A técnica da Eletroforese para a  análise de DNA e proteínas     Prof. Dr. Francisco Prosdocimi
Histórico•   1952, Markham and Smith     –   Ao estudarem hidrólise de RNA percebem que         moléculas de diferentes es...
Eletroforese•   Movimento de partículas dispersas    num fluído sob influência de um    campo elétrico uniforme•   DNA, ca...
Eletroforese, etapas1.Preparação do gel2.Aplicação das amostras3.Eletroforese4.Coloração5. Análise dos resultados
Preparação do gel   Horizontal X Vertical   Agarose X Poliacrilamida
Aplicação das amostrasDefinição do mapa dasamostras por canaleta
Corrida do gel• Aplicação do campo elétrico• Fonte elétrica gera fluxo de  íons através da solução  tampão• Terminais posi...
Coloração das moléculas• Brometo de etídio  – Agente intercalante do DNA     • Cancerígeno!  – Composto fluorescente à luz...
Eletroforese em campo pulsado                        Grandes                        fragmentos                        de DNA
PCRa reação em cadeia da polimerase    Prof. Dr. Francisco Prosdocimi         http://dotsub.com/view/538a719f-927b-4192-8e...
Reação em cadeia
Amplificação do DNA
Síntese de DNA in vitro• Polimerase Chain Reaction   – Reação em cadeia da Polimerase• Amplificação in vitro de  moléculas...
Etapas da PCR• Ciclos da PCR    – Separação das fitas → 96°C    – Anelamento dos primers → 60°C    – Síntese do DNA → 37°C...
História da PCR•   Químico, 1966     –   Doutor em bioquímica, 1972     –   2 anos de pós-doutorado numa industria farmacê...
PCRSistema de reação:        DNA molde (100 ng)        Iniciadores (5 µM)        dNTPs        Tampão com MgCL2        Taq ...
Filmes como técnica didática• http://learn.genetics.utah.edu/content/labs/pcr/• http://www.maxanim.com/genetics/PCR/PCR.ht...
Interlúdio explicativoProf. Dr. Francisco Prosdocimi
Bioquímica + Biomol •    Enzimas são proteínas,      portanto: 1.   São formadas por sequências de      aminoácidos 2.   D...
>gi|188497753|ref|NM_000188.2| Homo sapiens hexokinase 1 (HK1), nucleargene encoding mitochondrial protein, transcript var...
Sequenciamento de proteínas•   Degradação de Edman     – Quebra-se o aminoácido N-terminal     – Identifica-se o aminoácid...
O Sequenciamento                            de moléculas de DNA                            Prof. Dr. Francisco Prosdocimi>...
Frederick Sanger• Único vivo dentre os 4 indivíduos que já  venceram dois prêmios Nobel• ~1955: publicou a primeira sequên...
O método de Sanger, 1975   Polimerização do DNA a ser sequenciado (molde)   na presença de:          DNA polimerase       ...
Amplificação interrompida              com didesoxinucleotídeosDesoxinucleotídeos       dNTP                              ...
G                          C             T       T        T   A         C       C       T          G                   C A...
C             T    T           T T                      C              G           C                 A                    ...
T C       T         C       C         T       G             T   C A    A G T T                              A             ...
C         AT G C         TA       T    T         A T TT          C            T G     C                        G    C   CA...
A                      T GAA               G      A                      G     T    T T T              GA G C     T       ...
CC          A                 T    T T  T            T GAA                                G       A                       ...
A                    T                              T GA CC                                 A                  G          ...
5’                                          3’ ATGCTTCTGGCAGATCTGAACAGTGTTACTGAT ATGCTTCTGGCAGATCTGAACAGTGT ATGCTTCTGGCAGA...
ATGCTTCTATGCTTCTGGCAGATATGCTTCTGGCAGATCTATGCTTCTGGCAGATCTGAACAGTATGCTTCTGGCAGATCTGAACAGTGTATGCTTCTGGCAGATCTGAACAGTGTTATGCT...
• molde             • polimerase             • dN TPs•ddG TPs   •ddA TPs   •ddT TPs   •ddC TPs    G         A          T  ...
ATGCTTCTATGCTTCTGATGCTTCTGGATGCTTCTGGCATGCTTCTGGCAATGCTTCTGGCAGATGCTTCTGGCAGAATGCTTCTGGCAGATATGCTTCTGGCAGATCATGCTTCTGGCAGA...
ATGCTTCTATGCTTCTGATGCTTCTGGATGCTTCTGGCATGCTTCTGGCAATGCTTCTGGCAGATGCTTCTGGCAGAATGCTTCTGGCAGATATGCTTCTGGCAGATCATGCTTCTGGCAGA...
Modelo originalEtapa 1                     Marcação do primerAmplificaçãoTipo-PCr                            4 reações nec...
Sanger e o fago Phi 174                    De fato, esse tipo de                    sequenciamento                    manu...
Modelo moderno       Applied Byosystems, 1986       Marcação fluorescente do ddNTP                                        ...
Cromatograma
As máquinas necessárias              para o sequenciamento• Primeira etapa: junta-se os  reagentes em poços de  placas e c...
O que faz um sequenciador de                DNA?•    Segunda etapa: realiza a eletroforese capilar      – O sequenciador e...
ExercícioDê a sequência de DNA da canaleta apontadaazul = Guaninaamarelo = Timinavermelha = Adeninaverde = Citosinahttp://...
Aula 9 eletroforese_pcr_sequenciamento
Aula 9 eletroforese_pcr_sequenciamento
Aula 9 eletroforese_pcr_sequenciamento
Aula 9 eletroforese_pcr_sequenciamento
Aula 9 eletroforese_pcr_sequenciamento
Upcoming SlideShare
Loading in …5
×

Aula 9 eletroforese_pcr_sequenciamento

2,617 views
2,413 views

Published on

Published in: Education
0 Comments
2 Likes
Statistics
Notes
  • Be the first to comment

No Downloads
Views
Total views
2,617
On SlideShare
0
From Embeds
0
Number of Embeds
1
Actions
Shares
0
Downloads
175
Comments
0
Likes
2
Embeds 0
No embeds

No notes for slide

Aula 9 eletroforese_pcr_sequenciamento

  1. 1. A técnica da Eletroforese para a análise de DNA e proteínas Prof. Dr. Francisco Prosdocimi
  2. 2. Histórico• 1952, Markham and Smith – Ao estudarem hidrólise de RNA percebem que moléculas de diferentes estruturas têm sua mobilidade diferenciada quando aplicadas num papel e submetidas a um campo elétrico Vou ali correr• 1955, Smithies um gelzinho e – Géis de amido funcionam bem para separar proteínas do soro humano já volto• 1967, Loening Tenho que ir senão – Géis de acrilamida com maior resolução e vou perder meu gel permitem separar ainda moléculas grandes de DNA• 1980, Schwartz and Cantor – Eletroforese em campo pulsado separa fragmentos enormes• É hoje impossível imaginar um laboratório de biomol sem eletroforese acontecendo a todo instante...
  3. 3. Eletroforese• Movimento de partículas dispersas num fluído sob influência de um campo elétrico uniforme• DNA, carga negativa – Tem tendência a se dirigir ao polo positivo quando sujeito a um campo elétrico• Serve para separar moléculas por tamanho/carga elétrica – Proteína deve ser desnaturada com detergente (SDS)• Técnica utilizada à exaustão em trabalhos de biologia molecular
  4. 4. Eletroforese, etapas1.Preparação do gel2.Aplicação das amostras3.Eletroforese4.Coloração5. Análise dos resultados
  5. 5. Preparação do gel Horizontal X Vertical Agarose X Poliacrilamida
  6. 6. Aplicação das amostrasDefinição do mapa dasamostras por canaleta
  7. 7. Corrida do gel• Aplicação do campo elétrico• Fonte elétrica gera fluxo de íons através da solução tampão• Terminais positivo e negativo• Tempo adequado, senão o DNA sai do gel
  8. 8. Coloração das moléculas• Brometo de etídio – Agente intercalante do DNA • Cancerígeno! – Composto fluorescente à luz UV – Gel de agarose• Prata – Gel SDS-PAGE • PoliAcrilamide Gel Electrophoresis – Melhor resolução• Coomassie blue, etc
  9. 9. Eletroforese em campo pulsado Grandes fragmentos de DNA
  10. 10. PCRa reação em cadeia da polimerase Prof. Dr. Francisco Prosdocimi http://dotsub.com/view/538a719f-927b-4192-8e95-18a92a9e95a5
  11. 11. Reação em cadeia
  12. 12. Amplificação do DNA
  13. 13. Síntese de DNA in vitro• Polimerase Chain Reaction – Reação em cadeia da Polimerase• Amplificação in vitro de moléculas de DNA – In vivo X In vitro X In silico• Procedimento análogo à replicação do DNA – Amostra de DNA; 2 primers; DNA polimerase; Tampão; dNTP
  14. 14. Etapas da PCR• Ciclos da PCR – Separação das fitas → 96°C – Anelamento dos primers → 60°C – Síntese do DNA → 37°C• Problema inicial da técnica – Durante a etapa de quebra das pontes de H e separação das fitas (DNA melting) a 96°C, a enzima polimerase era desnaturada e precisava ser acrescentada ciclo a ciclo... – Não permitia automação
  15. 15. História da PCR• Químico, 1966 – Doutor em bioquímica, 1972 – 2 anos de pós-doutorado numa industria farmacêutica• Deixou a academia para escrever ficção científica, foi dono de Kary Mullis, 1944 padaria por dois anos; voltou à indústria• 1983 → Teve a idéia de utilizar um par de primers para amplificação enquanto voltava para a casa à noite ao lado da namorada• Avisou na empresa e deixou-se que ele ficasse trabalhando na PCR, demorou um ano para padronizar a técnica• Perdeu a namorada logo depois, mas ganhou o Nobel de química (1993)• 1986 → utilização da enzima polimerase de Thermus aquaticus – Permitiu finalmente a automação da técnica• Controvérsias: Surfista, já foi divorciado 3 vezes, é um dos que acredita que o HIV não causa a AIDS, e diz ter tomado bastante LSD na década de 60/70 e que isso o ajudou a descobrir a afamada técnica! Taq polimerase
  16. 16. PCRSistema de reação: DNA molde (100 ng) Iniciadores (5 µM) dNTPs Tampão com MgCL2 Taq polimerase Protocolo de amplificação: Desnaturação: 95º C Anelamento: 45-60º C Extensão: 72º C
  17. 17. Filmes como técnica didática• http://learn.genetics.utah.edu/content/labs/pcr/• http://www.maxanim.com/genetics/PCR/PCR.htm• http://www.youtube.com/watch?v=_YgXcJ4n-kQ
  18. 18. Interlúdio explicativoProf. Dr. Francisco Prosdocimi
  19. 19. Bioquímica + Biomol • Enzimas são proteínas, portanto: 1. São formadas por sequências de aminoácidos 2. Derivam de informações dispostas por genes no DNA, que deve ser transcrito e, posteriormente, traduzido 3. Podemos saber a sequência delas, tanto de aminoácidos quanto de nucleotídeos
  20. 20. >gi|188497753|ref|NM_000188.2| Homo sapiens hexokinase 1 (HK1), nucleargene encoding mitochondrial protein, transcript variant 1, mRNAGAGGAGGAGCCGCCGAGCAGCCGCCGGAGGACCACGGCTCGCCAGGGCTGCGGAGGACCGACCGTCCCCACGCCTGCCGCCCCGCGACCCCGACCGCCAGCATGATCGCCGCGCAGCTCCTGGCCTATTACTTCACGGAGCTGAAGGATGACCAGGTCAAAAAGATTGACAAGTATCTCTATGCCATGCGGCTCTCCGATGAAACTCTCATAGATATCATGACTCGCTTCAGGAAGGAGATGAAGAATGGCCTCTCCCGGGATTTTAATCCAACAGCCACAGTCAAGATGTTGCCAACATTCGTAAGGTCCATTCCTGATGGCTCTGAAAAGGGAGATTTCATTGCCCTGGATCTTGGTGGGTCTTCCTTTCGAATTCTGCGGGTGCAAGTGAATCATGAGAAAAACCAGAATGTTCACA >gi|188497754|ref|NP_000179.2| hexokinase 1 isoform HKI [Homo sapiens]TGGAGTCCGAGGTTTATGACACCCCAGAGAACATCGTGCACGGCAGTGGAAGCCAGCTTTTTGATCATGT MIAAQLLAYYFTELKDDQVKKIDKYLYAMRLSDETLIDIMTRFRKEMKNGLSRDFNPTATVKMLPTFVRSTGCTGAGTGCCTGGGAGATTTCATGGAGAAAAGGAAGATCAAGGACAAGAAGTTACCTGTGGGATTCACG IPDGSEKGDFIALDLGGSSFRILRVQVNHEKNQNVHMESEVYDTPENIVHGSGSQLFDHVAECLGDFMEKTTTTCTTTTCCTTGCCAACAATCCAAAATAGATGAGGCCATCCTGATCACCTGGACAAAGCGATTTAAAG RKIKDKKLPVGFTFSFPCQQSKIDEAILITWTKRFKASGVEGADVVKLLNKAIKKRGDYDANIVAVVNDTCGAGCGGAGTGGAAGGAGCAGATGTGGTCAAACTGCTTAACAAAGCCATCAAAAAGCGAGGGGACTATGA VGTMMTCGYDDQHCEVGLIIGTGTNACYMEELRHIDLVEGDEGRMCINTEWGAFGDDGSLEDIRTEFDRETGCCAACATCGTAGCTGTGGTGAATGACACAGTGGGCACCATGATGACCTGTGGCTATGACGACCAGCAC IDRGSLNPGKQLFEKMVSGMYLGELVRLILVKMAKEGLLFEGRITPELLTRGKFNTSDVSAIEKNKEGLHTGTGAAGTCGGCCTGATCATCGGCACTGGCACCAATGCTTGCTACATGGAGGAACTGAGGCACATTGATC NAKEILTRLGVEPSDDDCVSVQHVCTIVSFRSANLVAATLGAILNRLRDNKGTPRLRTTVGVDGSLYKTHTGGTGGAAGGAGACGAGGGGAGGATGTGTATCAATACAGAATGGGGAGCCTTTGGAGACGATGGATCATT PQYSRRFHKTLRRLVPDSDVRFLLSESGSGKGAAMVTAVAYRLAEQHRQIEETLAHFHLTKDMLLEVKKRAGAAGACATCCGGACAGAGTTTGACAGGGAGATAGACCGGGGATCCCTCAACCCTGGAAAACAGCTGTTT MRAEMELGLRKQTHNNAVVKMLPSFVRRTPDGTENGDFLALDLGGTNFRVLLVKIRSGKKRTVEMHNKIYGAGAAGATGGTCAGTGGCATGTACTTGGGAGAGCTGGTTCGACTGATCCTAGTCAAGATGGCCAAGGAGG AIPIEIMQGTGEELFDHIVSCISDFLDYMGIKGPRMPLGFTFSFPCQQTSLDAGILITWTKGFKATDCVGGCCTCTTATTTGAAGGGCGGATCACCCCGGAGCTGCTCACCCGAGGGAAGTTTAACACCAGTGATGTGTC HDVVTLLRDAIKRREEFDLDVVAVVNDTVGTMMTCAYEEPTCEVGLIVGTGSNACYMEEMKNVEMVEGDQAGCCATCGAAAAGAATAAGGAAGGCCTCCACAATGCCAAAGAAATCCTGACCCGCCTGGGAGTGGAGCCG GQMCINMEWGAFGDNGCLDDIRTHYDRLVDEYSLNAGKQRYEKMISGMYLGEIVRNILIDFTKKGFLFRGTCCGATGATGACTGTGTCTCAGTCCAGCACGTTTGCACCATTGTCTCATTTCGCTCAGCCAACTTGGTGG QISETLKTRGIFETKFLSQIESDRLALLQVRAILQQLGLNSTCDDSILVKTVCGVVSRRAAQLCGAGMAACTGCCACACTGGGCGCCATCTTGAACCGCCTGCGTGATAACAAGGGCACACCCAGGCTGCGGACCACGGT VVDKIRENRGLDRLNVTVGVDGTLYKLHPHFSRIMHQTVKELSPKCNVSFLLSEDGSGKGAALITAVGVRTGGTGTCGACGGATCTCTTTACAAGACGCACCCACAGTATTCCCGGCGTTTCCACAAGACTCTAAGGCGC LRTEASSTTGGTGCCAGACTCCGATGTGCGCTTCCTCCTCTCGGAGAGTGGCAGCGGCAAGGGGGCTGCCATGGTGACGGCGGTGGCCTACCGCTTGGCCGAGCAGCACCGGCAGATAGAGGAGACCCTGGCTCATTTCCACCTCACCAAGGACATGCTGCTGGAGGTGAAGAAGAGGATGCGGGCCGAGATGGAGCTGGGGCTGAGGAAGCAGACGCACAACAATGCCGTGGTTAAGATGCTGCCCTCCTTCGTCCGGAGAACTCCCGACGGGACCGAGAATGGTGACTTCTTGGCCCTGGATCTTGGAGGAACCAATTTCCGTGTGCTGCTGGTGAAAATCCGTAGTGGGAAAAA 917GAGAACGGTGGAAATGCACAACAAGATCTACGCCATTCCTATTGAAATCATGCAGGGCACTGGGGAAGAGCTGTTTGATCACATTGTCTCCTGCATCTCTGACTTCTTGGACTACATGGGGATCAAAGGCCCCAGGATGC aminoácidosCTCTGGGCTTCACGTTCTCATTTCCCTGCCAGCAGACGAGTCTGGACGCGGGAATCTTGATCACGTGGACAAAGGGTTTTAAGGCAACAGACTGCGTGGGCCACGATGTAGTCACCTTACTAAGGGATGCGATAAAAAGGAGAGAGGAATTTGACCTGGACGTGGTGGCTGTGGTCAACGACACAGTGGGCACCATGATGACCTGTGCTTATGAGGAGCCCACCTGTGAGGTTGGACTCATTGTTGGGACCGGCAGCAATGCCTGCTACATGGAGGAGATGAAGAACGTGGAGATGGTGGAGGGGGACCAGGGGCAGATGTGCATCAACATGGAGTGGGGGGCCTTTGGGGACAACGGGTGTCTGGATGATATCAGGACACACTACGACAGACTGGTGGACGAATATTCCCTAAATGCTGGGAAACAAAGGTATGAGAAGATGATCAGTGGTATGTACCTGGGTGAAATCGTCCGCAACATCTTAATCGACTTCACCAAGAAGGGATTCCTCTTCCGAGGGCAGATCTCTGAGACGCTGAAGACCCGGGGCATCTTTGAGACCAAGTTTCTCTCTCAGATCGAGAGTGACCGATTAGCACTGCTCCAGGTCCGGGCTATCCTCCAGCAGCTAGGTCTGAATAGCACCTGCGATGACAGTATCCTCGTCAAGACAGTGTGCGGGGTGGTGTCCAGGAGGGC 917 x 3 = 2751CGCACAGCTGTGTGGCGCAGGCATGGCTGCGGTTGTGGATAAGATCCGCGAGAACAGAGGACTGGACCGTCTGAATGTGACTGTGGGAGTGGACGGGACACTCTACAAGCTTCATCCACACTTCTCCAGAATCATGCACCAGACGGTGAAGGAACTGTCACCAAAATGTAACGTGTCCTTCCTCCTGTCTGAGGATGGCAGCGGCAAGGGGGCCGCCCTCATCACGGCCGTGGGCGTGCGGTTACGCACAGAGGCAAGCAGCTAAGAGTCCGGGATCCCC 3617-2751 = 866AGCCTACTGCCTCTCCAGCACTTCTCTCTTCAAGCGGCGACCCCCTACCCTCCCAGCGAGTTGCGCTGGGAGACGCTGGCGCCAGGGCCTGCCGGCGCGGGGAGGAAAGCAAAATCCAACTAATGGTATATATTGTAGGGTACAGAATAGAGCGTGTGCTGTTGATAATATCTCTCACCCGGATCCCTCCTCACTTGCCCTGCCACTTTGCATGGTTTGATTTTGACCTGGTCCCCCACGTGTGAAGTGTAGTGGCATCCATTTCTAATGTATGCATTCATCCAACAGAGTTATTTATTGGCTGGAGATGGAAAATCACACCACCTGACAGGCCTTCTGGGCCTCCAAAGCCCATCCTTGGGGTTCCCCCTCCCTGTGTGAAATGTATTATCACCAGCAGACACTGCCGGGCCTCCCTCCCGGGGGCACTGCCTGAAGGCGAGTGTGGGCATAGCATTAGCTGCTTCCTCCCCTCCTGGCACCCACTGTG 3617 bpGCCTGGCATCGCATCGTGGTGTGTCAATGCCACAAAATCGTGTGTCCGTGGAACCAGTCCTAGCCGCGTGTGACAGTCTTGCATTCTGTTTGTCTCGTGGGGGGAGGTGGACAGTCCTGCGGAAATGTGTCTTGTCTCCA 3,6 kbTTTGGATAAAAGGAACCAACCAACAAACAATGCCATCACTGGAATTTCCCACCGCTTTGTGAGCCGTGTCGTATGACCTAGTAAACTTTGTACCAATTCAAAAAAAAAAAAAAAAAA
  21. 21. Sequenciamento de proteínas• Degradação de Edman – Quebra-se o aminoácido N-terminal – Identifica-se o aminoácido quebrado – Sequenciamento de 50 a 70 aa’s• Espectometria de massa – Quebra-se a proteína em diversos pontos e verifica-se a massa dos fragmentos – Comparações com massas conhecidas dos aa’s identifica a sequência dos mesmos• Técnicas com limite de automação – Não permitem produzir dados em larga- escala – Para saber-se a sequência de um proteína, muitas vezes sequencia-se o DNA do organismo de interesse
  22. 22. O Sequenciamento de moléculas de DNA Prof. Dr. Francisco Prosdocimi>gi|33869444|gb|BC008730.2| Homo sapiens hexokinase 1, mRNA (cDNA clone MGC:1724IMAGE:3163058), complete cdsGGCTGCGGAGGACCGACCGTCCCCACGCCTGCCGCCCCGCGACCCCGACCGCCAGCATGATCGCCGCGCAGCTCCTGGCCTATTACTTCACGGAGCTGAAGGATGACCAGGTCAAAAAGATTGACAAGTATCTGTATGCCATGCGGCTCTCCGATGAAACTCTCATAGATATCATGACTCGCTTCAGGAAGGAGATGAAGAATGGCCTCTCCCGGGATTTTAATCCAACAGCCACAGTCAAGATGTTGCCAACATTCGTAAGGTCCATTCCTGATGGCTCTGAAAAGGGAGATTTCATTGCCCTGGATCTTGGTGGGTCTTCCTTTCGAATTCTGCGGGTGCAAGTGAATCATGAGAAAAACCAGAATGTTCACATGGAGTCCGAGGTTTATGACACCCCAGAGAACATCGTGCACGGCAGTGGAAGCCAGCTTTTTGATCATGTTGCTGAGTGCCTGGGAGATTTCATGGAGAAAAGGAAGATCAAGGACAAGAAGTTACCTGTGGGATTCACGTTTTCTTTTCCTTGCCAACAATCCAAAATAGATGAGGCCATCCTGATCACCTGGACAAAGCGATTTAAAGCGAGCGGAGTGGAAGGAGCAGATGTGGTCAAACTGCTTAACAAAG(...)TGACAGGCCTTCTGGGCCTCCAAAGCCCATCCTTGGGGTTCCCCCTCCCTGTGTGAAATGTATTATCACCAGCAGACACTGCCGGGCCTCCCTCCCGGGGGCACTGCCTGAAGGCGAGTGTGGGCATAGCATTAGCTGCTTCCTCCCCTCCTGGCACCCACTGTGGCCTGGCATCGCATCGTGGTGTGTCAATGCCACAAAATCGTGTGTCCGTGGAACCAGTCCTAGCCGCGTGTGACAGTCTTGCATTCTGTTTGTCTCGTGGGGGGAGGTGGACAGTCCTGCGGAAATGTGTCTTGTCTCCATTTGGATAAAAGGAACCAACCAACAAACAATGCCATCACTGGAATTTCCCACCGCTTTGTGAGCCGTGTCGTATGACCTAGTAAACTTTGTACCAATTCAAAAAAAAAAAAAAAAAA
  23. 23. Frederick Sanger• Único vivo dentre os 4 indivíduos que já venceram dois prêmios Nobel• ~1955: publicou a primeira sequência de aminoácidos da insulina – Ganhou o Nobel de química em 1958• 1964: descobriu que as proteínas de bactéria iniciavam-se com o aminoácido formil-metionina• 1967: desvendou a sequência do RNA ribossomal 5S• 1975: inventou o método dideóxi para o sequenciamento do DNA• 1977: sequencia, pela primeira vez, o genoma inteiro de um organismo, o bacteriófago phi X 174 – 11 genes in 5386 bases sequenciadas “à mão“ – Ganha o segundo Nobel de química em 1980
  24. 24. O método de Sanger, 1975 Polimerização do DNA a ser sequenciado (molde) na presença de: DNA polimerase primer tampão dNTPs (desóxinucleotídeo) ddNTPs (didesóxinucleotídeo) O que faria um nucleotídeo que, ao invés da extremidade 3’OH, tem uma extremidade 3’H? Como acontece a síntese de moléculas de DNA?http://www.youtube.com/watch?v=Mz-4LSfecM4&feature=related(dideóxi)
  25. 25. Amplificação interrompida com didesoxinucleotídeosDesoxinucleotídeos dNTP O didesóxinucleotídeo não tem a extremidade 3’OH livre (...) e, portanto, não permite a incorporação de novas bases a 3’ quando é adicionado, (...) interrompendo a formação da nova cadeia definitivamente ddNTP Didesoxinucleotídeos
  26. 26. G C T T T A C C T G C A A G T T C A AC T T C A G T C A TG G G A C C C A G5’ 3’ T A G ATGCTTC ||||||| TACGAAGACCGTCTAGACTTGTCACAATGACTATAACGAA3’ 5’
  27. 27. C T T T T C G C A C A A T A G T C A AC T G T G T C C AG TG G A C C C T A G5’ 3’ G ATGCTTC A ||||||||| TACGAAGACCGTCTAGACTTGTCACAATGACTATAACGAA3’ 5’
  28. 28. T C T C C T G T C A A G T T A C CA AC T T G T A G C A TG G G A C C C A G5’ 3’ T A G ATGCTTCTG |||||||||| TACGAAGACCGTCTAGACTTGTCACAATGACTATAACGAA3’
  29. 29. C AT G C TA T T A T TT C T G C G C CA A G T G C C A G T G A A T A G C GC A C5’ 3’ ATGCTTCTGGCAGATCT ||||||||||||||||| TACGAAGACCGTCTAGACTTGTCACAATGACTATAACGAA3’ 5’
  30. 30. A T GAA G A G T T T T GA G C T TA C T GT G C A T C C AC C G CA GA T C CC5’ 3’ ATGCTTCTGGCAGAT ||||||||||||||| TACGAAGACCGTCTAGACTTGTCACAATGACTATAACGAA3’ 5’
  31. 31. CC A T T T T T GAA G A TA CG A C G GT T C A G T GA GA T T C G C C C C AC5’ 3’ ATGCTTCTGGCAGAT ||||||||||||||| TACGAAGACCGTCTAGACTTGTCACAATGACTATAACGAA3’ 5’
  32. 32. A T T GA CC A G A G T T T C A G C T TA GT G T C T G C AC G T C CA GA C AC5’ 3’ ATGCTTCTGGCAGAT ||||||||||||||| TACGAAGACCGTCTAGACTTGTCACAATGACTATAACGAA3’ 5’
  33. 33. 5’ 3’ ATGCTTCTGGCAGATCTGAACAGTGTTACTGAT ATGCTTCTGGCAGATCTGAACAGTGT ATGCTTCTGGCAGATCTGAACAGTGTTACTGATATTGCTT ATGCTTCTGGCAGATCTGAACAGTGTTACTGATAT População de ATGCTTCTGGCAGATCTGAACAGTGTTACT moléculas ATGCTTCTGGCAGATCTGAACAGT ATGCTTCTGGCAGATCTGAACAGTGTTACTGATATTGCT Incorporação aleatória do ATGCTTCTGGCAGATCTGAACAGTGTTACTGATATT didesóxi ATGCTTCT ATGCTTCTGGCAGATCT Quantidade ATGCTTCTGGCAGATCTGAACAGTGTTACTGATATTGCTT precisa entre didesóxi e ATGCTTCTGGCAGATCTGAACAGTGTT desóxi ATGCTTCTGGCAGAT |||||||||||||||||||||||||||||||||||||||| TACGAAGACCGTCTAGACTTGTCACAATGACTATAACGAA3’ 5’
  34. 34. ATGCTTCTATGCTTCTGGCAGATATGCTTCTGGCAGATCTATGCTTCTGGCAGATCTGAACAGTATGCTTCTGGCAGATCTGAACAGTGTATGCTTCTGGCAGATCTGAACAGTGTTATGCTTCTGGCAGATCTGAACAGTGTTACTATGCTTCTGGCAGATCTGAACAGTGTTACTGATATGCTTCTGGCAGATCTGAACAGTGTTACTGATATATGCTTCTGGCAGATCTGAACAGTGTTACTGATATTATGCTTCTGGCAGATCTGAACAGTGTTACTGATATTGCTATGCTTCTGGCAGATCTGAACAGTGTTACTGATATTGCTTATGCTTCTGGCAGATCTGAACAGTGTTACTGATATTGCTT
  35. 35. • molde • polimerase • dN TPs•ddG TPs •ddA TPs •ddT TPs •ddC TPs G A T C
  36. 36. ATGCTTCTATGCTTCTGATGCTTCTGGATGCTTCTGGCATGCTTCTGGCAATGCTTCTGGCAGATGCTTCTGGCAGAATGCTTCTGGCAGATATGCTTCTGGCAGATCATGCTTCTGGCAGATCTATGCTTCTGGCAGATCTGATGCTTCTGGCAGATCTGAATGCTTCTGGCAGATCTGAAATGCTTCTGGCAGATCTGAACATGCTTCTGGCAGATCTGAACAATGCTTCTGGCAGATCTGAACAGATGCTTCTGGCAGATCTGAACAGTATGCTTCTGGCAGATCTGAACAGTGATGCTTCTGGCAGATCTGAACAGTGTATGCTTCTGGCAGATCTGAACAGTGTTATGCTTCTGGCAGATCTGAACAGTGTTAATGCTTCTGGCAGATCTGAACAGTGTTACATGCTTCTGGCAGATCTGAACAGTGTTACTATGCTTCTGGCAGATCTGAACAGTGTTACTGATGCTTCTGGCAGATCTGAACAGTGTTACTGAATGCTTCTGGCAGATCTGAACAGTGTTACTGATATGCTTCTGGCAGATCTGAACAGTGTTACTGATAATGCTTCTGGCAGATCTGAACAGTGTTACTGATATATGCTTCTGGCAGATCTGAACAGTGTTACTGATATTATGCTTCTGGCAGATCTGAACAGTGTTACTGATATTGATGCTTCTGGCAGATCTGAACAGTGTTACTGATATTGCATGCTTCTGGCAGATCTGAACAGTGTTACTGATATTGCTATGCTTCTGGCAGATCTGAACAGTGTTACTGATATTGCTT G A T CATGCTTCTGGCAGATCTGAACAGTGTTACTGATATTGCTT
  37. 37. ATGCTTCTATGCTTCTGATGCTTCTGGATGCTTCTGGCATGCTTCTGGCAATGCTTCTGGCAGATGCTTCTGGCAGAATGCTTCTGGCAGATATGCTTCTGGCAGATCATGCTTCTGGCAGATCTATGCTTCTGGCAGATCTGATGCTTCTGGCAGATCTGAATGCTTCTGGCAGATCTGAAATGCTTCTGGCAGATCTGAACATGCTTCTGGCAGATCTGAACAATGCTTCTGGCAGATCTGAACAGATGCTTCTGGCAGATCTGAACAGTATGCTTCTGGCAGATCTGAACAGTGATGCTTCTGGCAGATCTGAACAGTGTATGCTTCTGGCAGATCTGAACAGTGTTATGCTTCTGGCAGATCTGAACAGTGTTAATGCTTCTGGCAGATCTGAACAGTGTTACATGCTTCTGGCAGATCTGAACAGTGTTACTATGCTTCTGGCAGATCTGAACAGTGTTACTGATGCTTCTGGCAGATCTGAACAGTGTTACTGAATGCTTCTGGCAGATCTGAACAGTGTTACTGATATGCTTCTGGCAGATCTGAACAGTGTTACTGATAATGCTTCTGGCAGATCTGAACAGTGTTACTGATATATGCTTCTGGCAGATCTGAACAGTGTTACTGATATTATGCTTCTGGCAGATCTGAACAGTGTTACTGATATTGATGCTTCTGGCAGATCTGAACAGTGTTACTGATATTGCATGCTTCTGGCAGATCTGAACAGTGTTACTGATATTGCTATGCTTCTGGCAGATCTGAACAGTGTTACTGATATTGCTTATGCTTCTGGCAGATCTGAACAGTGTTACTGATATTGCTT
  38. 38. Modelo originalEtapa 1 Marcação do primerAmplificaçãoTipo-PCr 4 reações necessárias, uma para cada base Eletroforese separa fragmentos deEtapa 2 diferentes tamanhosEletroforese Leitura manual da sequência de baixo pra cima
  39. 39. Sanger e o fago Phi 174 De fato, esse tipo de sequenciamento manual continuou acontecendo por décadas...
  40. 40. Modelo moderno Applied Byosystems, 1986 Marcação fluorescente do ddNTP Leroy Hood, 1938- 1 reação necessária, todas as bases lidas ao mesmo tempo Eletroforese separa fragmentos de diferentes tamanhos Leitura da automática sequência, de baixo pra cima, por um laser http://www.youtube.com/watc h?v=ezAefHhvecM
  41. 41. Cromatograma
  42. 42. As máquinas necessárias para o sequenciamento• Primeira etapa: junta-se os reagentes em poços de placas e coloca-se na máquina de PCR para a reação de amplificação interrompida• Diferenças com relação ao PCR – Utilização de um só primer – Utilização dos ddNTPs• Uma vez prontas, as sequências de diferentes tamanhos contendo os didesóxi amplificados devem ser enviadas ao sequenciador de DNA mais próximo
  43. 43. O que faz um sequenciador de DNA?• Segunda etapa: realiza a eletroforese capilar – O sequenciador executa a eletroforese em géis capilares ultra-finos – Um sensor é responsável por emitir um laser e verificar qual o comprimento de onda emitido pelo didesóxi
  44. 44. ExercícioDê a sequência de DNA da canaleta apontadaazul = Guaninaamarelo = Timinavermelha = Adeninaverde = Citosinahttp://www.youtube.com/watch?v=dUjMf2ZezIw&feature=related

×