguhan dan liabilitas pajak tangguhan disaling-hapuskan jika terdapat hak secara hukum untuk melakukan salinghapus antara aset pajak kini terhadap liabilitas pajak kini, atauaset dan liabilitas pajak tangguhan pada entitas yang sama, Grupyang bermaksud untuk merealisasikan aset dan menyelesaikanliabilitas lancar berdasarkan jumlah neto.Pajak Pertambahan Nilai (PPN)Pendapatan, beban-beban dan aset-aset diakui neto atas jumlahPPN kecuali:• PPN yang muncul dari pembelian aset atau jasa yang tidakdapat dikreditkan oleh kantor pajak, yang dalam hal ini PPNdiakui sebagai bagian dari biaya perolehan aset atau sebagaibagian dari item beban-beban yang diterapkan; dan• Piutang dan utang yang disajikan termasuk dengan jumlahPPN.Jumlah PPN neto yang terpulihkan dari, atau terutang kepada,kantor pajak termasuk sebagai bagian dari piutang atau utangpada laporan perubahan posisi keuangan konsolidasian.Instrumen KeuanganEfektif tanggal 1 Januari 2012, Grup Kalbe menerapkan PSAKNo. 50 (Revisi 2010), “Instrumen Keuangan: Penyajian”, PSAKNo. 55 (Revisi 2011), “Instrumen Keuangan: Pengakuandan Pengukuran” dan PSAK No. 60, “Instrumen Keuangan:Pengungkapan”. PSAK No. 50 direvisi sehingga hanya mengaturpenyajian instrumen keuangan, sedangkan prinsip pengungkapaninstrumen keuangan dipindahkan ke PSAK No. 60.Revisi PSAK No. 55 tersebut tidak memberikan pengaruh bagilaporan keuangan konsolidasian pada saat penerapan awal,sedangkan penerapan PSAK No. 50 dan PSAK No. 60 yangdirevisi tersebut memberikan pengaruh bagi pengungkapandalam laporan keuangan konsolidasian.The carrying amount of a deferred tax asset is reviewed ateach reporting date and reduced to the extent that it is nolonger probable that sufficient taxable profit will be available toallow all or part of the benefit of that deferred tax asset to beutilized. Unrecognized deferred tax assets are reassessed ateach reporting date and are recognized to the extent that it hasbecome probable that future taxable profit will allow the deferredtax assets to be recovered.Deferred tax assets and liabilities are measured at the tax ratesthat are expected to apply to the year when the asset is realizedor the liability is settled, based on tax rates and tax laws that havebeen enacted or substantively enacted as at the reporting date.Deferred tax assets and deferred tax liabilities are offset when alegally enforceable right exists to offset current tax assets againstcurrent tax liabilities, or the deferred tax assets and the deferredtax liabilities relate to the same taxable entity, or Kalbe Groupintends to settle its current assets and liabilities on a net basis.Value Added Tax (VAT)Revenue, expenses and assets are recognized net of the amountof VAT except:• where the VAT incurred on a purchase of assets or services isnot recoverable from the taxation authority, in which case theVAT is recognized as part of the cost of acquisition of the assetor as part of the expense item as applicable; and• receivables and payables that are stated with the amount ofVAT includedThe net amount of VAT recoverable from, or payable to, thetaxation authorities is included as part of receivables or payablesin the consolidated statements of financial position.Financial InstrumentsEffective on January 1, 2012, Kalbe Group adopted PSAK No.50 (Revised 2010), “Financial Instruments: Presentation”, PSAKNo. 55 (Revised 2011), “Financial Instruments: Recognitionand Measurement” and PSAK No. 60, “Financial Instruments:Disclosures”. PSAK No. 50 was revised to only cover the principlesfor presentation of financial instruments, while the principles fordisclosures of financial instruments are transferred to PSAK No.60.The revised PSAK No. 55 has no impact on the consolidatedfinancial statements upon initial adoption, while the adoption ofthe revised PSAK No. 50 and PSAK No. 60 impacts the disclosuresmade in the consolidated financial statements
  • 164. Performance HighlightsManagement ReportCompany ProfileManagement Discussion and AnalysisCorporate GovernanceCorporate Social ResponsibilityPT Kalbe Farma Tbk. • Laporan Tahunan 2012162i. Aset Keuangan Pengakuan dan Pengukuran Awal Aset keuangan diklasifikasikan sebagai aset keuangan yangdinilai pada nilai wajar melalui laba rugi, pinjaman yangdiberikan dan piutang, investasi yang dimiliki hingga jatuhtempo, dan aset keuangan tersedia untuk dijual. Grup Kalbemenentukan klasifikasi aset keuangan pada saat pengakuanawal dan, jika diperbolehkan dan sesuai, akan dievaluasikembali setiap akhir tahun keuangan. Pada saat pengakuan awal, aset keuangan diukur padanilai wajar. Dalam hal investasi tidak diukur pada nilai wajarmelalui laba rugi, nilai wajar tersebut ditambah dengan biayatransaksi yang dapat diatribusikan secara langsung. Pembelian atau penjualan aset keuangan yang memerlukanpenyerahan aset dalam kurun waktu yang telah ditetapkanoleh peraturan dan kebiasan yang berlaku di pasar (pembelianreguler) diakui pada tanggal perdagangan, seperti tanggalPerseroan berkomitmen untuk membeli atau menjual aset. Aset keuangan Grup Kalbe mencakup kas dan setara kas,aset keuangan lancar lainnya, piutang usaha, piutang lain-laindan investasi pada entitas asosiasi - penyertaan lainnya. Pengukuran Setelah Pengakuan Awal Pengukuran setelah pengakuan awal dari aset keuangantergantung pada klasifikasi sebagai berikut:• Aset keuangan yang dinilai pada nilai wajar melalui labaatau rugi Aset keuangan yang dinilai pada nilai wajar melalui labaatau rugi meliputi aset keuangan yang diklasifikasikandalam kelompok diperdagangkan dan aset keuanganyang pada saat pengakuan awalnya telah ditetapkanuntuk dinilai pada nilai wajar melalui laba atau rugi. Aset keuangan diklasifikasikan sebagai kelompokdiperdagangkan jika diperoleh atau dimiliki untuktujuan dijual dalam waktu dekat. Aset derivatif jugadiklasifikasikan dalam kelompok diperdagangkan kecualiderivatif yang ditetapkan sebagai instrumen lindungnilai. Aset keuangan yang dinilai pada nilai wajar melaluilaba atau rugi dicatat dalam laporan posisi keuangankonsolidasian pada nilai wajar dengan laba atau rugidiakui sebagai laba rugi. Derivatif melekat dalam kontrak utama dihitung sebagaiderivatif terpisah ketika risiko dan karakteristiknya tidakberkaitan dengan kontrak utama dan kontrak utamatidak dicatat pada nilai wajar. Derivatif melekat diukuri. Financial Assets Initial Recognition and Measurement Financial assets are classified as financial assets at fair valuethrough profit or loss, loans and receivables, held-to-maturityinvestments and available-for-sale financial assets. KalbeGroup determines the classification of its financial assetsat initial recognition and, where allowed and appropriate,reevaluates this designation at each financial year end. Financial assets are recognized initially at fair value. In thecase of investments are not being measured at fair valuethrough profit or loss, directly attributable transaction costsare being added to the fair value. Purchases or sales of financial assets that require deliveryof assets within a time frame established by regulation orconvention in the marketplace (regular way purchases) arerecognized on the trade date, i.e., the date that the companiescommit to purchase or sell the assets. Kalbe Group’s financial assets include cash and cashequivalents, other current financial assets, trade and otherreceivables and investment in associated entity - otherinvestments. Subsequent Measurement The subsequent measurement of financial assets depends ontheir classification as follows:• Financial assets at fair value through profit or loss Financial assets at fair value through profit or loss includefinancial assets held for trading and financial assetsdesignated upon initial recognition at fair value throughprofit or loss. Financial assets are classified as held for trading ifthey are acquired for the purpose of selling in the nearterm. Derivative assets are also classified as held fortrading unless they are designated as effective hedginginstruments. Financial assets at fair value through profitand loss are carried in the consolidated statementsof financial position at fair value with gains or lossesrecognized as profit or loss. Derivatives embedded in host contracts are accountedfor as separate derivatives when their risks andcharacteristics are not closely related to those of the hostcontracts and the host contracts are not carried at fair
  • 165. PT Kalbe Farma Tbk. • 2012 Annual Report 163berdasarkan nilai wajar dengan laba atau rugi yangtimbul dari perubahan nilai wajar tersebut diakui sebagailaba rugi. Penilaian kembali hanya timbul jika terdapatperubahan kontrak yang secara signifikan mengubaharus kas yang dipersyaratkan oleh kontrak.• Pinjaman yang diberikan dan piutang Pinjaman yang diberikan dan piutang adalah asetkeuangan non derivatif dengan pembayaran tetapatau telah ditentukan dan tidak mempunyai kuotasi dipasar aktif. Aset keuangan tersebut dicatat pada biayaperolehan yang diamortisasi menggunakan metode sukubunga efektif. Laba atau rugi diakui sebagai laba rugi padasaat pinjaman dan piutang dihentikan pengakuannyaatau mengalami penurunan nilai, serta melalui prosesamortisasi. Kas dan setara kas, piutang usaha dan piutang lain-lainGrup Kalbe termasuk dalam kategori ini.• Investasi dimiliki hingga jatuh tempo Aset keuangan non-derivatif dengan pembayarantetap atau telah ditentukan dan jatuh temponya telahditetapkan diklasifikasi sebagai investasi dimiliki hinggajatuh tempo jika Grup Kalbe mempunyai maksud dankemampuan untuk memiliki aset keuangan tersebuthingga jatuh tempo. Setelah pengukuran awal, investasidalam kelompok dimiliki hingga jatuh tempo diukur padabiaya perolehan yang diamortisasi dengan menggunakanmetode suku bunga efektif. Metode ini menggunakansuku bunga efektif untuk mendiskonto penerimaan kasdi masa yang akan datang selama perkiraan umur asetkeuangan menjadi nilai tercatat netonya. Laba atau rugidiakui pada laporan laba rugi komprehensif konsolidasianketika investasi dihentikan pengakuannya atau mengalamipenurunan nilai, serta melalui proses amortisasi.• Aset keuangan tersedia untuk dijual Aset keuangan tersedia untuk dijual adalah aset keuangannon derivatif yang ditetapkan sebagai tersedia untuk dijualatau yang tidak diklasifikasikan ke dalam tiga kategorisebelumnya. Setelah pengukuran awal, aset keuangantersedia untuk dijual diukur pada nilai wajar dengan labaatau rugi yang belum direalisasi diakui dalam ekuitassampai investasi tersebut dihentikan pengakuannya.Pada saat itu, laba atau rugi kumulatif yang sebelumnyadiakui dalam ekuitas harus direklasifikasi ke dalam labaatau rugi sebagai penyesuaian reklasifikasi.value. These embedded derivatives are measured at fairvalue with gains or losses arising from changes in fairvalue recognized as profit or loss. Reassessment onlyoccurs if there is a change in the terms of the contractthat significantly modifies the cash flows that wouldotherwise be required.• Loans and receivables Loans and receivables are non-derivative financial assetswith fixed or determinable payments that are not quotedin an active market. Such financial assets are carried atamortized cost using the effective interest rate method.Gains and losses are recognized as profit or loss whenthe loans and receivables are derecognized or impaired,as well as through the amortization process. Kalbe Group’s cash and cash equivalents, trade andother receivables are included in this category.• Held-to-maturity (HTM) investments Non-derivative financial assets with fixed or determinablepayments and fixed maturities are classified as HTMinvestments when Kalbe Group has the positiveintention and ability to hold them to maturity. Afterinitial measurement, HTM investments are measuredat amortized cost using the effective interest ratemethod. This method uses an effective interest ratethat exactly discounts estimated future cash receiptsthrough the expected life of the financial asset to thenet carrying amount of the financial asset. Gains andlosses are recognized in the consolidated statementof comprehensive income when the investments arederecognized or impaired, as well as through theamortization process.• Available-for-sale (AFS) financial assets AFS financial assets are non-derivative financial assetsthat are designated as available-for-sale or are notclassified in any of the three preceding categories. Afterinitial measurement, AFS financial assets are measuredat fair value with unrealized gains or losses recognizedin the shareholders’ equity until the investment isderecognized. At that time, the cumulative gain or losspreviously recognized in the shareholders’ equity shallbe reclassified to profit or loss as a reclassificationadjustment.
  • 166. Performance HighlightsManagement ReportCompany ProfileManagement Discussion and AnalysisCorporate GovernanceCorporate Social ResponsibilityPT Kalbe Farma Tbk. • Laporan Tahunan 2012164 Investasi yang diklasifikasi sebagai aset keuangantersedia untuk dijual adalah sebagai berikut:- Investasi pada saham yang tidak tersedia nilaiwajarnya dengan kepemilikan kurang dari 20% daninvestasi jangka panjang lainnya dicatat pada biayaperolehannya.- Investasi dalam modal saham yang tersedia nilaiwajarnya dengan kepemilikan kurang dari 20%dicatat pada nilai wajar. Investasi yang diklasifikasikan sebagai aset keuangantersedia untuk dijual adalah investasi jangka pendek daninvestasi jangka panjang yaitu investasi pada sahamdengan kepemilikan kurang dari 20% yang dinyatakansebesar nilai pasar wajar. Penghentian Pengakuan Penghentian pengakuan atas suatu aset keuangan (atauapabila dapat diterapkan, untuk bagian dari aset keuanganatau bagian dari kelompok aset keuangan sejenis) terjadibila: (1) hak kontraktual atas arus kas yang berasal dari asetkeuangan tersebut berakhir; atau (2) Grup memindahkan hakuntuk menerima arus kas yang berasal dari aset keuangantersebut atau menanggung liabilitas untuk membayar aruskas yang diterima tersebut tanpa penundaan yang signifikankepada pihak ketiga melalui suatu kesepakatan penyerahandan salah satu di antara (a) Grup secara substansialmemindahkan seluruh risiko dan manfaat atas kepemilikanaset keuangan tersebut, atau (b) Grup secara substansialtidak memindahkan dan tidak memiliki seluruh risiko danmanfaat atas kepemilikan aset keuangan tersebut, namuntelah memindahkan pengendalian atas aset tersebut. Penurunan Nilai Aset Keuangan Setiap akhir periode pelaporan, Grup Kalbe mengevaluasiapakah terdapat bukti yang obyektif bahwa aset keuanganmengalami penurunan nilai. Untuk menentukan adanya buktiobyektif bahwa kerugian penurunan nilai aset keuangantelah terjadi, Grup mempertimbangkan faktor-faktor sepertiprobabilitas kebangkrutan atau kesulitan keuangan yangsignifikan dari debitur dan gagal bayar atau keterlambatanpembayaran yang signifikan. Untuk aset keuangan yang dicatat pada biaya perolehandiamortisasi, jika terdapat bukti obyektif bahwa kerugianpenurunan nilai telah terjadi, jumlah kerugian tersebut diukursebagai selisih antara nilai tercatat aset dengan nilai kiniestimasi arus kas masa datang (tidak termasuk ekspektasikerugian kredit masa datang yang belum terjadi). Nilai kiniestimasi arus kas masa datang didiskonto menggunakansuku bunga efektif awal dari aset keuangan tersebut. The investments classified as AFS financial assets are asfollows:- Investments in shares of stock that do not have readilydeterminable fair value in which the equity interest isless than 20% and other long-term investments arecarried at cost.- Investments in equity shares that have readilydeterminable fair value in which the equity interest isless than 20% are recorded at fair value. Investment classified as AFS financial assets are short-term investments in marketable securities and long-terminvestment in shares of stock which the equity interestis less than 20% which are stated at their fair marketvalues. Derecognition A financial asset (or where applicable, a part of a financial assetor part of a group of similar financial assets) is derecognizedwhen: (1) the rights to receive cash flows from the asset haveexpired; or (2) Group has transferred its rights to receive cashflows from the asset or has assumed an obligation to pay thereceived cash flows in full without material delay to a thirdparty under a “pass-through” arrangement; and either (a)Group has transferred substantially all the risks and rewardsof the asset, or (b) Group has neither transferred nor retainedsubstantially all the risks and rewards of the asset, but hastransferred control of the asset. Impairment of Financial Assets At each end of reporting period, Kalbe Group assesseswhether there is any objective evidence that a financial assetis impaired. To determine whether there is objective evidencethat an impairment loss on financial assets has incurred, KalbeGroup considers factors such as the probability of insolvencyor significant financial difficulties of the debtor and default orsignificant delay in payments. For financial assets carried at amortized cost, if there isobjective evidence that an impairment loss has occurred, theamount of the loss is measured as the difference between theasset’s carrying amount and present value of estimated futurecash flow (excluding future expected credit losses that havenot yet been incurred). The present value of the estimatedfuture cash flow is discounted at the financial asset’s initialeffective interest rate.
  • 167. PT Kalbe Farma Tbk. • 2012 Annual Report 165 Nilai tercatat aset keuangan tersebut dikurangi melaluipenggunaan cadangan penurunan nilai. Jumlah kerugianyang terjadi diakui sebagai laba rugi. Pinjaman yang diberikan dan piutang beserta dengancadangan terkait dihapuskan jika tidak terdapat kemungkinanyang realistis atas pemulihan di masa mendatang. Jika, padatahun berikutnya, nilai estimasi kerugian penurunan nilaiaset keuangan bertambah atau berkurang karena peristiwayang terjadi setelah penurunan nilai diakui, maka kerugianpenurunan nilai yang diakui sebelumnya bertambah atauberkurang dengan menyesuaikan pos cadangan penurunannilai. Jika di masa mendatang, penghapusan tersebut dapatdipulihkan, jumlah pemulihan tersebut diakui sebagai labarugi.ii. Liabilitas Keuangan Pengakuan Awal Liabilitaskeuangandiklasifikasikansebagailiabilitaskeuanganyang diukur pada nilai wajar melalui laba atau rugi, liabilitaskeuangan yang diukur dengan biaya perolehan diamortisasiatau derivatif yang telah ditetapkan untuk tujuan lindung nilaiyang efektif, jika sesuai. Grup menentukan klasifikasi liabilitaskeuangan pada saat pengakuan awal. Saat pengakuan awal, liabilitas keuangan diukur pada nilaiwajar dan, dalam hal liabilitas keuangan yang diukur denganbiaya perolehan diamortisasi, termasuk biaya transaksi yangdapat diatribusikan secara langsung. Liabilitas keuangan Grup Kalbe mencakup utang bank,utang usaha, utang lain-lain, beban akrual dan utang sewapembiayaan. Pengukuran Setelah Pengakuan Awal Pengukuran liabilitas keuangan bergantung pada klasifikasisebagai berikut:• Liabilitas keuangan yang diukur pada nilai wajar melaluilaba atau rugi. Liabilitas keuangan yang diukur pada nilai wajar melaluilaba atau rugi mencakup liabilitas keuangan yangdiklasifikasikan dalam kelompok diperdagangkan danliabilitas keuangan yang pada saat pengakuan awalnya,telah ditetapkan, diukur pada nilai wajar melalui laba ataurugi. The carrying amount of the assets is reduced through theuse of allowance for impairment. The impairment loss isrecognized as profit or loss. Loans and receivables, together with the associatedallowance, are written-off when there is no realistic prospectof future recovery. If, in a subsequent year, the amount of theestimated impairment loss increases or decreases becauseof an event occurring after the impairment was recognized,the previously recognized impairment loss is increased orreduced by adjusting the allowance for impairment account. Ifa future write-off is later recovered, the recovery is recognizedin profit or loss.ii. Financial Liabilities Initial Recognition Financial liabilities are classified as financial liabilities at fairvalue through profit or loss, financial liabilities at amortizedcost, or as derivatives designated as hedging instruments in aneffective hedge, as appropriate. Kalbe Group determines theclassification of their financial liabilities at initial recognition. Financial liabilities are recognized initially at fair value and, inthe case of financial liabilities at amortized cost, inclusive ofdirectly attributable transaction costs. Kalbe Group’s financial liabilities include bank loans, tradeand other payables, accrued expenses and obligations underfinance leases. Subsequent Measurement The measurement of financial liabilities depends on theirclassification as follows:• Financial liabilities at fair value through profit or loss. Financial liabilities at fair value through profit or lossinclude financial liabilities held for trading and financialliabilities designated upon initial recognition at fair valuethrough profit or loss.
  • 168. Performance HighlightsManagement ReportCompany ProfileManagement Discussion and AnalysisCorporate GovernanceCorporate Social ResponsibilityPT Kalbe Farma Tbk. • Laporan Tahunan 2012166 Liabilitas keuangan diklasifikasikan dalam kelompokdiperdagangkan jika diperoleh atau dimiliki untuktujuan dijual dalam waktu dekat. Liabilitas derivatif jugadiklasifikasikan dalam kelompok diperdagangkan kecualiderivatif yang ditetapkan sebagai instrumen lindung nilaiyang efektif. Laba atau rugi atas liabilitas dalam kelompokdiperdagangkan harus diakui sebagai laba rugi.• Liabilitas keuangan yang diukur dengan biaya perolehandiamortisasi Setelah pengakuan awal, utang dan pinjaman yangdikenakan bunga diukur pada biaya perolehandiamortisasi dengan menggunakan metode suku bungaefektif. Laba dan rugi harus diakui sebagai laba atau rugi ketikaliabilitas tersebut dihentikan pengakuannya serta melaluiproses amortisasinya. Penghentian Pengakuan Liabilitas keuangan dihentikan pengakuannya ketika liabilitasyang ditetapkan dalam kontrak dihentikan atau dibatalkanatau kadaluwarsa. Ketika liabilitas keuangan awal digantikan dengan liabilitaskeuangan lain dari pemberi pinjaman yang sama denganketentuan yang berbeda secara substansial, atau modifikasisecara substansial atas liabilitas keuangan yang saat ini ada,maka pertukaran atau modifikasi tersebut dicatat sebagaipenghapusan liabilitas keuangan awal dan pengakuanliabilitas keuangan baru dan selisih antara nilai tercatatliabilitas keuangan tersebut diakui sebagai laba atau rugi.iii. Saling Hapus Instrumen Keuangan Aset keuangan dan liabilitas keuangan saling hapus dannilai bersihnya disajikan dalam laporan posisi keuangankonsolidasian jika, dan hanya jika, terdapat hak yangberkekuatan hukum untuk melakukan saling hapus atasjumlah yang telah diakui dari aset keuangan dan liabilitaskeuangan tersebut dan terdapat intensi untuk menyelesaikandengan menggunakan dasar neto, atau untuk merealisasikanaset dan menyelesaikan liabilitasnya secara bersamaan.iv. Nilai Wajar Instrumen Keuangan Nilai wajar instrumen keuangan yang secara aktifdiperdagangkan di pasar keuangan ditentukan denganmengacu pada kuotasi harga pasar yang berlaku padapenutupan pasar pada akhir periode pelaporan. Untuk Financial liabilities are classified as held for trading ifthey are acquired for the purpose of selling in the nearterm. Derivative liabilities are also classified as held fortrading unless they are designated as effective hedginginstruments. Gains or losses on liabilities held for trading are recognizedas profit or loss.• Financial liabilities at amortized cost After initial recognition, interest-bearing loans andborrowings are subsequently measured at amortizedcost using the effective interest rate method. Gains and losses are recognized as profit or loss whenthe liabilities are derecognized as well as through theamortization process. Derecognition A financial liability is derecognized when the obligation underthe liability is discharged or cancelled or expired. When an existing financial liability is replaced by another fromthe same lender on substantially different terms, or the termsof an existing liability are substantially modified, such anexchange or modification is treated as a derecognition of theoriginal liability and the recognition of a new liability, and thedifference in the respective carrying amounts is recognizedas profit or loss.iii. Offsetting of Financial Instruments Financial assets and financial liabilities are offset and the netamount reported in the consolidated statements of financialposition if, and only if, there is a currently enforceable legalright to offset the recognized amounts and there is an intentionto settle on a net basis, or to realize the assets and settle theliabilities simultaneously.iv. Fair Value of Financial Instruments The fair value of financial instruments that are actively tradedin organized financial markets is determined by reference toquoted market bid prices at the close of business at the endof reporting period. For financial instruments where there is
  • 169. PT Kalbe Farma Tbk. • 2012 Annual Report 167instrumen keuangan yang tidak diperdagangkan di pasaraktif, nilai wajar ditentukan dengan menggunakan teknikpenilaian. Teknik penilaian tersebut meliputi penggunaantransaksi pasar terkini yang dilakukan secara wajar (arm’s-length market transactions), referensi atas nilai wajar terkinidari instrumen lain yang secara substantial sama, analisisarus kas yang didiskonto, atau model penilaian lainnya.7. Laba per SahamEfektif tanggal 1 Januari 2012, Grup Kalbe menerapkan PSAKNo. 56 (Revisi 2011), “Laba per Saham”. PSAK revisi ini mengaturdampak dilutif pada opsi, waran dan ekuivalennya. PenerapanPSAK yang direvisi tersebut tidak memberikan pengaruh yangberarti terhadap laporan keuangan konsolidasian.Laba per saham dihitung dengan membagi laba tahun berjalanyang dapat diatribusikan kepada pemilik entitas induk denganjumlah rata-rata tertimbang saham yang beredar pada tahunyang bersangkutan (setelah dikurangi dengan saham yang dibelikembali), yaitu sebesar 46.875.122.110 saham masing-masinguntuk tahun yang berakhir pada tanggal-tanggal 31 Desember2012 dan 2011, setelah perubahan nilai nominal saham dari Rp50menjadi Rp10 yang terjadi pada tahun 2012 dan berlaku surutterhadap tahun 2011.Perseroan tidak mempunyai efek berpotensi saham biasa yangbersifat dilutif pada tanggal 31 Desember 2012 dan 2011.Penyataan standar akuntansi keuangan yang telah dikeluarkantetapi belum berlaku efektifBerikut ini adalah beberapa standar akuntansi yang telahditerbitkan oleh Dewan Standar Akuntansi Keuangan (DSAK) yangdipandang relevan terhadap pelaporan keuangan konsolidasianGrup Kalbe namun belum berlaku efektif untuk laporan keuangankonsolidasian tahun 2012:Efektif berlaku pada atau setelah tanggal 1 Januari 2013:• PSAK No. 38, “Kombinasi Bisnis Entitas Sepengendali”.• Penyesuaian PSAK No. 60, “Instrumen Keuangan:Pengungkapan”.• PPSAK No. 10, “Pencabutan PSAK No. 51: Akuntansi Kuasi-Reorganisasi”.Grup Kalbe sedang mengevaluasi dan belum menentukandampak dari standar yang direvisi dan pencabutan standartersebut terhadap laporan keuangan konsolidasiannya.no active market, fair value is determined using valuationtechniques. Such techniques may include using recent arm’s-length market transaction, reference to the current fair value ofanother instrument that is substantially the same, discountedcash flow analysis, or other valuation models.7. Earnings per ShareEffective on January 1, 2012, Kalbe Group applies PSAK No.56 (Revised 2011), “Earnings per Share”. The revised PSAKestablishes the dilutive effects of options, warrants and theirequivalents. The adoption of the said revised PSAK has nosignificant impact on the consolidated financial statements.Earnings per share are computed by dividing income for theyear attributable to equity holders of the parent company by theweighted-average number of shares outstanding during the year(less treasury stock), for 46,875,122,110 shares for the yearsended December 31, 2012 and 2011, respectively, after changein the nominal value of shares from Rp50 to Rp10 in 2012 thatwere retroactively applied to 2011.The Company has no outstanding potential dilutive ordinaryshares as of December 31, 2012 and 2011.Statements of financial accounting standards issued but not yeteffective The following are several revised accounting standards andrevocation published by the Indonesian Financial AccountingStandards Board (DSAK) that are considered relevant to theconsolidated financial statements of Kalbe Group but not yeteffective for 2012 consolidated financial statements are asfollows:Effective on or after January 1, 2013:• PSAK No. 38, “Combination Business of Entities UnderCommon Control”.• Amendment of PSAK No. 60 “Financial Instrument:Disclosure”.• PPSAK No. 10, ”Revocation of PSAK No. 51: Accounting forQuasi-Reorganization”.Kalbe Group is presently evaluating and has not yet determinedthe effects of these revised and revocation standards on itsconsolidated financial statements.
  • 170. PT Kalbe Farma Tbk. • Laporan Tahunan 2012168LAPORAN TATA KELOLA PERUSAHAANCorporate Governance Report
  • 171. PT Kalbe Farma Tbk. • 2012 Annual Report 169Mematuhi Norma danEtika Berbisnis yangBertanggung JawabSerta TransparanUpholding Responsible BusinessEthics and TransparencyTata Kelola PerusahaanCorporate Governance170-227
  • 172. Performance HighlightsManagement ReportCompany ProfileManagement Discussion and AnalysisCorporate GovernanceCorporate Social ResponsibilityPT Kalbe Farma Tbk. • Laporan Tahunan 2012170Prinsip dan Komitmen Terhadap Tata KelolaPerusahaan yang Baik (GCG)Kalbe senantiasa menempatkan aspek tata kelola perusahaansebagai faktor penting guna memperoleh kepercayaan daripara pemegang saham dan pemangku kepentingan lainnya.Kami meyakini bahwa tata kelola perusahaan harus dipraktikkanuntuk mendukung upaya Perseroan dalam meraih sasaran-sasaran usahanya serta juga dalam melindungi kepentingan parapemangku kepentingan.Pengembangan dan implementasi GCG dilakukan melaluipenyelarasan program-program GCG dengan nilai-nilaiperusahaan serta rencana strategis Perseroan.Dengan penerapan prinsip-prinsip dasar GCG yang mencakuptransparansi, akuntabilitas, responsibilitas, independensi dankesetaraan,Perseroanmeyakiniakanterciptakeseimbanganbisnissecara menyeluruh mencakup segenap bentuk kepentingan, baikekonomi maupun sosial, individu dengan kelompok, internal jugaeksternal, jangka pendek dan jangka panjang serta kepentinganpemegang saham dan pemangku kepentingan.Tujuan Penerapan GCGMengingat pentingnya implementasi GCG dalam menciptakankeseimbanganbagiseluruhpemangkukepentingandanmencapaikelangsungan usaha, Kalbe berkomitmen untuk mengembangkanGCG untuk mencapai sebuah sistem tata kelola yang baik dansesuai dengan nilai-nilai Perseroan. Dalam mengembangkanGCG, Kalbe juga mengacu kepada ketentuan dalam PedomanUmum Good Corporate Governance Indonesia yang dikeluarkanoleh Komite Nasional Kebijakan Governance, semua peraturanyang berlaku di Indonesia serta praktik-praktik bisnis terbaik.Penerapan GCG mempunyai tujuan utama untuk:1. Mengarahkan dan mengendalikan hubungan kerja OrganPerseroan yaitu antara Rapat Umum Pemegang Saham(RUPS), Dewan Komisaris dan Direksi;2. Meningkatkan pertanggungjawaban pengelolaan Perseroankepada Pemegang Saham dengan tetap memperhatikankepentingan para pemangku kepentingan;3. Menciptakan kejelasan hubungan kerja antara Perseroandengan para pemangku kepentingan;4. Mendorong dan mendukung pengembangan usaha,pengelolaan sumber daya Perseroan dan pengelolaan risikoyang efektif sehingga menjamin peningkatan nilai Perseroanyang berkelanjutan;Principles and Commitment to Good CorporateGovernance (GCG)Kalbe always regards GCG as an important factor to gain thetrust of its shareholders and other stakeholders. Our belief is thatGCG has to be practiced with the highest standard to support theCompany’s efforts in achieving its business objectives as well asin protecting the interest of all stakeholders.Kalbe’s GCG development and implementation are conductedby aligning its GCG programs with our corporate values and theCompany’s strategic plans.With the implementation of basic GCG principles, coveringtransparency, accountability, responsibility, independence andfairness, the Company believes that a thoroughly balancedbusiness, covering all economic, social, individual, public, as wellas internal, external, short term and long term interests and theinterests of shareholders and stakeholders will be achieved.Objectives of GCG ImplementationUnderlining the importance of GCG implementation in creatingbalance for all stakeholders and achieving a sustainablebusiness, Kalbe is committed to develop GCG to achieve agood corporate governance system in line with the Company’svalues. In developing GCG, Kalbe also pays attention to therequirements set in the General Guidelines for Indonesia’s GoodCorporate Governance issued by the National Policy GovernanceCommittee, all prevailing regulations applicable in Indonesia andby taking into account the prevailing business best practices.The main objectives of GCG implementation are to:1. To govern and to control work practices within CompanyOrgans, namely, the General Meeting of Shareholders, theBoard of Commissioners and Board of Directors;2. To improve the accountability of the Company’s managementtoward the shareholders by taking into account the interestsof all stakeholders;3. To create clarity in job relationships, between the Companyand its stakeholders;4. To promote and to support effective business expansion,resources management and risk management to ensuresustainable enhancement of the Company’s values;Performance HighlightsManagement ReportCompany ProfileManagement Discussion and AnalysisCorporate GovernanceCorporate Social ResponsibilityTata Kelola PerusahaanCorporate Governance
  • 173. PT Kalbe Farma Tbk. • 2012 Annual Report 1715. Mengarahkan pencapaian Visi dan Misi Perseroan;6. Meningkatkan profesionalisme sumber daya manusia;7. Menjadi dasar implementasi dan pengembangan BudayaPerseroan.Upaya Memperkuat Implementasi GCGImplementasi GCG di Kalbe dimulai dari level manajemenpuncak sampai kepada seluruh level pelaksana. Berbagai upayamemperkuat implementasi GCG yang terus dilakukan adalahsebagai berikut:1. Melanjutkan internalisasi nilai-nilai perusahaan Panca SradhaKalbe kepada seluruh jajaran karyawan untuk mendorongimplementasi pada seluruh proses bisnis.2. Memperbaharui dan menyempurnakan kebijakan-kebijakanPerseroan sesuai dengan asas-asas GCG serta perubahanperaturan perundang-undangan.3. Mengembangkan rencana kerja tahunan Perseroan untukmendukung perbaikan penerapan prinsip GCG di seluruhlingkungan Perseroan.4. Meninjau kembali pedoman GCG Perseroan serta melakukanbeberapa penyesuaian dengan mengikuti perkembanganpraktik GCG yang terakhir.5. To guide the attainment of the Company’s Vision andMission;6. To improve human resources’ professionalism;7. To become the basis for the implementation and developmentof Company Culture.Efforts to Reinforce GCG ImplementationAt Kalbe, GCG implementation begins from the top managementlevel and extends to all operation unit levels. Various effortsconducted to strengthen Kalbe’s GCG implementation are asfollows:1. To continue internalization of corporate values Panca SradhaKalbe to employees at all levels to promote the implementationwithin the entire business processes.2. To update and to enhance on the Company’s policiesbased on the GCG principles and changes in the prevailingregulations.3. To develop the Company’s annual work plan to supportimprovements in the implementation of GCG principles withinthe entire Company.4. To conduct reviews on the Company’s GCG guidelinesand introducing adjustments to stay abreast with the latestdevelopment in GCG practices.Pengembangan dan implementasi GCG dilakukan melaluipenyelarasan program-program GCG dengan nilai sertarencana strategis Perseroan.Kalbe’s GCG development and implementation are conducted by aligning its GCG programswith Company’s values and strategic plans.
  • 174. Performance HighlightsManagement ReportCompany ProfileManagement Discussion and AnalysisCorporate GovernanceCorporate Social ResponsibilityPT Kalbe Farma Tbk. • Laporan Tahunan 2012172Inisiatif Peningkatan Praktik GCG Selama 2012Selama tahun 2012, Kalbe telah melakukan beberapa inisiatifberikut untuk meningkatkan penerapan GCG:1. Penandatanganan Piagam Komite Audit pada tanggal 13Desember 2012 yang memuat tugas, tanggung jawab,wewenang dan kebijakan rapat Komite Audit. PiagamKomite Audit ini dimaksudkan untuk menjadi acuan danpedoman kerja bagi Komite Audit dalam menjalankan tugasdan tanggung jawabnya yang berdasarkan atas ketentuanperaturan yang berlaku :1. Undang-undang No. 40 tahun 2007 tentang PerseroanTerbatas;2. Peraturan Bapepam-LK No. IX.I.5 tentang Pembentukandan Pedoman Pelaksanaan Kerja Komite Audit2. Perubahan keanggotaan Komite-komite untuk lebihmeningkatkan efektivitas pelaksanaan tugas dan sehubungandengan berakhirnya masa tugas Bapak Johanes BerchmanApik Ibrahim sebagai anggota Komite Nominasi danRemunerasi.3. Pedoman Etika Melanjutkan inisiatif penyusunan Pedoman Etika yang dimulaitahun 2011, Kalbe terus mengembangkan konsep pedomanetika dengan membentuk Satuan Tugas GCG yang bertugasmenyusun rancangan pedoman etika yang mencerminkannilai-nilai Perseroan, Panca Sradha Kalbe sebagai berikut :1. Saling percaya adalah perekat di antara kami2. Kesadaran penuh adalah dasar setiap tindakan kami3. Inovasi adalah kunci keberhasilan kami4. Bertekad untuk menjadi yang terbaik5. Saling keterkaitan adalah panduan hidup kami Perseroan telah memiliki rancangan Pedoman Etika yangmemuat aspek-aspek pedoman perilaku korporasi danperilaku individu yang antara lain meliputi kepatuhan,penanganan benturan kepentingan, keterlibatan dalamkegiatan politik, komitmen terhadap karyawan, jaminanproduk, komitmen terhadap lingkungan, hubungan dengankonsumen serta pemasok dan lain-lain. Rancangan tersebut akan dibahas lebih lanjut untukmenghasilkan Pedoman Etika yang komprehensif sesuaidengantuntutanperkembanganusahadanstandarpenerapantata kelola perusahaan yang baik. Perseroan merencanakanuntuk meratifikasi dan mulai mensosialisasikan PedomanEtika pada tahun 2013.4. Whistleblowing System Perseroan berkomitmen melaksanakan kegiatan usahasecara bersih dan transparan dan menghindari kemungkinanpenyalahgunaan dan pelanggaran Pedoman Etika. Perseroanmenyadari perlunya memperkuat upaya pengendalianGCG Practice Improvement Initiatives in 2012During 2012, Kalbe completed the following initiatives to enhanceits GCG implementation:1. The ratification of the Audit Committee Charter on December13, 2012 outlining the roles, responsibilities, authorities andmeeting policy of the Audit Committee. The Audit CommitteeCharter is developed to serve as reference and workingguideline for the Audit Committee in conducting its roles andresponsibilities based on the prevailing regulations:1. Law No 40 year 2007 regarding Limited Liability ;2. Regulations of Bapepam-LK No. IX.I.5 regarding theGuidelines on Establishment and Working Implementationof Audit Committee2. Changes in the composition of the Committees to improveeffectiveness and to accommodate the resignation of JohanesBerchman Apik Ibrahim who previously served as a memberof the Nomination and Remuneration Committee.3. Code of Ethics To continue the development of the Code of Ethics thatstarted in 2011, Kalbe continued to develop the concept ofethical code by forming the GCG Task Force responsible forformulating the code of ethics that reflects the Company’svalues, Panca Sradha Kalbe as follows:1. Trust is the glue of life2. Mindfulness is the foundation of our actions3. Innovation is the key to our success4. Strive to be the best5. Interconnectedness is a universal way of life The Company has developed a draft of Code of Ethicscontaining the aspects of corporate conducts and individualconducts covering among others compliance, conflictof interest handling, involvement in political activities,commitment to employees, product guarantee, commitmentto environment, relationship with consumers and suppliers,etc. The draft will be further discussed to produce a comprehensiveCode of Ethics in line with the demand of business expansionand the standard of good corporate governance. TheCompany plans to ratify and start the socialization of theCode of Ethics in 2013.4. Whistleblowing System The Company is committed to conducting its business in aclear and transparent manner and avoiding the possibilityof abuse and breach of the Code of Ethics. The Companyrealizes the need to strengthen the efforts of internal control to
  • 175. PT Kalbe Farma Tbk. • 2012 Annual Report 173internal untuk mencegah praktik-praktik korupsi, kolusi,dan nepotisme, dan praktik kecurangan lainnya di dalampelaksanaan kegiatan usaha. Oleh karenanya, Kalbemelanjutkan upaya persiapan rancangan WhistleblowingSystem (WBS), yang telah dimulai tahun 2011. Pada tahun2012, sejalan dengan pembahasan Pedoman Etika secaralebih mendalam, Satuan Kerja GCG juga memperbaikirancangan WBS untuk menyesuaikan dengan kebutuhanPerseroan. Rancangan WBS yang sedang dikembangkan Perseroanmengatur aspek-aspek mekanisme pengaduan pelanggaranyang baku, peranan organ-organ GCG dalam penangananpengaduan pelanggaran, mengatur cara penangananterhadap pelanggaran yang dilaporkan, serta menjaminperlindungan terhadap pihak-pihak yang terlibat di dalamnya.Karyawan sebagai salah satu pemangku kepentingan yangterlibat secara langsung dalam kegiatan usaha Perusahaanmemiliki peranan yang penting untuk ikut mengawasi danmelaporkan tindakan-tindakan kecurangan yang terjadi.Mekanisme GCGSebagai pedoman pelaksanaan GCG dalam Perseroan, Kalbetelah memiliki kelengkapan kebijakan-kebijakan (soft-structure)yang mengatur berbagai aspek pelaksanaan GCG. Soft-structureGCG disusun sedemikian rupa agar sesuai dengan kebutuhanPerseroan dengan mengacu pada berbagai ketentuan yangberlaku di Indonesia.Soft-structure GCG yang berlaku di Kalbe adalah sebagaiberikut:a. Visi, Misi, Motto, serta nilai-nilai Perseroan Panca SradhaKalbe yang telah tertanam dalam sejarah perjalanan Kalbedan diperbaharui sesuai dengan perkembangan bisnisPerseroanb. Pedoman Good Corporate Governance PT Kalbe Farma Tbk.,yang telah diberlakukan sejak tahun 2001c. Buku Saku Panduan Pelaksanaan Tata Kelola Perusahaanyang telah didistribusikan kepada seluruh karyawan Kalbesejak tahun 2005d. Piagam Komite Audite. Piagam Audit Internalf. Kebijakan hukum Kalbe Good Legal Practice sejak tahun2006g. Kebijakan Teknologi Informasih. Kebijakan mengenai hak dan kewajiban karyawani. Kebijakan mengenai tanggung jawab sosial Perseroanj. Berbagai Standar Prosedur OperasionalKebijakan-kebijakan tersebut saling menunjang dan terusdikembangkan sejalan dengan kebutuhan perkembangan usahadan untuk menunjang peningkatan penerapan GCG di Kalbe.prevent practices such as corruption, collution and nepotism,and other form of frauds within the business. Therefore, Kalbecontinued the efforts to develop a draft of WhistleblowingSystem (WBS) which has started in 2011. In 2012, parallelto deeper discussion on the Code of Ethics, the GCG TaskForce worked on improving the WBS draft to align with theCompany’s requirements. The WBS draft under development governs the reportingmechanism for any occurrence of frauds, the roles of theGCG organs in following up any fraud reports, proceduresin resolving any reported frauds, and assuring protection ofinvolved parties. Employees as one of the stakeholders whoare directly involved in the Company’s operational activitiesplay an important role to monitor and report any occurrenceof frauds.GCG MechanismAs a guidance in GCG implementation in the Company, Kalbe hasestablished the necessary soft-structure instruments to managethe various aspects of GCG implementation. The GCG’s softstructure was developed to address the needs of the Companybased on the prevailing regulations in Indonesia.The GCG’s soft structure applied within Kalbe are as follows:a. Kalbe’s Vision, Mission, Motto and Panca Sradha Kalbe ascorporate values, which have been cultivated throughout thehistory of Kalbe and have been continuously updated in linewith the Company’s business developmentb. Good Corporate Governance Guidelines of PT Kalbe FarmaTbk., enacted since 2001c. GCG Implementation Guideline Book, which has beendistributed to all Kalbe employees since 2005d. Audit Committee Chartere. Internal Audit Charterf. Kalbe Good Legal Practices legal policy since 2006g. Information Technology Policyh. Policies on employee’s rights and obligationsi. Policies on the Company’s social responsibilitiesj. Various Standard Operating ProceduresThese policies are closely interconnected and continuouslydeveloped in line with business growth needs and to promoteimproved GCG implementation within Kalbe.
  • 176. Performance HighlightsManagement ReportCompany ProfileManagement Discussion and AnalysisCorporate GovernanceCorporate Social ResponsibilityPT Kalbe Farma Tbk. • Laporan Tahunan 2012174Struktur dan Hubungan GCGBerdasarkan Undang-undang Republik Indonesia No. 40 tahun2007 tentang Perseroan Terbatas (Undang-undang PerseroanTerbatas), organ perusahaan terdiri dari Rapat Umum PemegangSaham (RUPS), Dewan Komisaris, dan Direksi, yang memilikitugas dan tanggung jawab masing-masing dan mempunyaiperanan penting dalam pelaksanaan GCG secara efektif.RUPS merupakan wadah pengambilan keputusan penting olehpara pemegang saham, yang dilakukan dengan mengutamakankepentingan perusahaan dengan memperhatikan ketentuanAnggaran Dasar dan peraturan perundang-undangan yangberlaku.Dewan Komisaris dan Direksi secara bersama-sama memilikitanggung jawab atas kelangsungan usaha Perseroan dalamjangka panjang. Pengelolaan Perseroan dilakukan oleh Direksi,sementara Dewan Komisaris bertanggung jawab melakukanpengawasan terhadap kinerja pengelolaan perusahaan. Olehkarena itu, Dewan Komisaris dan Direksi harus memiliki kesamaanpersepsi terhadap visi, misi, dan nilai-nilai Perseroan.Untuk membantu pelaksanaan tugasnya, Dewan Komisarisdibantu oleh 5 Komite dan untuk membantu pelaksanaan tugasDireksi, telah dibentuk struktur organisasi yang efektif danefisien.Rapat Umum Pemegang Saham (RUPS)Mekanisme utama perlindungan dan pelaksanaan hak-hakpemegang saham adalah Rapat Umum Pemegang Saham.Sebagai organ perusahaan, RUPS memegang kekuasaantertinggi dalam Perseroan, yang memiliki segala kewenanganyang tidak diserahkan kepada Dewan Komisaris dan Direksi.Tanpa mengurangi kekuasaan dan wewenang yang dimiliki olehRUPS, RUPS atau pemegang saham tidak dapat melakukanintervensi terhadap pelaksanaan tugas, fungsi dan wewenangDewan Komisaris dan Direksi untuk menjalankan kewajiban danhaknya sesuai dengan Anggaran Dasar dan peraturan perundang-undangan.RUPS merupakan wadah para pemegang saham untukmengambil keputusan penting yang berkaitan dengan modalyang ditanam dalam perusahaan, dengan memperhatikanketentuan Anggaran Dasar dan peraturan perundang-undangan.Pengambilan keputusan dalam RUPS harus dilakukan secarawajar dan transparan dan didasarkan pada kepentingan usahaPerseroan dalam jangka panjang.Kewenangan RUPS antara lain mengangkat dan memberhentikananggota Dewan Komisaris dan Direksi, mengevaluasi kinerjaDewan Komisaris dan Direksi, menyetujui perubahan AnggaranDasar, menyetujui Laporan Tahunan dan menetapkan bentuk danStructure and Relationship of GCGBased on the Law of the Republic of Indonesia No. 40 Year 2007regarding Limited Company (Law of Limited Company), theCompany’s organs consist of the General Meeting of Shareholders(GMS), the Board of Commissioners and the Board of Directors,each with their own roles and responsibilities, playing importantrole in effective GCG implementation.GMS is the forum for shareholders to take important decisionsby considering the best interests of the Company, and taking intoaccount the requirements of the Articles of Association and allprevailing laws and regulations.The Board of Commissioners and Board of Directors arecollectively responsible for the continuity of the Company’sbusiness in the long term. The management of the Companyis carried out by the Board of Directors, whereas the Board ofCommissioners is responsible for conducting oversight onperformance of the Company’s management. Therefore, theBoards of Commissioners and Directors need to have compatibleperception regarding the Company’s Vision, Mission and values.In supporting their duties, the Board of Commissioners is assistedby 5 Committees, while to assist the Board of Directors inperforming its duties, the Company has established an effectiveand efficient organization structure.General Meeting of Shareholders (GMS)The main mechanism of protection and the manifestation of therights of shareholders is through General Meeting of Shareholders.As an organ of the company, GMS holds the supreme powerwithin the Company that possesses all authorities which cannotbe delegated to the Board of Commissioners and Board ofDirectors. Without diluting either the power and authority of theGMS, the GMS or shareholders may not intervene against theduties, functions and authorities of the Board of Commissionersand Board of Directors, in carrying out their obligations and rightsin accordance with the Articles of Association and prevailingregulations.The GMS serves as a mechanism for shareholders to makeimportant decisions related to capital invested in the Company,in accordance with statements in the Articles of Association andall prevailing regulations. Decision making by the GMS must beconducted in a fair and transparent manner based on the long-term interests of the Company’s businesses.The authorities of the GMS include, among others, theauthority of appointing and dismissing members of the Boardof Commissioners and the Board of Directors, evaluating theperformance of the Board of Commissioners and the Board of
  • 177. PT Kalbe Farma Tbk. • 2012 Annual Report 175jumlah remunerasi anggota Dewan Komisaris dan Direksi sertamengambil keputusan terkait tindakan korporasi atau keputusanstrategis lainnya yang diajukan Direksi.Pelaksanaan RUPS Tahunan dan RUPS Luar Biasa tahun 2012telah didahului dengan pemberitahuan dan panggilan bagipemegang saham sesuai ketentuan yang berlaku. Kalbe memilikitatacara penyelenggaraan RUPS dimana disebutkan bahwaagenda acara RUPS disampaikan beserta undangan RUPS.Proses penyelenggaraan RUPS tersebut telah dilaksanakansesuai dengan UU No. 40 tahun 2007 tentang Perseroan TerbatasPasal 81, 82 & 83 serta Peraturan Bapepam-LK No.IX.I.1 tentangRencana dan Pelaksanaan Rapat Umum Pemegang Sahamdan Peraturan Bapepam-LK No.IX.J.1 tentang Pokok-pokokAnggaran Dasar Perusahaan yang Melakukan Penawaran UmumEfek Bersifat Ekuitas dan Perusahaan Publik dengan prosessebagai berikut:PemberitahuanNotificationPengumumanAnnouncementPanggilanInvitationHasil RUPSGMS Result16 April 2012April 16, 201223 April 2012April 23, 20128 Mei 2012May 8, 201225 Mei 2012May 25, 2012• Melalui surat Perseroankepada Bapepam-LK danBursa Efek Indonesia No.010/CSEC-KF/IV-12 perihalPenyampaian RencanaPelaksanaan RUPS Tahunandan Luar Biasa PerseroanBy letter of the CompanyNo. 010/CSEC-KF/IV-12 to Bapepam-LK andIndonesia Stock Exchangeconcerning Information onThe Company’s Annual andExtraordinary GMS Plan• Melalui surat Perseroankepada Bapepam-LK danBursa Efek Indonesia No.014/CSEC-KF/IV-12 perihalPemberitahuan PelaksanaanRUPS Tahunan dan LuarBiasa PerseroanBy letter of the CompanyNo. 014/CSEC-KF/IV-12 toBapepam-LK and IndonesiaStock Exchange concerningAnnouncement of TheCompany’s Annual andExtraordinary GMS• Melalui surat Perseroankepada Bapepam-LK danBursa Efek Indonesia No.025/CSEC-KF/V-12 perihalPanggilan RUPS Tahunandan Luar Biasa PerseroanBy letter of the CompanyNo. 025/CSEC-KF/V-12 toBapepam-LK and IndonesiaStock Exchange concerningInvitation to The Company’sAnnual and ExtraordinaryGMS• Melalui surat Perseroankepada Bapepam-LK danBursa Efek Indonesia No.031/CSEC-KF/V-12 perihalPenyampaian Hasil RUPSTahunan dan Luar BiasaPerseroanBy letter of the CompanyNo. 031/CSEC-KF/V-12 toBapepam-LK and IndonesiaStock Exchange concerningResolution of the Company’sAnnual and ExtraordinaryGMS• Melalui iklan di surat kabarBisnis Indonesia danInvestor DailyBy advertisement in dailynewspaper Bisnis Indonesiaand Investor Daily• Melalui iklan di surat kabarBisnis Indonesia danInvestor DailyBy advertisement in dailynewspaper Bisnis Indonesiaand Investor Daily• Melalui iklan di surat kabarBisnis Indonesia danInvestor DailyBy advertisement in dailynewspaper Bisnis Indonesiaand Investor DailyRUPS TahunanSelama tahun 2012, Kalbe telah melaksanakan 1 kali RUPSTahunan. RUPS Tahunan tersebut dilaksanakan pada tanggal23 Mei 2012 di Gedung Bintang Toedjoe, Jl. Jend. A.Yani No. 2,Pulomas, Jakarta.Directors, approving amendments to the Articles of Association,approving the Annual Report and determining the form and amountof remuneration for members of the Board of Commissioners andthe Board of Directors, as well as making decisions related tocorporate actions or other strategic matters proposed by theBoard of Directors.The implementation of the Annual GMS and the ExtraordinaryGMS held in 2012 were preceded by an announcement andinvitation to the shareholders in accordance with the prevailingregulations. Kalbe has a mechanism for GMS implementationthat states that the agenda of GMS is to be delivered togetherwith the invitation to the GMS.The execution of GMS was conducted pursuant to Law No. 40Year 2007 concerning Limited Companies, Articles 81, 82 & 83and Bapepam-LK Regulation No. IX.I.1 regarding the Plan andImplementation of GMS and and Bapepam-LK Regulation No.IX.J.1 regarding Principles of Articles of Association of Companieswith Equity based Securities and Public Companies with the thefollowing process:Annual GMSDuring 2012, Kalbe has conducted 1 Annual GMS. The AnnualGMS was convened on May 23, 2012 in Bintang Toedjoe Building,Jl. Jend A. Yani No. 2, Pulomas, Jakarta.
  • 178. Performance HighlightsManagement ReportCompany ProfileManagement Discussion and AnalysisCorporate GovernanceCorporate Social ResponsibilityPT Kalbe Farma Tbk. • Laporan Tahunan 2012176RUPS Tahunan tersebut dihadiri dan/atau diwakili oleh parapemegang saham serta kuasa pemegang saham Perseroanyang berjumlah 8.091.078.308 saham atau mewakili 86,30% dari9.375.024.422 saham yang merupakan seluruh saham yang telahdikeluarkan oleh Perseroan (setelah dikurangi dengan jumlahsaham yang telah dibeli kembali oleh Perseroan dan berdasarkanjumlah saham sebelum pemecahan nilai nominal saham).RUPS Tahunan pada tanggal 23 Mei 2012 tersebut telahmenghasilkan keputusan-keputusan sebagai berikut:1. Menyetujui dan mengesahkan Laporan Tahunan Perseroanuntuk tahun buku yang berakhir pada tanggal 31 Desember2011 yang diantaranya meliputi Laporan Kegiatan Perseroan,Laporan Tugas Pengawasan Dewan Komisaris, serta RencanaKegiatan Usaha Perseroan sebagaimana disampaikan dalamRUPS Tahunan.2. a. Menyetujui dan mengesahkan Laporan KeuanganPerseroan yang memuat Neraca dan Perhitungan LabaRugi Perseroan untuk tahun buku yang berakhir padatanggal 31 Desember 2011 yang telah diaudit oleh KantorAkuntan Publik Purwantono, Suherman & Surja;b. Memberikan pelunasan dan pembebasan tanggungjawab sepenuhnya kepada Dewan Komisaris dan DireksiPerseroan atas tindakan pengawasan dan pengurusanyang mereka lakukan dalam tahun buku yang berakhirpada tanggal 31 Desember 2011 (acquit et decharge),sepanjang tindakan-tindakan mereka tersebut tercermindalam Laporan Keuangan dan Laporan TahunanPerseroan untuk tahun buku yang berakhir pada tanggal31 Desember 2011.3. a. Dalam tahun buku 2011, Perseroan telah membukukanlaba bersih sebesar Rp1.482.236.969.778 dan ataslaba bersih tersebut menyetujui untuk menetapkanpenggunaannya sebagai berikut :i. Dibagikan sebagai dividen tunai sebesar Rp95 persaham kepada para pemegang saham, tidak termasuksaham yang telah dibeli kembali oleh Perseroan, yangtercatat pada daftar pemegang saham Perseroanpada tanggal pencatatan (recording date) yang akanditetapkan oleh Direksi;ii. Sebesar Rp14.822.369.697 dialokasikan dandibukukan sebagai dana cadangan; daniii. Sisanya dibukukan sebagai laba ditahan yang akandigunakan untuk menambah modal kerja Perseroan.b. Memberikan wewenang dan kuasa kepada DireksiPerseroan untuk melakukan semua dan setiap tindakanyang diperlukan sehubungan dengan pembagian dividentunai tersebut, termasuk tidak terbatas untuk menentukanwaktu, tanggal dan cara pembayaran dividen tunaitersebut.4. Menyetujui melimpahkan wewenang kepada DewanKomisaris Perseroan dengan memperhatikan masukan/rekomendasi dari Komite Remunerasi, untuk menetapkanjumlah gaji dan/atau honorarium anggota Dewan Komisarisdan anggota Direksi Perseroan.The Annual GMS was attended by shareholders and proxieswho in total held 8,091,078,308 shares, representing 86.30%of the total 9,375,024,422 shares issued by the Company (afterdeducting all shares repurchased by the Company based on thenumber of shares before stock split).The Annual GMS on May 23, 2012 has approved the followingresolutions:1. Approved and ratified the Annual Report of the Company forthe fiscal year ended December 31, 2011, which includedReport of the Company’s Activities, Report of the Boardof Commissioners Supervisory Role, and the Company’sBusiness Plan as presented in the Annual GMS.2. a. Approved and ratified the Company’s Audited FinancialStatements for the fiscal year ended December 31, 2011,as audited by the Public Accounting Firm Purwantono,Suherman & Surja.b. Granted full discharge from their responsibilities to allmembers of the Board of Commissioners and Board ofDirectors for their management and supervision actionsduring the fiscal year ended December 31, 2011 (acquitet decharge), as long as the actions were reflected in theCompany’s Annual Report and the Company’s AuditedFinancial Statements for the year ended December 31,2011.3. a. In fiscal year ended December 31, 2011, the Companyrecorded net income of Rp1,482,236,969,778. and forthis net income, it was agreed to determine appropriationas follows:i. Distributed as cash dividends of Rp95 per share tothe shareholders, excluding shares which have beenrepurchased by the Company, as recorded in theCompany’s register of shareholders on the recordingdate to be determined by the Board of Directors;ii. The amount of Rp14,822,369,697 is allocated andrecorded as reserve funds; andiii. The remaining amount is recorded as retainedearnings, to be used as additional working capital forthe Company.b. Delegated authority to the Board of Directors of theCompany to perform all and any necessary actions inconnection with the distribution of said cash dividend,including but not limited to determining the time, dateand method of payment of the cash dividend.4. Approved the delegation of authority to the Board ofCommissioners of the Company, by taking into accountthe inputs / recommendations from the RemunerationCommittee, to determine the amount of the salary and/orhonorarium of the members of the Board of Commissionersand the members of the Board of Directors.
  • 179. PT Kalbe Farma Tbk. • 2012 Annual Report 1775. Memberikan wewenang dan kuasa kepada Direksi Perseroandengan persetujuan Dewan Komisaris Perseroan, untukmenunjuk Akuntan Publik Independen yang akan melakukanaudit atas Laporan Keuangan Perseroan untuk tahunbuku yang berakhir pada tanggal 31 Desember 2012, danmemberikan wewenang kepada Direksi Perseroan untukmenetapkan honorarium Akuntan Publik Independen tersebutserta persyaratan lain penunjukannya.RUPS Luar BiasaSelama tahun 2012, Kalbe telah melaksanakan 1 kali RUPS LuarBiasa. RUPS Luar Biasa tersebut dilaksanakan pada tanggal23 Mei 2012 di Gedung Bintang Toedjoe, Jl. Jend. A.Yani No.2,Pulomas, Jakarta.RUPS Luar Biasa tersebut dihadiri dan/atau diwakili oleh parapemegang saham serta kuasa pemegang saham Perseroanyang berjumlah 8.083.435.353 saham atau mewakili 86,22% dari9.375.024.422 saham yang merupakan seluruh saham yang telahdikeluarkan oleh Perseroan (setelah dikurangi dengan jumlahsaham yang telah dibeli kembali oleh Perseroan dan berdasarkanjumlah saham sebelum pemecahan nilai nominal).RUPS Luar Biasa pada tanggal 23 Mei 2012 tersebut telahmenghasilkan keputusan-keputusan sebagai berikut:1. a. Menyetujui pemecahan nilai nominal (stock split) atassaham Perseroan semula sebesar Rp50 per sahammenjadi sebesar Rp10 per saham; b. Memberikan kuasa dan wewenang kepada DireksiPerseroan dengan hak untuk memindahkan Kuasa inikepada orang lain, untuk melakukan segala tindakan yangdiperlukan sehubungan dengan keputusan mengenaipemecahan nilai nominal (stock split) atas sahamPerseroan tersebut diatas, sesuai dengan perundang-undangan dan peraturan yang berlaku di Pasar Modal.2. I. Menyetujui: a. penyesuaian ketentuan Pasal 3 Anggaran DasarPerseroan, sehingga untuk selanjutnya menjadi tertulisdan berbunyi sebagai berikut :1. Maksud dan tujuan Perseroan ialah:- Berusaha dalam bidang farmasi, perdagangandan perwakilan.2. Untuk mencapai maksud dan tujuan tersebut diatasPerseroan dapat melaksanakan kegiatan usahasebagai berikut :a. Kegiatan Usaha Utama :i. Menjalankan usaha dalam bidangpengembangan dan pembuatan (industri) :- sediaan farmasi meliputi obat, bahan obat,obat tradisional, dan produk konsumsikesehatan;- produk kesehatan hewan;- alat kesehatan;- kosmetika yang meliputi antara lain produkperawatan pribadi;- dan lain-lain5. Granted authority and power to the Board of Directors of theCompany with the approval of the Board of Commissionersof the Company, to appoint Independent Public Accountantto perform an audit on the Company’s Financial Statementsfor the fiscal year ended December 31, 2012 and providedauthority to the Board of Directors to determine thehonorarium of the Independent Public Accountant and otherappointment’s conditions.Extraordinary GMSDuring 2012, Kalbe has conducted 1 Extraordinary GMS. TheExtraordinary GMS was convened on May 23, 2012 in BintangToedjoe Building, Jl. Jend A. Yani No. 2, Pulomas, Jakarta.The Extraordinary GMS was attended by shareholders andproxies with the amount of 8,083,435,353 shares, representing86.22% of the total 9,375,024,422 shares issued by the Company(after deducting all shares repurchased by the Company basedon the number of shares before stock split).The Extraordinary GMS held on May 23, 2012 has approved thefollowing resolutions:1. a. Approved the split of the nominal value of the Company’sshares from Rp50 per share to Rp10 per share; b. Granted authority and power to the Board of Directors ofthe Company, with the right of substitution, to perform alland any necessary actions with respect to the stock splitof the Company’s shares, in accordance to the laws andregulations in the capital market.2. I. Approved: a. The adjustment of the provision of Article 3 of theCompany’s Articles of Association, so that they arehereby restated and read as follows:1. The purpose and objectives of the Company is:- To engage in pharmaceuticals, trading, andagency businesses.2. To achieve the said purpose and objectives, theCompany may conduct the following businessactivities:a. Main business activities:i. To engage in development and manufacturing(industry):- pharmaceuticals preparation includingmedicines,medicinerawmaterials,traditionalmedicines and consumer health products;- animal health products;- medical devices;- cosmeticsincludingamongotherspersonalcare products;- and others;
  • 180. Performance HighlightsManagement ReportCompany ProfileManagement Discussion and AnalysisCorporate GovernanceCorporate Social ResponsibilityPT Kalbe Farma Tbk. • Laporan Tahunan 2012178ii. Menjalankan usaha dalam bidang perdaganganumum yang meliputi perdagangan secaraimpor, ekspor, lokal serta antar pulau(interinsulair) baik untuk perhitungan sendirimaupun secara komisi atas perhitungan pihaklain, demikian pula usaha-usaha perdagangansebagai leveransir (supplier), grosir dandistributor, bertindak sebagai perwakilan dan/atau peragenan dari perusahaan-perusahaanlain baik di dalam maupun di luar negeri,untuk segala macam sediaan farmasi meliputiobat, bahan obat, obat tradisional dan produkkonsumsi kesehatan.b. Kegiatan Usaha Penunjang :i. Melaksanakan berbagai kegiatan riset danpenelitian untuk mendukung pengembangandan pembuatan (industri) produk sediaanfarmasi;ii. Melaksanakan berbagai kegiatan untukmengoptimalkan pemanfaatan sumber dayaPerseroan, antara lain aset tetap dan asetbergerak, fasilitas sistem informasi, fasilitaspendidikan dan pelatihan;iii. Melakukan kegiatan yang melibatkanmasyarakat dalam rangka promosi danpemasaran produkb. perubahan Pasal 4 ayat 1 dan 2 Anggaran DasarPerseroan, sehingga untuk selanjutnya menjadi tertulisdan berbunyi sebagai berikut :1. ModaldasarPerseroanberjumlahRp850.000.000.000(delapan ratus lima puluh miliar Rupiah), terbagiatas 85.000.000.000 (delapan puluh lima miliar)saham, masing-masing saham bernilai nominal Rp10(sepuluh Rupiah);2. Dari modal dasar tersebut telah ditempatkan sebesar59,74 % (lima puluh sembilan koma tujuh puluhempat persen) atau sejumlah 50.780.072.110 (limapuluh miliar tujuh ratus delapan puluh juta tujuh puluhdua ribu seratus sepuluh) saham dengan nilai nominalseluruhnya sebesar Rp507.800.721.100 (lima ratustujuh miliar delapan ratus juta tujuh ratus dua puluhsatu ribu seratus Rupiah), yang telah diambil bagianoleh para pemegang saham.c. perubahan Pasal 11 ayat 1 Anggaran Dasar Perseroan,sehingga untuk selanjutnya menjadi tertulis dan berbunyisebagai berikut :1. Perseroan diurus dan dipimpin oleh Direksi terdiridari sekurang-kurangnya 2 orang anggota Direksi,dengan susunan sebagai berikut :a. seorang Presiden Direktur;b. seorang atau lebih Direktur. dengan memperhatikan peraturan yang berlakudi bidang Pasar Modal.ii. To engage in general trading includingimport, export, local and inter-island both forown accounts or based on commission forother parties’ accounts, as well as tradingactivities as supplier, wholesaler, distributor,act as a representative and/or an agency ofother companies, both domestic and foreign,for pharmaceuticals preparation includingmedicines, medicine raw materials, traditionalmedicines and consumer health products.b. Supporting business activities:i. Conducting various research anddevelopment to support the development andmanufacturing (industry) of pharmaceuticalspreparation.ii. Conducting various activities to optimizeCompany asset utilization, among othersfixed assets and movable assets, informationsystem facilities, education and trainingfacilities.iii. Conducting activities involving the communityin product promotion and marketing.b. The amendment of the provision of Article 4 paragraph 1and 2 of the Company’s Articles of Association, so thatthey are hereby restated and read as follows:1. The authorized capital of the Company amountedto Rp850,000,000,00.00 (eight hundred fifty billionRupiah) comprising of 85,000,000,000 (eighty fivebillion) shares, where each share has a nominal valueof Rp10 (ten Rupiah);2. 59.74 % (fifty nine point seven four percent) out of theauthorized capital has been issued and fully-paid, or50,780,072,110 (fifty billion seven hundred and eightymillion seventy two thousand one hundred and ten)shares with the nominal value of Rp507,800,721,100(five hundred seven billion eight hundred million sevenhundred twenty one thousand one hundred Rupiah)which has been contributed by the shareholders.c. The amendment of the provision of Article 11 paragraph 1of the Company’s Articles of Association, so that they arehereby restated and read as follows:1. The Company is managed and led by a Board ofDirectors which consist of at least 2 members withthe following composition:a. One President Director;b. One or more Director(s). in accordance to the laws and regulations in thecapital market.
  • 181. PT Kalbe Farma Tbk. • 2012 Annual Report 179II. Memberikan kuasa dan wewenang kepada Direksi,dengan hak untuk memindahkan Kuasa ini kepada oranglain, untuk melakukan semua dan setiap tindakan yangdiperlukan sehubungan dengan keputusan tersebutdiatas, termasuk tetapi tidak terbatas untuk menuangkankeputusan Rapat ini dalam Akta yang dibuat dihadapanNotaris, untuk menyesuaikan, mengubah dan menyusunkembali ketentuan Pasal 3, Pasal 4 ayat 1 dan ayat2 serta Pasal 11 ayat 1 Anggaran Dasar Perseroanyang disyaratkan oleh dan sesuai dengan ketentuanperundang-undangan dan peraturan yang berlaku diPasar Modal, yang selanjutnya memohon persetujuandan/atau menyampaikan pemberitahuan atas keputusanRapat ini dan/atau pengubahan Anggaran Dasar inikepada instansi yang berwenang dan untuk membuatpengubahan dan/atau tambahan dalam bentuk yangbagaimanapun juga yang diperlukan untuk memperolehpersetujuan dan/atau diterimanya pemberitahuantersebut dan untuk mengajukan dan menandatanganisemua permohonan dan dokumen lainnya, untuk memilihtempat kedudukan dan untuk melaksanakan tindakanlain yang mungkin diperlukan.3. I. a. Menerima pengunduran diri Bapak Johanes BerchmanApik Ibrahim selaku Wakil Presiden Direktur Perseroan,dengan ucapan terima kasih atas jasa-jasanya (danmemberikan pembebasan dan pelunasan tanggungjawab sepenuhnya (acquit et decharge) atas tindakanpengurusan yang telah dilakukan selama melaksanakanjabatannya, sepanjang tindakan tersebut tercermindalam buku-buku atau catatan-catatan Perseroan) efektifterhitung sejak tanggal diterimanya pemberitahuan atasperubahan Pasal 11 ayat 1 Anggaran Dasar oleh MenteriHukum dan Hak Asasi Manusia sebagaimana telahdiputuskan dalam agenda kedua Rapat ini;b. Menetapkan Bapak Vidjongtius selaku Direktur (tidakterafiliasi) terhitung sejak ditutupnya RUPS Luar Biasa ini,sehingga selanjutnya susunan anggota Direksi Perseroan:i. Terhitung sejak ditutupnya RUPS Luar Biasa inisampai dengan Dewan Komisaris tanggal diterimanyapemberitahuan atas perubahan Pasal 11 ayat 1Anggaran Dasar oleh Menteri Hukum dan Hak AsasiManusia, sebagaimana telah diputuskan dalamagenda kedua RUPS Luar Biasa ini, adalah sebagaiberikut:Direksi Board of DirectorsPresiden Direktur Bernadette Ruth Irawati Setiady President DirectorWakil Presiden Direktur Johanes Berchman Apik Ibrahim Vice President DirectorDirektur Budi Dharma Wreksoatmodjo DirectorDirektur Herman Widjaja DirectorDirektur (tidak terafiliasi) Vidjongtius Director (unaffiliated)Direktur Ongkie Tedjasurja DirectorII. GrantedauthorityandpowertotheBoardofDirectors,withthe right of substitution, to perform all and any necessaryactions with respect to the above resolutions, includingbut not limited to present the resolutions of the EGMS indeed drawn up in front of a notary, to adjust, amend, andrearrange the provisions of Article 3, Article 4 paragraph1 and 2, Article 11 paragraph 1 of the Company’s Articlesof Association in accordance to the requirements of thelaws and regulations in the capital market, to requestapproval and/or provide information of the resolutionsand/or amendment of Company’s Articles of Associationto the authorized institutions and to create amendmentand/or addition in any forms which are needed to obtainapproval and/or the acceptance of the notification and topropose and sign all requests and other documents, tochoose location and to execute other actions which maybe required.3. I. a. Accepted the resignation of Johanes Berchman ApikIbrahim as the Vice President Director of the Company,with an expression of appreciation for his services (andgranted discharge from his responsibilities (acquit etdecharge) for the performance of management actions,as long as the actions were reflected the Company’sbooks and reports), effective from the date when theinformation on the amendment of the provision of Article11 paragraph 1 of the Company’s Article of Associationhas been received by The Ministry of Law and HumanRights, as has been decided in the second agenda of thisExtraordinary GMS.b. Appointed Vidjongtius as Director (unaffiliated), effectivefrom the closing of this Extraordinary GMS, therefore, thecomposition of the Board of Directors will be as follows:i. Since the closing of this Extraordinary GMS to thedate when the information on the amendment of theprovision of Article 11 paragraph 1 of the Company’sArticle of Association has been received by theMinistry of Law and Human Rights, as has beendecided in the second agenda of this ExtraordinaryGMS:
  • 182. Performance HighlightsManagement ReportCompany ProfileManagement Discussion and AnalysisCorporate GovernanceCorporate Social ResponsibilityPT Kalbe Farma Tbk. • Laporan Tahunan 2012180ii. Dan terhitung sejak tanggal diterimanyapemberitahuan atas perubahan Pasal 11 ayat 1Anggaran Dasar oleh Menteri Hukum dan Hak AsasiManusia, sebagaimana telah diputuskan dalamagenda kedua RUPS Luar Biasa ini, sampai denganditutupnya RUPS Tahunan Perseroan pada tahun2014, adalah sebagai berikut :Direksi Board of DirectorsPresiden Direktur Bernadette Ruth Irawati Setiady President DirectorDirektur Budi Dharma Wreksoatmodjo DirectorDirektur Herman Widjaja DirectorDirektur (tidak terafiliasi) Vidjongtius Director (unaffiliated)Direktur Ongkie Tedjasurja DirectorII. Memberikan wewenang dan kuasa dengan hak substitusikepada Direksi Perseroan untuk melakukan segalatindakan sehubungan dengan perubahan susunananggota Direksi Perseroan tersebut di atas termasuktetapi tidak terbatas untuk membuat atau meminta untukdibuatkan serta menandatangani segala akta yang dibuatdihadapan Notaris, selanjutnya memberitahukan kepadapihak yang berwenang serta melakukan semua dan setiaptindakan yang diperlukan sehubungan dengan keputusantersebut sesuai dengan peraturan perundang-undanganyang berlaku.Dewan KomisarisDewan Komisaris bertugas dan bertanggung jawab secarakolektif untuk melakukan pengawasan dan memberikan nasihatkepada Direksi atas kegiatan pengurusan, termasuk memastikanbahwa Kalbe melaksanakan GCG pada seluruh tingkatan ataujenjang organisasi.Secara kolektif, Dewan Komisaris memiliki kompetensiyang memadai untuk menjalankan tanggung jawab yangdiamanahkan. Dewan Komisaris memiliki pemahaman yang baikmengenai Perseroan, kemampuan untuk mengambil keputusansecara independen, kemampuan memberikan masukan yangmembangun bagi manajemen dalam menghadapi permasalahanPerseroan dan dalam mendorong kinerja Perseroan untuk terustumbuh dan berkembang secara berkelanjutan. Seluruh anggotaDewan Komisaris memiliki integritas dan reputasi yang baik.Dalam rangka mendukung efektivitas pelaksanaan tanggungjawabnya, Dewan Komisaris telah membentuk Komite Audit,Komite Nominasi, Komite Remunerasi, Komite Risiko Usaha danKomite GCG.Proses pengangkatan dan pemilihan Dewan Komisaris telahmemenuhi ketentuan peraturan perundang-undangan yangberlaku.ii. And from the date when the information on theamendment of the provision of Article 11 paragraph1 of the Company’s Article of Association has beenreceived by the Ministry of Law and Human Rights,as has been decided in the second agenda of thisExtraordinary GMS, until the closing of the AnnualGMS to be held in year 2014:II. Granted authority and power with the right of substitutionto the Board of Directors of the Company to performall necessary actions with respect to the changes incomposition of the members of Board of Directors asmentioned above, including but not limited to create orto request to create and sign all deeds drawn up in frontof Notary, then to provide information to the authorizedinstitutions and conduct all and any relevant actions withrespect to the resolutions in accordance to the prevailinglaws and regulations.Board of CommissionersThe Board of Commissioners has the collective duty andresponsibility to supervise and provide advises to the Boardof Directors in managing the Company, including to ensurethat Kalbe has implemented GCG at all organizational levels orhierarchy.Collectively, the Board of Commissioners possess relevantexpertise to carry the mandated responsibilities. The Board ofCommissioners possesses good understanding of the Company,the ability to make independent decisions, the ability to provideconstructive feedbacks to the management in dealing withthe Company’s challenges and to drive sustainable growthof the Company. All members of the Board of Commissionersdemonstrate sound integrity and possess good reputation.To ensure effective execution of its duties, the Board ofCommissioners has established its Audit Committee, NominationCommittee, Remuneration Committee, Business Risk Committeeand GCG Committee.The appointment and election of the Board of Commissionershas complied with applicable laws and regulations.
  • 183. PT Kalbe Farma Tbk. • 2012 Annual Report 181Anggota Dewan Komisaris tidak mengambil dan/atau menerimakeuntungan pribadi dari Perseroan selain remunerasi danfasilitas lainnya yang ditetapkan RUPS. Dalam melaksanakantugas, Dewan Komisaris bertanggung jawab kepada RUPS.Pertanggungjawaban Dewan Komisaris kepada RUPS merupakanperwujudan akuntabilitas pengawasan atas pengelolaanperusahaan dalam rangka pelaksanaan prinsip-prinsip GCG.Kinerja Dewan Komisaris dievaluasi berdasarkan unsur-unsurpenilaian kinerja yang disusun secara mandiri oleh DewanKomisaris. Pelaksanaan penilaian dilakukan pada tiap akhirperiode tutup buku. Hasil penilaian kinerja Dewan Komisarisdisampaikan dalam RUPS.Tugas dan Tanggung jawab Dewan KomisarisPelaksanaan tugas dan tanggung jawab Dewan Komisaris sejalandengan Anggaran Dasar dan peraturan perundang-undanganyang berlaku.Tugas dan tanggung jawab Dewan Komisaris dapat dirincisebagai berikut:a. Melakukan pengawasan atas jalannya pengurusan Perseroanoleh Direksi serta memberikan persetujuan dan pengesahanatas rencana kerja dan anggaran tahunan Perseroan.b. Mengadakan rapat atau pertemuan secara berkala untukmembahas pengelolaan operasional Perseroan.c. Mengawasi pengelolaan Perseroan atas kebijakan yangtelah ditetapkan oleh Direksi dan memberikan masukan jikadiperlukan.d. Menominasikan dan menunjuk calon anggota DewanKomisaris dan Direksi untuk diajukan dan disetujui dalamRUPS Tahunan.e. Menentukan jumlah remunerasi bagi anggota DewanKomisaris dan Direksi, berlandaskan pada wewenang yangdiberikan dalam RUPS Tahunan.f. Menunjuk dan menetapkan anggota Komite Audit.Komposisi Keanggotaan dan Independensi DewanKomisarisSusunan Dewan Komisaris telah memenuhi kriteria jumlah,komposisi dan independensi sesuai ketentuan yang berlakudimana jumlah anggota Dewan Komisaris saat ini adalah 6 orang,termasuk 2 Komisaris Independen atau sama dengan 33% daritotal jumlah anggota Dewan Komisaris.Sampai dengan tanggal 31 Desember 2012, susunan DewanKomisaris Kalbe adalah sebagai berikut:Members of the Board of Commissioners do not take and/or receive any personal benefits from the Company other thanthe remuneration or other facilities as stipulated by the GMS. Incarrying out its duties, the Board of Commissioners is responsibleto the GMS. The Board of Commissioners’ accountability tothe GMS is a manifestation of supervisory accountability onthe management of the Company in the implementation of theprinciples of GCG.The performance of the Board of Commissioners is evaluatedbased on performance assessment measures, developedindependently by the Board of Commissioners. Assessments arecarried out at the end of a fiscal period. Results from the Boardof Commissioners’ performance evaluation are presented in theGMS.Duties and Responsibilities of the Board ofCommissionersThe execution of the duties and responsibilities of the Board ofCommissioners is in accordance with the Articles of Associationand all applicable regulations.The duties and responsibilities of the Board of Commissionersare as follows:a. Conduct supervision over the management of the Companyby the Board of Directors and give approval and ratificationon the Company’s work plan and annual budget.b. Conduct regular meetings to discuss the operationalmanagement of the Company.c. Oversee the management of the Company’s policiesestablished by the Board of Directors and provide input ifnecessary.d. Nominate and appoint candidates for the Board ofCommissioners and Board of Directors to be submitted andapproved at the Annual GMS.e. Determine the amount of remuneration for members of Boardof Commissioners and Board of Directors, based on theauthority given during the AGM.f. Appoint and assign members of the Audit Committee.Composition and Independency of the Board ofCommissionersThe Board of Commissioners has met the number, composition,and independency criteria pursuant to prevailing regulations,where the Board of Commissioners comprises 6 members,including 2 Independent Commissioner members or 33% of totalmembers of the Board of Commissioners.AsatDecember31,2012,membersoftheBoardofCommissionersof Kalbe are as follows:
  • 184. Performance HighlightsManagement ReportCompany ProfileManagement Discussion and AnalysisCorporate GovernanceCorporate Social ResponsibilityPT Kalbe Farma Tbk. • Laporan Tahunan 2012182NamaNameJabatanTitleRepresentasi Pemegang SahamShareholders’ RepresentationMasa JabatanPeriodJohannes SetijonoPresiden KomisarisPresident Commissioner- 2011 – 2014Santoso OenKomisarisCommissioner- 2011 – 2014Jozef Darmawan AngkasaKomisarisCommissioner- 2011 – 2014Ferdinand AryantoKomisarisCommissioner- 2011 – 2014Wahjudi PrakarsaKomisaris IndependenIndependent CommissionerIndependenIndependent2011 – 2014Farid Anfasa MoeloekKomisaris IndependenIndependent CommissionerIndependenIndependent2011 – 2014Tidak ada perubahan komposisi Dewan Komisaris sepanjangtahun 2012. Dalam hal penggantian dan pengangkatan anggotaDewan Komisaris, hal tersebut dilakukan dengan memperhatikanrekomendasi dari Komite Nominasi.Pengawasan dan Rekomendasi Dewan KomisarisDalam rangka menjalankan fungsi supervisi, Dewan Komisarismelakukan pengawasan dan memberikan masukan kepadaDireksi secara proaktif. Pengawasan dilakukan secara langsungtermasuk memantau tindak lanjut atas rekomendasi DewanKomisaris kepada Direksi, maupun melalui komite-komite yangdibentuk.Selama tahun 2012, Dewan Komisaris telah melakukanpengawasan dan evaluasi terhadap:− Proses pengelolaan Perseroan oleh Direksi serta rencanakerja dan anggaran tahunan Perseroan serta hasil kinerjaDireksi;− Pelaksanaan seluruh kebijakan strategis Perseroan, termasukmengenai efektivitas penerapan manajemen risiko;− Penerapan serta pengembangan pelaksanaan praktik GCGserta kebijakan-kebijakan yang mendukung pelaksanaanGCG di Perseroan.Dewan Komisaris juga secara aktif memberikan rekomendasikepada Direksi sehubungan dengan kegiatan pengelolaanPerseroan untuk mendukung pertumbuhan berkelanjutan danmeningkatkan kinerja Perseroan, yang yang mencakup faktor-faktor sebagai berikut:1. Pemantauan eksekusi inisiatif-inisiatif strategis Perseroandan kebutuhan mengintegrasikan penerapan manajemenrisiko2. Upaya dan peluang pengembangan usaha dan peningkatankinerja Perseroan dalam meningkatkan nilai bagi seluruhpemangku kepentinganThere were no changes in the composition of the Board ofCommissioners in 2012. In the event of replacement andappointment of members of the Board of Commissioners, thiswill be conducted by taking into account the recommendationsof the Nomination Committee.Supervision and Recommendations of the Boardof CommissionerIn carrying out its supervisory role, the Board of Commissionersproactively supervises and advises the Board of Directors.Supervision is conducted directly, including through monitoringfollow ups of recommendations submitted to the Board ofDirectors, or through the established committees.During the year 2012, the Board of Commissioners has conductedsupervision and evaluation of:− The Company’s management process conducted by theBoard of Directors, as well as the work plan and annualbudget of the Company, and the performance of the Board ofDirectors;− Implementation of the Company’s entire strategic policies,including reviews on the effectiveness of risk management;− Implementation and development of GCG practices andpolicies that support the implementation of GCG in theCompany.The Board of Commissioners is also active in providingrecommendations to the Directors in the course of the Company’smanagement to achieve sustainable growth and improve itsperformance, including the following:1. Monitoring of the execution of strategic initiatives and theneed for an integrated risk management2. Efforts and opportunities to develop business and improvethe Company’s performance to enhance value for allstakeholders.
  • 185. PT Kalbe Farma Tbk. • 2012 Annual Report 1833. Penyempurnaan kebijakan-kebijakan Perseroan dalammendukung penerapan praktik GCG di PerseroanUpaya-upaya perbaikan kinerja tersebut di atas akan dapatdiwujudkan sejalan dengan upaya Kalbe untuk mempertahankandan terus meningkatkan penerapan prinsip-prinsip GCGberdasarkan peraturan yang berlaku.Frekuensi Pertemuan, Tingkat Kehadiran danAgenda Rapat Dewan KomisarisSepanjang tahun 2012, Rapat Dewan Komisaris diselenggarakansebanyak 4 kali. Hal ini sesuai dengan ketentuan Anggaran DasarPerseroan untuk menyelenggarakan sekurang-kurangnya satukali rapat Dewan Komisaris dalam setiap tiga bulan. Rapat DewanKomisaris tersebut dapat berupa Rapat internal Dewan Komisarismaupun Rapat Dewan Komisaris bersama Direksi.Daftar kehadiran Rapat Dewan Komisaris di tahun 2012 dapatdilihat pada tabel berikut:NamaNameRapat Dewan KomisarisBOC MeetingsRapat Dewan Komisaris dan DireksiBOC – BOD MeetingsJumlah RapatNumber of Meetings4 4Dewan KomisarisBoard of CommissionersJohannes Setijono 4 4Santoso Oen 0 0Jozef Darmawan Angkasa 4 4Ferdinand Aryanto 4 4Wahjudi Prakarsa 4 4Farid Anfasa Moeloek 4 4Catatan | Note :Ketidakhadiran dalam rapat terutama disebabkan oleh perjalanan dinas | Absence was mainly due to business tripAdapun hal-hal yang dibahas dalam Rapat Dewan Komisarisdapat terlihat dari daftar agenda Rapat berikut ini:Tanggal RapatMeeting DateAgenda RapatMeeting Agenda22 Februari 2012February 22, 2012Pembahasan kinerja keuangan dan operasional tahun 2011Discussion of 2011 financial and operational performancePembahasan pelaksanaan inisiatif strategis PerseroanProgress report on the implementation of the Company’s strategic initiativesPenyampaian strategi Perseroan untuk tahun 2012Update on the Company’s 2012 strategiesPenyampaian mengenai rencana pengembangan tata kelola perusahaanUpdate on the corporate governance development plan30 Mei 2012May 30, 2012Pembahasan kinerja keuangan dan operasional triwulan 1-2012Discussion of quarter 1- 2012 financial and operational performancePembahasan pelaksanaan inisiatif strategis PerseroanProgress report on the implementation of the Company’s strategic initiativesPembahasan beberapa kendala utama yang dihadapi selama triwulan 1-2012 berikutlangkah perbaikanDiscussion on major issues during quarter 1-2012 along with the corrective actions3. Improvements on the Company’s policies that support theimplementation of GCG practices.These performance improvement efforts will be realized inline with initiatives to maintain and continuously improve theimplementation of GCG principles, based on all applicableregulations.Meeting Frequency, Meeting Attendance andMeeting Agenda of Board of Commissioners’MeetingsIn 2012, meetings of the Board of Commissioners have beenconvened for 4 times. This is pursuant to the Company’s Articlesof Association stipulation that the Board of Commissioners’meetings are to be carried out at least once every three months.Board of Commissioners’ meetings can be held either internallyor with the attendance of the Board of Directors.The Board of Commissioners’s meeting attendance record in2012 is as follows:Issues discussed in the Meetings of the Board of Commissionersare presented in the following Meeting Agenda:
  • 186. Performance HighlightsManagement ReportCompany ProfileManagement Discussion and AnalysisCorporate GovernanceCorporate Social ResponsibilityPT Kalbe Farma Tbk. • Laporan Tahunan 2012184Tanggal RapatMeeting DateAgenda RapatMeeting Agenda29 Agustus 2012August 29, 2012Pembahasan kinerja keuangan dan operasional triwulan 2-2012Discussion of quarter 2- 2012 financial and operational performancePembahasan pelaksanaan inisiatif strategis PerseroanProgress report on the implementation of the Company’s strategic initiativesPembahasan beberapa kendala utama yang dihadapi sampai dengan triwulan 2-2012berikut langkah perbaikanDiscussion on major issues up to quarter 2-2012 along with the corrective actionsPenyampaian perkembangan proses penyusunan Anggaran 2013Update on the preparation of 2013 BudgetPenyampaian perkembangan beberapa tindakan korporasiProgress report on the implementation of several corporate actions5 Desember 2012December 5, 2012Pembahasan kinerja keuangan dan operasional hingga bulan November 2012Discussion of YTD November 2012 financial and operational performancePembahasan pelaksanaan inisiatif strategis PerseroanProgress report on the implementation of the Company’s strategic initiativesPembahasan beberapa kendala utama yang dihadapi sejauh ini berikut langkahperbaikanDiscussion on major issues to date along with the corrective actionsPenyampaian perkembangan pelaksanaan rencana ekspansi jaringan distribusiUpdate on the implementation of the distribution network expansion planPelatihan Dewan KomisarisUntuk meningkatkan kompetensi dan untuk menunjangpelaksanaan tugas Dewan Komisaris, Dewan Komisaris jugasenantiasa mengikuti berbagai seminar dan program pelatihandan pembelajaran untuk menyelaraskan pengetahuan dankompetensi dengan perkembangan industri.TanggalDatePerihalTopicPenyelenggaraInstitutionLokasiLocation21-23 Mei 2012May 21-23, 2012Convention on PharmaceuticalIngredients (CPhI) JapanUBM Asia Tokyo, Japan10-12 Mei 2012May 10-12, 2012Convention on PharmaceuticalIngredients (CPhI) Southeast AsiaUBM Asia Jakarta, Indonesia6 Agustus 2012August 6, 2012Pandangan dan Analisis MakroekonomiIndonesiaOutlook and Analysis of Indonesia’sMacroeconomyAviliani, S.E., M.Si(Economist at the Institute forDevelopment of Economics and Finance)Jakarta, Indonesia1 November 2012November 1, 2012UBS Healthcare Forum UBS Jakarta, Indonesia8 November 2012November 8, 2012Pharmaceutical Sector Meeting EU - Indonesia Business Dialogue (EIBD) Bali, IndonesiaHubungan Keluarga dan Keuangan AnggotaDewan KomisarisBerikut disajikan hubungan keluarga dan keuangan anggota-anggota Dewan Komisaris:Familial and Financial Relationships of Membersof the Board of CommissionersThe following table presents familial and financial relationships ofmembers of the Board of Commissioners:Training of the Board of CommissionersTo develop the Board of Commissioners’ competence andto support the accomplishment of their duties, the Board ofCommissioners continuously participates in seminars and training& education programs, to stay abreast with the latest knowledgeand competence in line with development in the industry.
  • 187. PT Kalbe Farma Tbk. • 2012 Annual Report 185Hubungan Keluarga denganFamilial Relation withHubungan Keuangan denganFinancial Relation withDewan KomisarisBoard ofCommissionersDireksiBoard ofDirectorsPemegangSahamPengendaliControllingShareholdersDewan KomisarisBoard ofCommissionersDireksiBoard ofDirectorsPemegangSahamPengendaliControllingShareholdersNama AnggotaDewan KomisarisName ofMembers of theBoCYaYesTidakNoYaYesTidakNoYaYesTidakNoYaYesTidakNoYaYesTidakNoYaYesTidakNoJohannesSetijono√ √ √ √ √ √Santoso Oen √ √ √ √ √ √Jozef DarmawanAngkasa√ √ √ √ √ √FerdinandAryanto√ √ √ √ √ √Wahjudi Prakarsa √ √ √ √ √ √Farid AnfasaMoeloek√ √ √ √ √ √Tiga orang dari anggota Dewan Komisaris merupakan perwakilankeluarga pendiri Perseroan. Perseroan dimiliki oleh satu kelompokyang terdiri dari enam keluarga, di mana tidak ada satu keluargayang memiliki secara mayoritas.DireksiDireksi adalah organ perusahaan yang bertanggungjawab penuhatas pengurusan Perseroan untuk kepentingan dan tujuanperusahaan sesuai dengan ketentuan anggaran dasar.Dalam menjalankan tanggung jawabnya dalam mengelolaPerusahaan, masing-masing anggota direksi melaksanakantugas dan melakukan pengambilan keputusan sesuai denganpembagian tugas dan wewenang masing-masing. Namundemikian, Direksi bertanggung jawab secara kolektif akankemajuandankelangsunganusahaperusahaandemimenciptakannilai bagi pemegang saham. Presiden Direktur berperan sebagaikoordinator Direksi. Pelaksanaan tugas, wewenang dan hal-hallain yang terkait dengan Direksi harus dilakukan sesuai AnggaranDasar dan peraturan perundang-undangan yang berlaku.Direksi bertanggung jawab kepada RUPS dalam melaksanakantugasnya. Pertanggungjawaban Direksi kepada RUPS merupakanperwujudan akuntabilitas pengelolaan perusahaan dalam rangkapelaksanaan prinsip-prinsip GCG. Kinerja Direksi dievaluasioleh Dewan Komisaris baik secara individual maupun kolektifberdasarkan unsur-unsur penilaian kinerja yang disusun olehKomite Nominasi. Pelaksanaan penilaian dilakukan pada tiapakhir periode tahun buku. Hasil penilaian kinerja Direksi olehDewan Komisaris disampaikan dalam RUPS.ThreemembersoftheBoardofCommissionersarerepresentativesof the Company’s founding family. The Company is owned bya group of six families, where none of them holds a majorityownership.Board of DirectorsThe Board of Directors is the Company’s organ that holds fullresponsibility of corporate management for its interests andobjectives, in accordance with its Articles of Association.In carrying out their responsibility in managing the Company,each member of the Board of Directors perform their duties andmake decision in accordance to the segregation of duties andauthorities. Nonetheless, the Board of Directors are responsiblecollectively for the Company’s sustainable growth to create valuesfor shareholders. The President Director acts as the coordinatorof the Board of Directors. Implementation of roles, authorities andother matters related to the Board of Directors must be conductedin accordance with the Articles of Association and the prevailinglaws and regulations.The Board of Directors is responsible to the GMS in conductingits duties. This responsibility is a manifestation of corporatemanagement accountability for conducting GCG principles. TheBoard of Directors’ individual and collective performances areevaluated by the Board of Commissioners, based on performanceevaluation parementers prepared by the Nomination Committee.The evaluation is conducted at the end of every fiscal year. Resultsfrom the evaluation are conveyed to the GMS.
  • 188. Performance HighlightsManagement ReportCompany ProfileManagement Discussion and AnalysisCorporate GovernanceCorporate Social ResponsibilityPT Kalbe Farma Tbk. • Laporan Tahunan 2012186Tugas dan Wewenang DireksiDalam melaksanakan tugas dan tanggung jawabnya, Direksisenantiasa berpegang dan berpedoman pada Anggaran Dasarmaupun ketentuan internal serta eksternal lainnya.Berdasarkan ketentuan Anggaran Dasar Kalbe, tugas danwewenang Direksi adalah sebagai berikut:- Direksi bertanggung jawab penuh dalam melaksanakantugasnya untuk kepentingan Perseroan dalam mencapaimaksud tujuan Perseroan.- Setiap anggota Direksi wajib mempertanggungjawabkantugasnya sesuai dengan peraturan perundang-undanganyang berlaku dan Anggaran Dasar Perseroan.- Tugas pokok Direksi adalah sebagai berikut:a. Memimpin, mengurus, dan mengendalikan Perseroansesuai dengan tujuan Perseroan;b. Menguasai, memelihara, dan mengurus kekayaanPerseroan;c. Menyusun rencana kerja tahunan yang memuat anggarantahunan Perseroan, dan wajib disampaikan kepadaDewan Komisaris untuk memperoleh persetujuan dariDewan Komisaris, sebelum tahun buku tersebut dimulai.- Direksi berhak mewakili Perseroan di dalam dan diluar Pengadilan tentang segala hal dan kejadian yangmenyangkut Perseroan dengan pihak lain, serta menjalankansegala tindakan yang dibutuhkan sesuai dengan peraturanperundang-undangan yang berlaku di Indonesia.- Segala tindakan Direksi yang menyangkut penggunaan asetserta penerimaan dan pemberian pinjaman dalam jumlahdan jangka waktu yang telah ditetapkan wajib mendapatkanpersetujuan dari 2 anggota Dewan Komisaris, denganmemperhatikan peraturan perundang-undangan yang berlakudi bidang Pasar Modal.- Apabila terjadi benturan kepentingan antara Perseroandengan salah satu anggota Direksi Perseroan, Perseroan akandiwakili oleh anggota Direktur lainnya yang tidak mempunyaibentuan kepentingan. Dalam hal Perseroan mempunyaibenturan kepentingan dengan seluruh anggota Direksi, makaPerseroan akan diwakili oleh Dewan Komisaris. Dalam halPerseroan mempunyai benturan kepentingan dengan seluruhanggota Direksi dan Dewan Komisaris, maka Perseroanakan diwakili oleh pihak lain yang tidak mempunyai benturankepentingan dengan Perseroan yang ditunjuk oleh RUPSdengan memperhatikan peraturan perundang-undanganyang berlaku di Indonesia.- Presiden Direktur berhak dan berwenang bertindak atas namaDireksi serta mewakili Perseroan. Dalam hal Presiden Direkturberhalangan untuk hadir, hal mana tidak perlu dibuktikansebabnya oleh pihak ketiga, maka 2 anggota Direksi lainnyaberhak dan berwenang bertindak untuk dan atas nama Direksidan Perseroan.Duties and Authorities of the Board of DirectorsIn performing its duties and responsibilities, the Board of Directorsalways upholds and are guided by the Articles of Association andother internal and external regulations.Based on Kalbe’s Articles of Association, the duties and authoritiesof the Board of Directors are as follows:- The Board of Directors is fully responsible for conducting itsduties for the interest of the Company in order to achievecorporate objectives.- Every member of the Board of Directors must be accountablefor its duties, and comply with the prevailing regulations andthe Company’s Articles of Association.- The Board of Directors’ main duties are as follows:a. To lead, manage, and control the Company according toits objectives;b. To control, maintain, and manage the Company’s assets;c. To formulate an annual work plan comprising theCompany’s annual budget, and to convey it to the Boardof Commissioners for approval, before the beginning of afiscal year.- The Board of Directors has the rights to represent theCompany intra- and extra-Court regarding matters in relationwith other parties, and performs all actions deemed necessaryin accordance with prevailing regulations in Indonesia.- Any action by the Board of Directors concerning theuse of assets as well as received and granted loans of apredetermined amount and period of time is subject to theapproval of 2 members of the Board, taking into accountexisting regulations applicable in the Capital Market.- In the event of any conflict of interests between the Companyand a member of the Board of Directors, the Company will berepresented by other members of the Board with no conflictof interests. In the event that there is a conflict of interestbetween the Company and all members of the Board ofDirectors, the Company will be represented by the Board ofCommissioners. In the event of a conflict of interest betweenthe Company and all members of the Boards, the Companywill be represented by another party who has no conflict ofinterest with the Company, which is appointed by the GMSwith duly consideration to all laws and regulations applicablein Indonesia.- The President Director is entitled and authorized to act onbehalf of the Board of Directors and to represent the Company.In the event that the President Director is absent, the causeof which is not required to be proven by third parties, 2 othermembers of the Board of Directors are entitled and authorizedto act for and on behalf of the Board of Directors and theCompany.
  • 189. PT Kalbe Farma Tbk. • 2012 Annual Report 187- Tanpa mengurangi tanggung jawabnya, Direksi berhakmengangkat seseorang atau lebih sebagai wakil ataukuasanya dengan memberikan kekuasaan atas tindakantertentu yang diatur di dalam surat kuasa serta sesuai denganAnggaran Dasar Perseroan.Komposisi Keanggotaan DireksiSampai dengan tanggal 31 Desember 2012, susunan DireksiKalbe adalah sebagai berikut:NamaNameJabatanTitleMasa JabatanPeriodBernadette Ruth Irawati Setiady Presiden Direktur | President Director 2011 – 2014Budi Dharma Wreksoatmodjo Direktur | Director 2011 – 2014Herman Widjaja Direktur | Director 2011 – 2014Vidjongtius Direktur (tidak terafiliasi) | Director (unaffiliated) 2011 – 2014Ongkie Tedjasurja Direktur | Director 2011 – 2014Seluruh Anggota Direksi berdomisili di Indonesia.Pada tanggal 23 Mei 2012, RUPS Luar Biasa telah menerimapengunduran diri Bapak Johanes Berchman Apik Ibrahim selakuWakil Presiden Direktur Perseroan, dengan ucapan terima kasihatas jasa-jasanya dan memberikan pembebasan dan pelunasantanggung jawab sepenuhnya (acquit et decharge) atas tindakanpengurusan yang telah dilakukan selama melaksanakanjabatannya, sepanjang tindakan tersebut tercermin dalam buku-buku atau catatan-catatan Perseroan) efektif terhitung sejaktanggal diterimanya pemberitahuan atas perubahan Pasal 11 ayat1 Anggaran Dasar oleh Menteri Hukum dan Hak Asasi Manusia.Pembidangan Tugas DireksiDalam rangka menunjang pelaksanaan tugas secara, telahdilakukan pembagian tugas di antara anggota Direksi. Pembagiantugas didasarkan pada keahlian dan pengalaman masing-masingDireksi dengan tujuan mendukung proses pengambilan keputusansecara tepat dan cepat. Masing-masing Direksi dapat mengambilkeputusan sesuai bidang dan tanggung jawab masing-masing,namun pelaksanaan tugas Direksi merupakan tanggung jawabbersama.- Without reducing its responsibilities, the Board of Directors isentitled to appoint one or more people as its representative(s)and give them power to perform certain actions as stipulatedin the letter of authority and in accordance with the Articles ofAssociation.Composition of the Board of DirectorsAs at December 31, 2012, members of the Board of Directors ofKalbe are as follows:All members of the Board of Directors are domiciled inIndonesia.On May 23, 2012, the Extraordinary GMS has accepted theresignation of Johanes Berchman Apik Ibrahim as the VicePresident Director of the Company, with an expression ofappreciation for his services and granted discharge from hisresponsibilities (acquit et decharge) for the performance ofmanagement actions, as long as the actions were reflected intthe Company’s books and reports, effective from the date whenthe information on the amendment of the provision of Article 11paragraph 1 of the Company’s Article of Association has beenreceived by the Ministry of Law and Human Rights.Division of Duties among the DirectorsIn order to support effective implementation of its duties,segregation of duties has been applied among members of theBoard of Directors. The assignments are based on the expertiseand experience of each member, with the aim of supporting anaccurate and quick decision-making process. Each member ofthe Board of Directors may make decisions according to their fieldand responsibilities, but the conduct of the Board of Director’sduties is a shared responsibility.
  • 190. Performance HighlightsManagement ReportCompany ProfileManagement Discussion and AnalysisCorporate GovernanceCorporate Social ResponsibilityPT Kalbe Farma Tbk. • Laporan Tahunan 2012188NamaNameJabatanTitleBernadette Ruth Irawati SetiadyPresiden Direktur | President DirectorBertanggung jawab untuk mengkoordinasikan seluruh kegiatanoperasional Perseroan dan atas segmen usaha ProdukKesehatanResponsible for coordinating all Company’s operational activitiesand for Consumer Health DivisionBudi Dharma WreksoatmodjoDirektur | DirectorBertanggung jawab untuk segmen usaha Distribusi dan LogistikResponsible for Distribution and Logistics DivisionHerman WidjajaDirektur | DirectorBertanggung jawab untuk segmen usaha Obat ResepResponsible for Prescription Pharmaceuticals DivisionVidjongtiusDirektur (tidak terafiliasi) | Director (unaffiliated)Bertanggung jawab untuk bidang Keuangan dan TeknologiInformasiResponsible for Finance and Information TechnologyOngkie TedjasurjaDirektur | DirectorBertanggung jawab untuk bidang Pemasaran Korporasi, segmenusaha Nutrisi, dan kegiatan Perdagangan InternasionalResponsible for Corporate Marketing, Nutritionals Division, andInternational BusinessFrekuensi Pertemuan, Tingkat Kehadiran, danAgenda Rapat DireksiDireksi melakukan rapat secara berkala, yang merupakanmekanisme untuk melakukan pengambilan keputusan secarakolektif. Rapat internal Direksi dilakukan minimal sebulan sekali.Di samping itu, Direksi juga melakukan rapat gabungan denganDewan Komisaris untuk membahas kinerja Perseroan.Selama tahun 2012 telah diadakan 30 kali rapat internal Direksidan 4 kali rapat gabungan Komisaris-Direksi dengan tingkatkehadiran masing-masing Direksi sebagai berikut:NamaNameRapat DireksiBOD MeetingsRapat Dewan Komisaris dan DireksiBOC – BOD MeetingsJumlah RapatNumber of Meetings30 4DireksiBoard of DirectorsBernadette Ruth Irawati Setiady 26 4Budi Dharma Wreksoatmodjo 24 2Herman Widjaja 21 1Vidjongtius 27 4Ongkie Tedjasurja 22 4Catatan | Note:Ketidakhadiran dalam rapat terutama disebabkan oleh perjalanan dinas | Absence was mainly due to business tripMeeting Frequency, Meeting Attendance andMeeting Agenda of Board of Directors’ MeetingsThe Board of Directors conduct regular meetings, which serve asa mechanism to perform collective decision makings. The Boardof Directors’ internal meetings are conducted at least once amonth.In addition, the Board of Directors also holds joint meetingswith the Board of Commissioners to discuss the Company’sperformance.During 2012, 30 internal meetings of the Board of Directors and4 joint meetings of the Board of Commissioners and the Boardof Directors have been conducted, with the attendance record ofeach member of the Board of Directors as follows:
  • 191. PT Kalbe Farma Tbk. • 2012 Annual Report 189Adapun hal-hal yang dibahas dalam Rapat Direksi selama tahun2012 antara lain adalah:1. Evaluasi kinerja setiap unit bisnis Perseroan secara detail danrutin2. Pembahasan kinerja keuangan bulanan Perseroan secararutin3. Pembahasan laporan keuangan Perseroan Konsolidasi yangtelah diaudit oleh auditor independen untuk tahun buku20124. Pembahasan rencana pelaksanaan RUPS Tahunan dan LuarBiasa tahun 2012 berikut agenda yang akan dibahas5. Pemantauan perkembangan tindakan korporasi akuisisi PTHale International and pembentukan perusahaan patunganPT Kalbe Milko Indonesia6. Penunjukan auditor independen untuk melakukan auditlaporan keuangan konsolidasi Perseroan untuk tahun buku20137. Pembahasan Anggaran 20138. Pembahasan rencana jangka pendek dan jangka panjangpengembangan portofolio bisnis Perseroan baik secaraorganik maupun inorganik serta kebutuhan belanja modal9. Pembahasan atas pelaksanaan rencana ekspansi distribusi10. Memantau perkembangan rencana pelaksanaan Kalbe JuniorScience Fair, Kalbe Junior Scientist Award dan Ristek KalbeScience Awards.Rangkap Jabatan DireksiPosisi dan jabatan anggota Direksi di Perseroan dan anakPerusahaannya dapat dilihat pada tabel berikut:NamaNameJabatan | PositionPresiden KomisarisPresidentCommissionerKomisarisCommissionerPresiden DirekturPresident DirectorDirekturDirectorBernadette Ruth Irawati SetiadyPT Kalbe MorinagaIndonesia*PT Enseval PuteraMegatrading Tbk.*PT Kalbe Farma Tbk.Asiawide KalbePhilippines, Inc.*PT Sanghiang PerkasaBudi Dharma Wreksoatmodjo PT Sanghiang Perkasa* PT Tri Sapta Jaya*PT Enseval PuteraMegatrading Tbk.*PT Kalbe Farma Tbk.PT Enseval MedikaPrima*PT Milenia DharmaInsani*PT Global ChemindoMegatrading*Matters discussed in Board of Directors’ meetings during year2012 were:1. Detailed and routine evaluation of the performance of eachbusiness unit of the Company2. Routine reviews of the Company’s monthly financialperformance3. Discussions of the Consolidated Company’s financialstatements, audited by independent auditors, for the fiscalyear 20124. Discussions of the plan of convening the Annual andExtraordinary GMS 2012 and the agenda to be discussed5. Monitoring the development of corporate actions includingacquisition of PT Hale International and joint venture toestablish PT Kalbe Milko Indonesia6. Appointment of an independent auditor to audit theCompany’s consolidated financial statements for fiscal year20137. Discussions on Budget 20138. Discussions of the short-term and long-term developmentplan of the Company’s business portfolio organically andinorganically, as well as capital expenditure requirements9. Reviews on the implementation of the distribution expansionplan10. Progress monitoring on the preparation of Kalbe JuniorScience Fair, Kalbe Junior Scientist Award and Ristek KalbeScience Awards.Concurrent Positions of The DirectorsConcurrent positions held by members of the Board of Directorsin the Company and its Subsidiaries are presented in the followingtable:
  • 192. Performance HighlightsManagement ReportCompany ProfileManagement Discussion and AnalysisCorporate GovernanceCorporate Social ResponsibilityPT Kalbe Farma Tbk. • Laporan Tahunan 2012190NamaNameJabatan | PositionPresiden KomisarisPresidentCommissionerKomisarisCommissionerPresiden DirekturPresident DirectorDirekturDirectorHerman WidjajaPT Enseval PuteraMegatrading Tbk.*PT Renalmed TiaraUtama*PT Kalbe Farma Tbk.PT Finusolprima FarmaInternational*PT Hexpharm JayaLaboratories*PT Dankos Farma*Vidjongtius PT Bifarma Adiluhung* PT Kalbe Farma Tbk.Ongkie TedjasurjaPT Kalbe MorinagaIndonesia*PT Kalbe Farma Tbk.PT Sanghiang Perkasa*Kalbe Vision Pte. Ltd.** entitas anaksubsidiariesPelatihan DireksiAnggota Direksi secara aktif meningkatkan dan mengembangkankompetensinya untuk menunjang tugas pengelolaan Perseroandengan mengikuti berbagai seminar, workshop, conference dantalk show. Pada tahun 2012, pelatihan yang telah diikuti olehDireksi adalah sebagai berikut:TanggalDatePerihalTopicPenyelenggaraInstitutionLokasiLocation6 Agustus 2012August 6, 2012Pandangan dan AnalisisMakroekonomi IndonesiaOutlook and Analysis of Indonesia’sMacroeconomyAviliani, S.E., M.Si(Economist at the Institute forDevelopment of Economics andFinance)Jakarta6 Agustus 2012August 6, 2012KepemimpinanLeadershipDr. Ir. Handry Satriago, M.M., M.B.A.(President & CEO, GE Indonesia)Jakarta16 Oktober 2012October 16, 2012Peluang Pasar Farmasi di AsiaTenggaraSoutheast Asia Pharma MarketOpportunitiesIMS Health JakartaKebijakan Remunerasi Dewan Komisaris danDireksiPemberian remunerasi Dewan Komisaris dan Direksi mengacukepada keputusan dari Pemegang Saham sebagaimanaditetapkan dalam Rapat U