0
“Ile waży białko,czyli historia pewnej informacji”               Agata Malinowska           GEEK GIRLS CARROTS            ...
Ile waży białko, czylihistoria pewnej informacji         Agata Malinowska  Laboratorium Spektrometrii Mas,              IB...
Spektrometr mas
=    Spektrometr mas
Masa       Spektrometr mas
Punktizoelektryczny                                Funkcja                              biologiczna Tożsamość             ...
Punktizoelektryczny                                Funkcja                              biologiczna Tożsamość             ...
Punktizoelektryczny                                Funkcja                              biologiczna Tożsamość             ...
M              ASpecyficzny              S  enzym       A              Peptide mass              fingerprinting
M              ASpecyficzny              S  enzym       A              Peptide mass              fingerprinting
Specyficzny  enzym              Peptydy składają się                z aminokwasów
K     A       W   A                             K     A       W   ASpecyficzny   Fragmentacja  enzym        w aparacie    ...
K     A       W   A              K   A   W   A                                             K     A       W   ASpecyficzny ...
Identyfikacja!                                              K   A   W   A              M              ASpecyficzny        ...
Punktizoelektryczny                                Funkcja                              biologiczna Tożsamość             ...
MAAVKTLNPKAEVARAQAALAVNISAARGLQDVLRTNLGPKGTMKMLVSGAGDIKLTKDG NVLLHEMQIQHPTASLIAKVATAQDDITGDGTTSNVLIIGELLKQADLYISEGLHPRIIT ...
MAAVKTLNPKAEVARAQAALAVNISAARGLQDVLRTNLGPKGTMKMLVSGAGDIKLTKDG NVLLHEMQIQHPTASLIAKVATAQDDITGDGTTSNVLIIGELLKQADLYISEGLHPRIIT ...
MASA
Punktizoelektryczny                                Funkcja                              biologiczna Tożsamość             ...
EQVKVSK                                        AGLVYEYT                   KAWA               EQVKVSK                      ...
Gen kodujący białkoKAWAEKSPRESSTART AAGGCCTGGGCTGA               Kultura bakteryjna GAAGAGCCCCCGGG           w pożywce z c...
15N          15N           15NKAWAEKSPRESSTART                                                   15N                      ...
Krystalografiarentgenowska     Knock-out                  Badania                 aktywności                 Modelowanie  ...
Dziękuję za uwagę :)
GEEK GIRLS CARROTS   społeczność kobiet kochających nowe technologiewww.geekgirlscarrots.pl           @ggcarrots
Ile waży białko, czyli historia pewnej informacji by Agata Malinowska
Ile waży białko, czyli historia pewnej informacji by Agata Malinowska
Ile waży białko, czyli historia pewnej informacji by Agata Malinowska
Ile waży białko, czyli historia pewnej informacji by Agata Malinowska
Ile waży białko, czyli historia pewnej informacji by Agata Malinowska
Upcoming SlideShare
Loading in...5
×

Ile waży białko, czyli historia pewnej informacji by Agata Malinowska

359

Published on

Prezentacja z 10 spotkania Geek Girls Carrots w Warszawie.

0 Comments
0 Likes
Statistics
Notes
  • Be the first to comment

  • Be the first to like this

No Downloads
Views
Total Views
359
On Slideshare
0
From Embeds
0
Number of Embeds
1
Actions
Shares
0
Downloads
1
Comments
0
Likes
0
Embeds 0
No embeds

No notes for slide

Transcript of "Ile waży białko, czyli historia pewnej informacji by Agata Malinowska"

  1. 1. “Ile waży białko,czyli historia pewnej informacji” Agata Malinowska GEEK GIRLS CARROTS Warszawa, dn. 16 sierpnia 2012 r.
  2. 2. Ile waży białko, czylihistoria pewnej informacji Agata Malinowska Laboratorium Spektrometrii Mas, IBB PAN
  3. 3. Spektrometr mas
  4. 4. = Spektrometr mas
  5. 5. Masa Spektrometr mas
  6. 6. Punktizoelektryczny Funkcja biologiczna Tożsamość Struktura Rozpuszczalność Aktywność Ilość
  7. 7. Punktizoelektryczny Funkcja biologiczna Tożsamość Struktura Rozpuszczalność Aktywność Ilość
  8. 8. Punktizoelektryczny Funkcja biologiczna Tożsamość Struktura Rozpuszczalność Aktywność Ilość
  9. 9. M ASpecyficzny S enzym A Peptide mass fingerprinting
  10. 10. M ASpecyficzny S enzym A Peptide mass fingerprinting
  11. 11. Specyficzny enzym Peptydy składają się z aminokwasów
  12. 12. K A W A K A W ASpecyficzny Fragmentacja enzym w aparacie K A W A Widmo fragmentacyjne
  13. 13. K A W A K A W A K A W ASpecyficzny Fragmentacja enzym w aparacie K A W A Widmo fragmentacyjne
  14. 14. Identyfikacja! K A W A M ASpecyficzny S Fragmentacja enzym A w aparacie Sekwencje Masy peptydów peptydów
  15. 15. Punktizoelektryczny Funkcja biologiczna Tożsamość Struktura Rozpuszczalność Aktywność Ilość
  16. 16. MAAVKTLNPKAEVARAQAALAVNISAARGLQDVLRTNLGPKGTMKMLVSGAGDIKLTKDG NVLLHEMQIQHPTASLIAKVATAQDDITGDGTTSNVLIIGELLKQADLYISEGLHPRIIT EGFEAAKEKALQFLEQVKVSKEMDRETLIDVARTSLRTKVHAELADVLTEAVVDSILAIR KKDEPIDLFMVEIMEMKHKSETDTSLIRGLVLDHGARHPDMKKRVENAYILTCNVSLEYE KTEVNSGFFYKSAEEREKLVKAERKFIEDRVKKIIELKKKVCGDSDKGFVVINQKGIDPF SLDALAKEGIVALRRAKRRNMERLTLACGGIALNSFDDLNPDCLGHAGLVYEYTLGEEKF TFIEKCNNPRSVTLLVKGPNKHTLTQIKDAIRDGLRAVKNAIDDGCVVPGAGAVEVALAE ALIKYKPSVKGRAQLGVQAFADALLIIPKVLAQNSGFDLQETLVKVQAEHSESGQLVGVD LSTGEPMVAAEMGVWDNYCVKKQLLHSCTVIATNILLVDEIMRAGMSSLKG
  17. 17. MAAVKTLNPKAEVARAQAALAVNISAARGLQDVLRTNLGPKGTMKMLVSGAGDIKLTKDG NVLLHEMQIQHPTASLIAKVATAQDDITGDGTTSNVLIIGELLKQADLYISEGLHPRIIT EGFEAAKEKALQFLEQVKVSKEMDRETLIDVARTSLRTKVHAELADVLTEAVVDSILAIR KKDEPIDLFMVEIMEMKHKSETDTSLIRGLVLDHGARHPDMKKRVENAYILTCNVSLEYE KTEVNSGFFYKSAEEREKLVKAERKFIEDRVKKIIELKKKVCGDSDKGFVVINQKGIDPF SLDALAKEGIVALRRAKRRNMERLTLACGGIALNSFDDLNPDCLGHAGLVYEYTLGEEKF TFIEKCNNPRSVTLLVKGPNKHTLTQIKDAIRDGLRAVKNAIDDGCVVPGAGAVEVALAE ALIKYKPSVKGRAQLGVQAFADALLIIPKVLAQNSGFDLQETLVKVQAEHSESGQLVGVD LSTGEPMVAAEMGVWDNYCVKKQLLHSCTVIATNILLVDEIMRAGMSSLKG Wymiana proton-deuter
  18. 18. MASA
  19. 19. Punktizoelektryczny Funkcja biologiczna Tożsamość Struktura Rozpuszczalność Aktywność Ilość
  20. 20. EQVKVSK AGLVYEYT KAWA EQVKVSK KSAEEREKLVAGLVYEYT RSVTLLVKG EKSPRESDMKKRVENA LAKEGIVA KSAEEREKLVSpecyficzny enzym DMKKRVENA START RSVTLLVKG LAKEGIVA
  21. 21. Gen kodujący białkoKAWAEKSPRESSTART AAGGCCTGGGCTGA Kultura bakteryjna GAAGAGCCCCCGGG w pożywce z ciężkim azotem AAAGTAGTACAGCGA GGACT 15N 15N 15N 15N 15N 15N 15N KAWA START 15N 15N 15N 15N KAWAEKSPRESSTART EKSPRES „Ciężkie” wersje „Ciężkie” białko peptydów
  22. 22. 15N 15N 15NKAWAEKSPRESSTART 15N 15N KAWA EQVKVSK START 5 µg 15N AGLVYEYT KAWA EKSPRES EQVKVSK KSAEEREKLVAGLVYEYT RSVTLLVKG EKSPRESDMKKRVENA LAKEGIVA KSAEEREKLV Specyficzny enzym DMKKRVENA START RSVTLLVKG LAKEGIVA 15N 15N 15N 4 µg 10 µg 6 µg
  23. 23. Krystalografiarentgenowska Knock-out Badania aktywności Modelowanie komputerowe Spektrometria mas
  24. 24. Dziękuję za uwagę :)
  25. 25. GEEK GIRLS CARROTS społeczność kobiet kochających nowe technologiewww.geekgirlscarrots.pl @ggcarrots
  1. A particular slide catching your eye?

    Clipping is a handy way to collect important slides you want to go back to later.

×