Епігенетика:імплементація фундаментальних    основ у клінічну практику         Д. О. Микитенко              2012
Зміст• Епігенетика – загальні відомості                загальні відомості• Механізми епігенетики  –М   Метилування ДНК та ...
Сестри Діон (нар 1934)‐ п’ять однояйцевих близнючок            (нар. 1934) п ять однояйцевихГенетично ідентичні           ...
Загальна інформація  • Епігенетика (επί‐над) – розділ медико‐біологічної науки, що вивчає     закономірності змін експресі...
Епігенетичне наслідуванняІмпринтінг – варіант епігенетичної спадковості, при якомуспецифічний характер дференційної активн...
Ефекти епігенетики•   Геномний імпринтінг (та його порушення)•   Дифференцирование клеток•   Трансгенеративні епігенетичні...
Механізми епігенетики•   Метилування ДНК•   Ремоделювання хроматину•   РНК‐опосередковані модифікації•   Пріонізація білкі...
Метилування ДНК           S. M. Tailor. p53 and deregulation of DNA            methylation in cancer. Cellscience Reviews ...
Термін          Дефініційне визначення поняття, характеристикаМетилування Ензиматична модифікація цитозину (С), розташован...
201170‐е годы              2009
Поширення в геноміУ нормальних клітинах метилування зустрічається, в основному, в повторюваних                            ...
Organization of                                        Tissue Specific‐N                          Chromatin in Active and ...
Метилування ДНК у монозиготних               близнюків у різному віціВік близнюків:      3 роки                      р    ...
Втрата метилування ДНК в ембріоні (миша)                      ДНК в ембріоні (миша) призводить до його загибелі на 10 день...
Метилування геному в процесі онтогенезу
Диференційний профіль метилування зрілих статевих клітин
ДНК‐метилтрансферази•    редокс‐чутливі ферменти.      редокс чутливі ферменти•    DNMT1 ‐ підтримувальне метилування in v...
Порушення функції ДНК‐метилтрансфераз1. Порушення балансу‐окисно‐відновних процесів в організмі2. Дефіцит субстрату3. Ефек...
Механізми репресії транскрипції генів•   метилування безпосередньо інгібує зв язок транскрипційних факторів з     метилува...
20
Варіанти ремоделювання гістонів                                  21
Варіанти ремоделювання гістонів                                  22
Чи можуть набуті признаки                 признаки  передаватися нащадкам?   р д          щ д
С‐Т мутації, обумовлені метилуванням                                         25
Динаміка 5 -гідрокси метилцитозину в пронуклеусі зиготи миші©2011 by National Academy of Sciences                         ...
27
28
Метаболізм    29
Історія відкриття                      р     д рГомоцистеїн – сірковмісна амінокислота, що не зустрічаєтьсяв природних біл...
Захвоювання, асоційовані з гіпергомоцистеїнемієюЗахвоювання асоційовані з гіпергомоцистеїнемією• Серцево‐судинні захворюва...
Патофізіологічні ефекти гомоцистеїну         ф             ф         ц      у• П  Порушення біологічних процесів          ...
Зміни метилування гена mdr1 та експресії P‐gp під впливом Метилування mdr1                               гомоцистеїну     ...
Інтенсивність процесів окисної модифікації білків                                                            р ц          ...
Гомоцистеїнування білківГомоцистеїнування білків           35   Пентюк О. О. та ін., 2003
Узагальнена блок‐схема впливу підвищених концентрацій гомоцистеїну на перебіг                              пухлинного проц...
Потенціювання естроген‐індукованого         гормонального раку                                       37 Микитенко Д. О., 2...
Гіпергомоцистеїнемія та вагітність•   Клінічні прояви: ранній початок та/чи важкий перебіг гестозу,    фетоплацентарна    ...
Гомоцистеїн та вагітність  Мета‐аналіз зв’язку між прееклампсією та    MTHFR 677C>T AND 1298A>C POLYMORPHISMS AND     деяк...
Mean (SE) birth weight according to tertile of maternal tHcy                    Murphy, M. M. et al. Clin Chem 2004;50:140...
Stein Emil Vollset et al. 200941
Гіпергомоцистеїнемія та вроджені вади розвитку плоду     р    ц               р д       д р       у    ду• Гомоцистеїн зда...
Причина чи наслідокПричина чи наслідок ???          43
Причини підвищення рівня гомоцистеїну       р        д щ      р         ц      у• Підвищення надходження метіоніну  Підвищ...
Чинники зниження рівня гомоцистеїну      Чинники зниження рівня гомоцистеїну•   Помірні фізичні навантаження    Помірні фі...
Імпринтінг  Материнський та батьківський геноми               та батьківський      функціонально НЕ ідентичні             ...
Функціональне значення імпринтінгу     в пренатальному періоді                         і і
Механізм розпізнавання ділянок            імпринтінгу1. Розпізнання молекулярних маркерів   імпринтінгових ділянок (Neuman...
Молекулярні маркери імпринтінгових ділянокMyotonic Dystrophy    DMPK: Muscle Protein Kinase, chromosome 19                ...
Протизмістовні транскрипти                   ON                                                                           ...
Збалансована регуляція                 Порушення і                 П         імпринтінгу                                  ...
Порушення імпринтінгу• Патологічні стани при порушенні імпринтінгу  – Геномний рівень             р     • хорионепітеліома...
Деякі хвороби імпринтінгуUpd(1)mat        NOEY2Upd(2)mat        ВЗРПUpd(4)mat        Вн.утробная гибель плодаUpd(6)pat    ...
Механізм утворення однобатьківських дисомійН. Kokkonen. Genetic changes of chromosome region 15q11‐q13 in Prader‐Willi and...
Транзиторний діабет новонароджених      Гіперекспресія гену PLAGL1K. Temple. Genomic imprinting. Univ of Southampton, 2009
Епігенетині порушення при ДРТ(с) Tarlatzis B. C. Health of children born after ICSI. 2005
Прионизация белков•   Прионы ‐ особый класс инфекционных агентов, чисто     П             б й       ф    белковых, не соде...
РНК‐опосередковані модифікації                            (RNase III                            endonuclease)             ...
Інактивація Х хромосоми                                    Х‐хромосоми  Ген  XistK. Temple. Genomic imprinting. Univ of So...
Epigenetics: Mediator of Environment, Development,                         and Disease                                    ...
Епігенетика: методи досліджень•Визначення тотального вмісту dmC     •Зворотньо‐фазова ВЕРХ     •ELISA•Чутливий до метилува...
Чутливий до метилування рестрикційний аналіз                                   Погрібний І., 2006                         ...
Специфічна до метилування ПЛРMETHYLATION STATUS OF PROMOTER IN MDR1, MGMT, GSTπAND Upa GENES IN MCF‐7 AND MCF‐7/R CELLS   ...
Schematic outline for analysis of DNA methylation based on oligonucleotide microarray.                          Gitan R S ...
Бісульфітне секвенування               Copyright © 2009 by Cold Spring Harbor Laboratory Press                            ...
High resolution melting for methylation analysis                                                   68
69
Methylated DNA immunoprecipitation (MeDIP)                                         70
71
ALTERATIONS OF HISTONE H3 MODIFICATIOINS IN THE  LIVER OF F344 RATS DURING METHYL DEFICIENCY                              ...
ChIP‐on‐chip               73
Міфотворчість           “…The integration of standard            massage practices and the            knowledge of the bio...
“Our goal is to preserve the past                      using 21st century technology”                               James ...
Эпигенетика - имплементация фундаментальных основ в клиническую практику
Эпигенетика - имплементация фундаментальных основ в клиническую практику
Эпигенетика - имплементация фундаментальных основ в клиническую практику
Upcoming SlideShare
Loading in …5
×

Эпигенетика - имплементация фундаментальных основ в клиническую практику

731 views
613 views

Published on

Эпигенетика - имплементация фундаментальных основ в клиническую практику

Published in: Health & Medicine
1 Comment
0 Likes
Statistics
Notes
  • Be the first to like this

No Downloads
Views
Total views
731
On SlideShare
0
From Embeds
0
Number of Embeds
5
Actions
Shares
0
Downloads
0
Comments
1
Likes
0
Embeds 0
No embeds

No notes for slide

Эпигенетика - имплементация фундаментальных основ в клиническую практику

  1. 1. Епігенетика:імплементація фундаментальних  основ у клінічну практику Д. О. Микитенко 2012
  2. 2. Зміст• Епігенетика – загальні відомості загальні відомості• Механізми епігенетики –М Метилування ДНК та ремоделювання хроматину ДНК • Модифікатори • Гомоцистеїн як універсальний модифікатор ц у р д ф р – Порушення біологічних процесів метилування – Оксидативний стрес – Гомоцистеїнування білків – Потенціювання естроген‐індукованого гормонального раку – Імпринтінг – Пріонізація бі і і і і білків – РНК‐опосередковані модифікації – Інактивація Х‐хромосоми Інактивація Х хромосоми• Методи досліджень 2
  3. 3. Сестри Діон (нар 1934)‐ п’ять однояйцевих близнючок (нар. 1934) п ять однояйцевихГенетично ідентичні Різні психотипи….. Різні хвороби… Різні долі…. Різні долі
  4. 4. Загальна інформація • Епігенетика (επί‐над) – розділ медико‐біологічної науки, що вивчає  закономірності змін експресії генів чи фенотипу клітини, викликаних  механізмами, що не пов’язані зі зміною послідовності ДНК. ,щ д Д • Епігенетика характеризує процес взаємодії організму із  середовищем при формуванні фенотиву • І Історія питання і – 1942 – Конрад Уоддінгтон – термін “Епігенетика” (похідне від “генетика” та “епігенез”)  ‐ концептуальна модель взаємодії  генів зі своїм оточенням при формуванні фенотипу. генів зі своїм оточенням при формуванні фенотипу “…дослідження механізмів тимчасового та просторового контролю  активності генів в процесі  розвитку організмів…”Епігенетичні процеси – норма чи патологія? і і і іЕпігенетика досліджує механізми, за допомогою котрих, на основі генетичної інформації, що міститься в одній клітині (зиготі), за рахунок різної експресії генів в різних типах клітин може відбуватися розвиток багатоклітинного організму, що складається із диференційованих клітин.  і ф ій і 4
  5. 5. Епігенетичне наслідуванняІмпринтінг – варіант епігенетичної спадковості, при якомуспецифічний характер дференційної активності генів фі й ф ій і івизначається статтю організма, від кого вони успадковані. ON OFFІмпринтінгІ і виходить за межі і класичних правилМенделевського наслідування. 5
  6. 6. Ефекти епігенетики• Геномний імпринтінг (та його порушення)• Дифференцирование клеток• Трансгенеративні епігенетичні ефекти Т і і і ф• Мутаційний процес у ц р ц• Новоутворення• Старіння організму і і• Консерватиність генетичної інформації р ф р ц 6
  7. 7. Механізми епігенетики• Метилування ДНК• Ремоделювання хроматину• РНК‐опосередковані модифікації• Пріонізація білків• Інактивація Х‐хромосоми Інактивація Х хромосоми 7
  8. 8. Метилування ДНК S. M. Tailor. p53 and deregulation of DNA  methylation in cancer. Cellscience Reviews 2006  Vol.2 No.3
  9. 9. Термін Дефініційне визначення поняття, характеристикаМетилування Ензиматична модифікація цитозину (С), розташованого у 5’ положенні до гуанозину (G) у CpG-динуклеотиді, ДНК що полягає у приєднанні метильної групи до вуглецю, призводячи до формування 5’-метилцитозину (5-mC) Ступінь Загальна сума метильованих цитозинів чи CpG-динуклеотидів відносно їх загальної чисельності. Визначенняметилування цього показника має певне інформативне значення, але воно недостатнє для встановлення прогностичних та геному діагностичних маркерів та вивчення механізмів пухлинної прогресії, формування ФЛР тощо. Рівень Усередненений показник метилування ДНК за одним конкретним CpG-динуклеотидом в обох ланцюгахметилування геномної ДНК отриманого зразку. Інформація стосовно рівнів метилування окремих CpG-динуклеотидів є вкрай ДНК необхідною для встановлення кількісних відмінностей у метилуванні важливих регуляторних послідовностей. Структура Характеристика статусу метилування певної послідовності CpG-динуклеотидів однієї спіралі ДНК. Наявність (карта) специфічних для окремих захворювань структур метилування ДНК дає можливість використовувати цейметилування показник з діагностичною та прогностичною метою. ДНК Профіль Характеристика всієї геномної ДНК за її множинними сайтами. Може бути визначена у вигляді профілю рівняметилу-вання чи структури метилування. Надає інформацію стосовно множинності сайтів геному, забезпечуючи унікальний ДНК підхід до молекулярної діагностики останнього.Гіпометилува Зниження рівня метилування ДНК у зразку за будь-яким окремим CpG-динуклеотидом чи групою CpG- ння ДНК динулеотидів (чи навіть за всім геномом) у відношенні до контрольного зразку ДНК.ГіперметилуваПідвищення рівня метилування ДНК в зразку за будь-яким окремим CpG-динуклеотидом чи групою CpG- ння ДНК динулеотидів у відношенні до контрольного зразку ДНК. а) метилування геному в цілому; Окремі  б) рівень метилування ДНК;  в) структура метилування ДНК;  ) ру ур у Д ;категоріальні категоріальні г) профіль рівня метилування; поняття д) профіль структури метилування. Микитенко Д. О., 2008 9
  10. 10. 201170‐е годы  2009
  11. 11. Поширення в геноміУ нормальних клітинах метилування зустрічається, в основному, в повторюваних  COMPOSITION OF GENOME CpG DISTRIBUTIONфрагментах ДНК (сателітна ДНК, генетичні  CpG Island/1st Exons Overlap 0.11% Other Ensembl Exons 1 83% 1.83%елементи, такі як LINES, SINES, ендогенні  Ensembl 1st Exons (Non-overlapping) 0.2% DNA Transposons 3.6% CpG Island (Non-overlapping)ретровіруси) та в кодуючій частині генів, за  0.57% LINEвиключенням першого екзону.  LINE 22.9% 22.9% Other Other 38.7% 38.7% LTR LTR 9.3%У геномі ссавців зустрічаються короткі ділянки  SINE 9.3% Low Complexity SINE 10.1%(фрагменти) довжиною 0,5‐4 kB, які збагачені  10.1% Repeats 1.3% Other Repeatsвмістом CG‐динуклеотидів і розміщені, в  Simple Repeats 0.15% Alpha Satellite Rollins et al., 1.7% Classical Satellite 2.07%основному, в проксимальній частині  Genome Res., 2006 2.1%регуляторної ділянки генів, відомі як CpG‐острівці. Їх метилування призводить до  і і Їрепресії промотору, а отже, й інактивації функції всього гена.  11
  12. 12. Organization of  Tissue Specific‐N Chromatin in Active and  MethylationO Inactive States Inactive StatesRMA X‐Chromosomes  Inactivation  Genomic  G iL        ImprintingCE DNA Silencing of Foreign  Sil i fF i MethylationL DNA SequencesLC Hypermethylation of A Gene‐specific  CpG Islands of Tumor  CpG Islands of Tumor hypomethylation h th l tiN Suppressor Genes Global Genomic C HypomethylationER        C Disruption of the p16INK4a/Rb,  Activation of E p53/p14ARF and APC/ß‐catenin oncogenes, loss of L Pathways, Defects in Mutation Repair  Pathways Defects in Mutation Repair Chromosomal  Chromosomal imprinting Networks (hMLH1,BRCA1, MGMT)  Instability, Aneuploidy L and Generation of Mutations, Loss of  Activation of  Adapted from J Pathol (2002) 196: 1-7 Apoptosis and Adherence  Transposons, Gene Up‐ Mechanisms Regulation 
  13. 13. Метилування ДНК у монозиготних близнюків у різному віціВік близнюків: 3 роки р 50 років р Fraga et al, PNAS, 2005
  14. 14. Втрата метилування ДНК в ембріоні (миша) ДНК в ембріоні (миша) призводить до його загибелі на 10 день розвитку Li et al, 1992, Cell Метилування ДНК є необхідним інструментом Регуляції геному для нормального розвитку організму Значення диференційного метилування окремх сайтів ДНК?
  15. 15. Метилування геному в процесі онтогенезу
  16. 16. Диференційний профіль метилування зрілих статевих клітин
  17. 17. ДНК‐метилтрансферази• редокс‐чутливі ферменти.  редокс чутливі ферменти• DNMT1 ‐ підтримувальне метилування in vivo, відповідає за  правильний розвиток ембріону, імпринтінг, інактивацію Х‐хромосоми та відновлення структури метилування ДНК після її реплікації. Вона в  та відновлення структури метилування ДНК після її реплікації. Вона в найбільшій кількості присутня в соматичних клітинах і локалізується у  фокусах реплікації ДНК, взаємодіє з ядерним антигеном  проліферуючих клітин (PCNA). • DNMT3а та DNMT3b  ‐ метилування de novo. Експресуюються в  ембріональних клітинах і на низькому рівні в соматичних клітинах  дорослої особини. • DNMT 3L наявна в статевих клітинах і взаємодіє з DNMT3a та DNMT3b  DNMT 3L і і і DNMT3 DNMT3b за їх спільної участі в імпринтінгу батьківських генів. • DNMT2 виявляється в усіх типах клітин, але не проявляє  ферментативної активності, тому її функція ще має бути встановлена.  ферментативної активності тому її функція ще має бути встановлена Взаємовідношення між різними  видами метилтрансфераз (de novo та  підтримувальними) й процесами  демдля встановлення порушень  шляхів епігенетичного  регулюванняетилування є важливим.  17
  18. 18. Порушення функції ДНК‐метилтрансфераз1. Порушення балансу‐окисно‐відновних процесів в організмі2. Дефіцит субстрату3. Ефект дози гену (анеуплоідії, незбалансовані геномні3 Ефект дози гену (анеуплоідії незбалансовані геномні перебудови в локусах, де картовані одноіменні кодуючі гени)4. Мутації генів Мутації генівмутація гена DNMT3B викликає розвиток синдрому ICF (Immunodeficiency–centromeric instability–facial anomalies) : y )•нестабільность центромерних ділянок хромосом, •Імунодефіцит•аномалії обличчя. Синтез мутованого ферменту сприяє порушенням метилування de novo і в результатівикликає гіпометилування юкстаце‐нтромерного гетерохроматину, в першу чергу, 1‐ої, 16‐ої та Х‐хромосоми, спричиняючи чисельні хромосомні порушення, наприклад, аномальну деконденсацію хроматину, спарювання, розділення та розпадперицентромерних ділянок хромосом. 18
  19. 19. Механізми репресії транскрипції генів• метилування безпосередньо інгібує зв язок транскрипційних факторів з  метилування безпосередньо інгібує зв’язок транскрипційних факторів з їхніми сайтами впізнання, що містять CpG‐острівці, які  найчастіше  знаходяться в районах промоторів генів, поширюючись на перший  екзон гена;• залучення метил‐зв’язуючих білків чи білкових комплексів, відповідно  MeCP2 та MeCP1, які, специфічно зв’язуючись з метильованими CpG‐ ділянками, можуть непрямим шляхом інгібувати зв’язування  транскрипційних факторів, обмежуючи їх доступ до регуляторних  елементів. 19
  20. 20. 20
  21. 21. Варіанти ремоделювання гістонів 21
  22. 22. Варіанти ремоделювання гістонів 22
  23. 23. Чи можуть набуті признаки признаки  передаватися нащадкам? р д щ д
  24. 24. С‐Т мутації, обумовлені метилуванням  25
  25. 25. Динаміка 5 -гідрокси метилцитозину в пронуклеусі зиготи миші©2011 by National Academy of Sciences Iqbal K et al. PNAS 2011;108:3642-3647
  26. 26. 27
  27. 27. 28
  28. 28. Метаболізм 29
  29. 29. Історія відкриття р д рГомоцистеїн – сірковмісна амінокислота, що не зустрічаєтьсяв природних білках, які вживаються з їжею, а є проміжнимпродуктом обміну амінокислот метіоніну та цистеїну.Вперше отримана: L. Butz та V. du Vigneaue у 1932 р.Референтні значення (WHO):Нормальний рівень: < 10 мкМ/лСубнормальний рівень: 10‐15 мкМ/лГіпергомоцистеїнемія: легка: 15‐25 мкМ/л помірна: 25 30 мкМ/л 25‐30 важка: > 30 мкМ/л 30 Rasmussen K. 2000, Пентюк О. О. 2003
  30. 30. Захвоювання, асоційовані з гіпергомоцистеїнемієюЗахвоювання асоційовані з гіпергомоцистеїнемією• Серцево‐судинні захворювання – АТ ІХС І М атеросклероз атеротромбоз інсульти АТ, ІХС, І.М., атеросклероз, атеротромбоз, інсульти• Захворювання системи крові• Неврологічні захворювання – Хвороба Альцгеймера• Захворювання нирок• Захворювання щитоподібної залози Захворювання щитоподібної залози• Онкологічні захворювання – Рак простати, легень, РМЗ, яєчників• Патологія вагітності• Вроджені аномалії – Дефекти нервової трубки вовча паща (Cleft Palate) Дефекти нервової трубки, вовча паща (Cleft Palate),  с‐м Дауна* (???) *) D.S.Rosenblatt. Am J Clin Nutr, 1995 James et al.Am J Clin Nutr 1999;70:429‐30 A. Chango et al. British J of Nutr, 2005 Kenneth F. Trofatter , Pregnancy and Childbirth, 2007 31
  31. 31. Патофізіологічні ефекти гомоцистеїну ф ф ц у• П Порушення біологічних процесів  бі і і метилування• Оксидативний стрес• Гомоцистеїнування білків• Потенціювання естроген‐індукованого  гормонального раку 32
  32. 32. Зміни метилування гена mdr1 та експресії P‐gp під впливом Метилування mdr1 гомоцистеїну ї Експресія P‐gp Статус метилування промотору гена Ген Г MCF-7 MCF-7/Hom mdr1 гіперметильований. гіпометильований . GSTp гіперметильований. гіпометильований . tp53 гіпометильований гіперметильований. tp73 гіпометильований гіперметильований. bcl-2 гіпометильований гіперметильований. CDH1 гіпометильований гіперметильований. 3,5 Цисплатин Доксорубіцин 3,0 5,00 5,00 Середнє значення 5,00 ±SD DNMT1 / β-Actin ті 4,50 4 50 Рівень резистентност 2,5 25 4,00 3,00 3,50 2,50 2,0 2,50 2,50 3,00 2,50 1,70 2,00 1,50 1,5 1,50 1,00 1,0 0,50 0,00 1,00 , 3,00 , 5,00 , 10,00 , 0,5 Введення гомоцистеїну 0,0 Mcf-7 Mcf-7 Hom Експресія DNMT1 33 Микитенко Д. О., 2006 ‐ 2008
  33. 33. Інтенсивність процесів окисної модифікації білків р ц д ф ц 3,6 F = 69,96, p = 0,00007Рівень карбонільни груп; С , mM 6кл 3,4 M/10 3,2 , Середнє значення ±SE 3,0 ±SD 2,8 их 2,6 26 2,4 2,2 2,0 20 ь 1,8 1,6 MCF-7 S MCF-7 Hom2 MCF-7 Hom5 Рівень карбонільних груп в мМ на 1 млн клітин при довжині хвилі 370 нм, + SD Клітинна лінія P 2 пасажи з вихідні 5 пасажів з HOM HOM F(2,6) = 69,96; MCF-7 2,93+0,04 1,78+0,03 3,11 + 0,26 P < 0,001 34 Микитенко Д. О., 2008
  34. 34. Гомоцистеїнування білківГомоцистеїнування білків 35 Пентюк О. О. та ін., 2003
  35. 35. Узагальнена блок‐схема впливу підвищених концентрацій гомоцистеїну на перебіг  пухлинного процесу 36 Микитенко Д. О., 2008
  36. 36. Потенціювання естроген‐індукованого  гормонального раку 37 Микитенко Д. О., 2008
  37. 37. Гіпергомоцистеїнемія та вагітність• Клінічні прояви: ранній початок та/чи важкий перебіг гестозу, фетоплацентарна недостатність, відшарування плаценти (OR=3.0), внутрішньоутробна затримка розвитку або загибель плоду (Vollset S.E. et al., 2009). )• Гіпергомоцистеїнемія може призводити до: – а) порушення та активації ендотеліальних клітин мікротромбози (Ellison et al., 2004); – б) посилення агрегації тромбоцитів порушення процесів імплантації, плацентації та фетоплацентарного кровообігу (OR=5,0; M.d.R.Rodríguez‐ Guillén et al., 2009). На пізніх термінах вагітності спостерігають: – а) виникнення генералізованої мікроангіопатії пізній гестоз (OR від 2.0 до 20.9) з розвитком важких станів (Vollset et al., 2009); – б) розвитку хронічної внутрішньоутробної гіпоксії плоду; – в) народження дітей із низькою вагою та зниженим функціональним ) р д д фу ц резервом усіх життєзабезпечуючих систем (Murphy et al., 2004).• Гіпергомоцистеїнемія може супроводжуватися розвитком вторинних аутоімунних реакцій (антифосфоліпідний синдром???) 38
  38. 38. Гомоцистеїн та вагітність Мета‐аналіз зв’язку між прееклампсією та  MTHFR 677C>T AND 1298A>C POLYMORPHISMS AND  деякими метаболічними порушеннями RISK OF SPONTANEOUS ABORTIONS María del Rosario Rodríguez‐Guillén et  al., 2009 L. Wilkins‐Haug, 2003Dose‐response relationbetween log plasma totalhomocysteine (tHcy) andthe risk of placentalabruption, preeclampsia in p g pregnancies<37 wk gestation, andneural tube defects 39 Stein Emil Vollset et al. 2009
  39. 39. Mean (SE) birth weight according to tertile of maternal tHcy Murphy, M. M. et al. Clin Chem 2004;50:1406‐1412 40Copyright ©2004 American Association for Clinical Chemistry
  40. 40. Stein Emil Vollset et al. 200941
  41. 41. Гіпергомоцистеїнемія та вроджені вади розвитку плоду р ц р д д р у ду• Гомоцистеїн здатний вільно проникати крізь плаценту та ц д р р ц у може спричиняти прямий тератогенний і фетотоксичний вплив (Микитенко Д. О., 2008). – виникнення дефектів нервової трубки, зокрема, аненцефалії та спинномозкової кили (Nathalie M.J. et al., 2001) – розщеплення губи й/або піднебіння – у важких випадках: помутніння та підвивих кришталика ока (Njälsson R. et al., 2007); олігофренія різного ступеню.• Порушення нормальної сегрегації хромосом в процесі мейозу та підвищення ризику народження дитини з трисомією 21 в 2,6 рази (K.Trofatter , 2007) 42
  42. 42. Причина чи наслідокПричина чи наслідок ??? 43
  43. 43. Причини підвищення рівня гомоцистеїну р д щ р ц у• Підвищення надходження метіоніну Підвищення надходження метіоніну• Недостатність вітамінів (Фолієвої кислоти, Віт.гр.В)• Шкідливі звички (паління, кава, спиртні напої) Шкідливі звички (паління, кава, спиртні напої)• Фармакологічні препарати (метотрексат, протисудомні препарати, оксид азоту, метформін, Н2‐антагоністи, еуфілін)• Інтеркурентні захворювання (псоріаз, ниркова недостатність,  цукровий діабет, лейкоз, гіпотиреоз,захворювання ШКТ, що супроводжуються порушенням всмоктування вітамінів (синдром мальабсорбції) • Поліморфізм гена MTHFR (С677Т, А1298С), MTRR, MTR Поліморфізм гена MTHFR (С677Т, А1298С), MTRR, MTR• Віковий фактор 44
  44. 44. Чинники зниження рівня гомоцистеїну Чинники зниження рівня гомоцистеїну• Помірні фізичні навантаження Помірні фізичні навантаження• Алькоголь у малих дозах• Вітаміни (ф.к., В , В , В Вітаміни (ф.к., В1, В6, В12)• Вагітність Лікування гіпергомоцистеїнемії Лікування гіпергомоцистеїнемії• Дієта (обмежуються ікра, соя, тверді сири, бринза, м’ясо,  птиця, яйця, риба, горіхи, насіння, бобові, крупи) ц , ц ,р , р , , , ру )• Вітаміни групи В (включно із фолієвою кислотою)• Антиагрегантна терапія• Симптоматична терапія 45
  45. 45. Імпринтінг Материнський та батьківський геноми та батьківський функціонально НЕ ідентичні =Материнский аллель Отцовский аллель Материнский аллельОтцовский аллель
  46. 46. Функціональне значення імпринтінгу в пренатальному періоді і і
  47. 47. Механізм розпізнавання ділянок імпринтінгу1. Розпізнання молекулярних маркерів імпринтінгових ділянок (Neuman B. et al. Characteristics of  р д imprinted genes/Nat Genet. 1995. vol. 9)2. Функціонування протизмістовних транскриптів (Wutz A. et al. Imprinted expression of the Igf2r gene …/ Nature. – 1997. Vol. 386, N. 6652)
  48. 48. Молекулярні маркери імпринтінгових ділянокMyotonic Dystrophy DMPK: Muscle Protein Kinase, chromosome 19 [CTG CTG CTG CTG CTG CTG] Normal: 5-27 repeats Affected individuals: 50-1000+ bp DMPK DMAHD DMWD Pizzuti A. et al. The myotonic dystrophy gene. Arch. Neurol. 50: 1173‐9, 1993.
  49. 49. Протизмістовні транскрипти ON OFF IGF2 H19Insulin‐like growth factor receptor 2 non‐coding RNA OFF ON IGF2 H19 Wutz A. et al. Imprinted expression of the Igf2r  gene …/ Nature. – 1997. Vol. 386, N. 6652 Grewal and Jia Nature Reviews Genetics 8, 35–46 (January  2007) | doi:10.1038/nrg2008
  50. 50. Збалансована регуляція Порушення і П імпринтінгу іK. Temple. Genomic imprinting. Univ of Southampton, 2009
  51. 51. Порушення імпринтінгу• Патологічні стани при порушенні імпринтінгу – Геномний рівень р • хорионепітеліома – Хромосомний рівень • Встановлено: 7, 10, 11, 14, 15 • Припускається: 1 2 5 6 16 19 20 22 Припускається: 1, 2, 5, 6, 16, 19, 20, 22 – Генний рівень
  52. 52. Деякі хвороби імпринтінгуUpd(1)mat NOEY2Upd(2)mat ВЗРПUpd(4)mat Вн.утробная гибель плодаUpd(6)pat Диабет новорожденныхUpd(7)mat Синдром Сильвера-РасселаUpd(7)pat/mat Муковисцидоз, лицевые дизморфииUpd(11)pat Синдром Беквита-Видемана Беквита ВидеманаUpd(14)mat Преждевременное половое созревание, Вн.утробная гибель плода дUpd(14)pat КарликовостьUpd(15)mat Синдром Прадера-ВиллиUpd(15)pat Синдром АнгельманаUpd(15)pat/mat Значимых отклонений в развитии плода не опеределяетсяUpd(16)mat ВЗРПUpd(20)mat ВЗРПUpd(21)mat Вн.утробная гибель плода ICF-синдром Синдром Р С Ретта Болезни тринуклеотидных повторов
  53. 53. Механізм утворення однобатьківських дисомійН. Kokkonen. Genetic changes of chromosome region 15q11‐q13 in Prader‐Willi and Angelman syndromes in Finland. Acta Universitatis Ouluensis. Medica, 2003
  54. 54. Транзиторний діабет новонароджених Гіперекспресія гену PLAGL1K. Temple. Genomic imprinting. Univ of Southampton, 2009
  55. 55. Епігенетині порушення при ДРТ(с) Tarlatzis B. C. Health of children born after ICSI. 2005
  56. 56. Прионизация белков• Прионы ‐ особый класс инфекционных агентов, чисто  П б й ф белковых, не содержащих нуклеиновых кислот,  вызывающих тяжёлые заболевания центральной  нервной системы у человека и ряда высших животных  (т. н. «медленные инфекции»).• Прионный белок, обладающий аномальной  трёхмерной структурой, способен прямо  трёхмерной структурой способен прямо катализировать структурное превращение  гомологичного ему нормального клеточного белка в  себе подобный (прионный), присоединяясь к белку‐ мишени и изменяя его конформацию. мишени и изменяя его конформацию Прионы — единственные инфекционные агенты, размножение которых происходит  без участия нуклеиновых кислот. Прионы отличаются составом аминокислот характерных для данного вида отличаются составом аминокислот, характерных для данного вида,  определяемых видовым геном прионового белка, а также так называемыми  посттрансляционными модификациями или степенью гликозилирования базовой  белковой цепочки. белковой цепочки 58
  57. 57. РНК‐опосередковані модифікації (RNase III endonuclease) : DGCR8 Unwind Drosha (RNase III endonuclease)7MGpppGAAAAA Imperfect Perfect Complementarity Complementarity 5’ 3’ UTR ORF UTR AAAAA 7MGpppG 7MG G AAAAA Pol II Target 7MGpppG OR F mRNA mRNA cleavage TRANSLATIONAL REPRESSION
  58. 58. Інактивація Х хромосоми Х‐хромосоми Ген  XistK. Temple. Genomic imprinting. Univ of Southampton, 20092007 Nature Publishing Group, Ng, K., et al., Xist and the order of silencing, EMBO reports 8, 34–39.
  59. 59. Epigenetics: Mediator of Environment, Development, and Disease Estrogen E t Herbicides H bi idNutrition Vitamins Drugs Disruptors Pesticides Epigenetics Reproductive Pathology Cardiovascular Disorders Disorders Growth Neurological Disorders Disorders Pediatric Lupus Disorders Cancer Imprinting Disorders (с) Mellissa Mann, Susceptibility of Genomic Imprinting to ART, 2009
  60. 60. Епігенетика: методи досліджень•Визначення тотального вмісту dmC •Зворотньо‐фазова ВЕРХ •ELISA•Чутливий до метилування рестрикційний аналіз•Бісульфітне секвенування•Специфічна до метилування ПЛР (MSP) С фі ПЛР (MSP)•COBRA (комбінований бісульфіт‐рестрикційний аналіз)• ms‐SNUPE (Methylation‐sensitive single‐nucleotide primer extension)•Імунопреципітація ДНК (MeDIP та MeDIP seq) ДНК (MeDIP та MeDIP‐seq)•Імунопреципітація хроматину 63
  61. 61. Чутливий до метилування рестрикційний аналіз Погрібний І., 2006 64
  62. 62. Специфічна до метилування ПЛРMETHYLATION STATUS OF PROMOTER IN MDR1, MGMT, GSTπAND Upa GENES IN MCF‐7 AND MCF‐7/R CELLS MDR1 exon 1 exon 2 MGMT CpG sites MCF ‐ 7 MCF – 7/R / m u m u m u m u m u m u m u Msp I/Hpa II sites 200 I II 100 PCR primers PCR primers 121 bp 206 bp GSTπ I MCF – 7/R MCF – 7 200 100 300 200 100 Upa II 200 100 300 200 100 Погрібний І., 2006
  63. 63. Schematic outline for analysis of DNA methylation based on oligonucleotide microarray. Gitan R S et al. Genome Res. 2002;12:158-164Cold Spring Harbor Laboratory Press
  64. 64. Бісульфітне секвенування Copyright © 2009 by Cold Spring Harbor Laboratory Press 67
  65. 65. High resolution melting for methylation analysis 68
  66. 66. 69
  67. 67. Methylated DNA immunoprecipitation (MeDIP) 70
  68. 68. 71
  69. 69. ALTERATIONS OF HISTONE H3 MODIFICATIOINS IN THE LIVER OF F344 RATS DURING METHYL DEFICIENCY 150 ol * Relative level of modification, % from controControl 9 weeks 18 weeks36 weeks Tumor 140 130 * * * H3K9me3 120 110 H3K9me2 100 Control 90 9 weeks H3K9me1 80 * * 18 weeks 70 H3K9ac 60 36 weeks 50 * * * Tumor f H3S10ph 40 * 30 H3 20 10 0 H3K9me3 H3K9ac H3S10ph M M M P M A P P A MA A MM P MN-ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKP-…-C 2 4 9 10 11 14 17 18 23 26 27 28 36 Interplay between H3K9me3, H3K9Ac, and H3S10ph i. Pogribny, 2007
  70. 70. ChIP‐on‐chip 73
  71. 71. Міфотворчість “…The integration of standard  massage practices and the  knowledge of the biology of  adversity will change our minds,  our physiology, our epigenetics— and hence our massage practice.” March 2012
  72. 72. “Our goal is to preserve the past  using 21st century technology” James Dewey Watson Дякую за увагу (044) 592 21 78E‐MAIL: d.mykytenko@genetics.kiev.uaE MAIL d k k @ i ki Клініка репродуктивної медицини «НАДІЯ» www.ivf.com.ua 75

×