• Share
  • Email
  • Embed
  • Like
  • Save
  • Private Content
Aula 9 eletroforese_pcr_sequenciamento
 

Aula 9 eletroforese_pcr_sequenciamento

on

  • 1,457 views

 

Statistics

Views

Total Views
1,457
Views on SlideShare
1,457
Embed Views
0

Actions

Likes
0
Downloads
72
Comments
0

0 Embeds 0

No embeds

Accessibility

Categories

Upload Details

Uploaded via as Microsoft PowerPoint

Usage Rights

© All Rights Reserved

Report content

Flagged as inappropriate Flag as inappropriate
Flag as inappropriate

Select your reason for flagging this presentation as inappropriate.

Cancel
  • Full Name Full Name Comment goes here.
    Are you sure you want to
    Your message goes here
    Processing…
Post Comment
Edit your comment

    Aula 9 eletroforese_pcr_sequenciamento Aula 9 eletroforese_pcr_sequenciamento Presentation Transcript

    • A técnica da Eletroforese para a análise de DNA e proteínas Prof. Dr. Francisco Prosdocimi
    • Histórico• 1952, Markham and Smith – Ao estudarem hidrólise de RNA percebem que moléculas de diferentes estruturas têm sua mobilidade diferenciada quando aplicadas num papel e submetidas a um campo elétrico Vou ali correr• 1955, Smithies um gelzinho e – Géis de amido funcionam bem para separar proteínas do soro humano já volto• 1967, Loening Tenho que ir senão – Géis de acrilamida com maior resolução e vou perder meu gel permitem separar ainda moléculas grandes de DNA• 1980, Schwartz and Cantor – Eletroforese em campo pulsado separa fragmentos enormes• É hoje impossível imaginar um laboratório de biomol sem eletroforese acontecendo a todo instante...
    • Eletroforese• Movimento de partículas dispersas num fluído sob influência de um campo elétrico uniforme• DNA, carga negativa – Tem tendência a se dirigir ao polo positivo quando sujeito a um campo elétrico• Serve para separar moléculas por tamanho/carga elétrica – Proteína deve ser desnaturada com detergente (SDS)• Técnica utilizada à exaustão em trabalhos de biologia molecular
    • Eletroforese, etapas1.Preparação do gel2.Aplicação das amostras3.Eletroforese4.Coloração5. Análise dos resultados
    • Preparação do gel Horizontal X Vertical Agarose X Poliacrilamida
    • Aplicação das amostrasDefinição do mapa dasamostras por canaleta
    • Corrida do gel• Aplicação do campo elétrico• Fonte elétrica gera fluxo de íons através da solução tampão• Terminais positivo e negativo• Tempo adequado, senão o DNA sai do gel
    • Coloração das moléculas• Brometo de etídio – Agente intercalante do DNA • Cancerígeno! – Composto fluorescente à luz UV – Gel de agarose• Prata – Gel SDS-PAGE • PoliAcrilamide Gel Electrophoresis – Melhor resolução• Coomassie blue, etc
    • Eletroforese em campo pulsado Grandes fragmentos de DNA
    • PCRa reação em cadeia da polimerase Prof. Dr. Francisco Prosdocimi http://dotsub.com/view/538a719f-927b-4192-8e95-18a92a9e95a5
    • Reação em cadeia
    • Amplificação do DNA
    • Síntese de DNA in vitro• Polimerase Chain Reaction – Reação em cadeia da Polimerase• Amplificação in vitro de moléculas de DNA – In vivo X In vitro X In silico• Procedimento análogo à replicação do DNA – Amostra de DNA; 2 primers; DNA polimerase; Tampão; dNTP
    • Etapas da PCR• Ciclos da PCR – Separação das fitas → 96°C – Anelamento dos primers → 60°C – Síntese do DNA → 37°C• Problema inicial da técnica – Durante a etapa de quebra das pontes de H e separação das fitas (DNA melting) a 96°C, a enzima polimerase era desnaturada e precisava ser acrescentada ciclo a ciclo... – Não permitia automação
    • História da PCR• Químico, 1966 – Doutor em bioquímica, 1972 – 2 anos de pós-doutorado numa industria farmacêutica• Deixou a academia para escrever ficção científica, foi dono de Kary Mullis, 1944 padaria por dois anos; voltou à indústria• 1983 → Teve a idéia de utilizar um par de primers para amplificação enquanto voltava para a casa à noite ao lado da namorada• Avisou na empresa e deixou-se que ele ficasse trabalhando na PCR, demorou um ano para padronizar a técnica• Perdeu a namorada logo depois, mas ganhou o Nobel de química (1993)• 1986 → utilização da enzima polimerase de Thermus aquaticus – Permitiu finalmente a automação da técnica• Controvérsias: Surfista, já foi divorciado 3 vezes, é um dos que acredita que o HIV não causa a AIDS, e diz ter tomado bastante LSD na década de 60/70 e que isso o ajudou a descobrir a afamada técnica! Taq polimerase
    • PCRSistema de reação: DNA molde (100 ng) Iniciadores (5 µM) dNTPs Tampão com MgCL2 Taq polimerase Protocolo de amplificação: Desnaturação: 95º C Anelamento: 45-60º C Extensão: 72º C
    • Filmes como técnica didática• http://learn.genetics.utah.edu/content/labs/pcr/• http://www.maxanim.com/genetics/PCR/PCR.htm• http://www.youtube.com/watch?v=_YgXcJ4n-kQ
    • Interlúdio explicativoProf. Dr. Francisco Prosdocimi
    • Bioquímica + Biomol • Enzimas são proteínas, portanto: 1. São formadas por sequências de aminoácidos 2. Derivam de informações dispostas por genes no DNA, que deve ser transcrito e, posteriormente, traduzido 3. Podemos saber a sequência delas, tanto de aminoácidos quanto de nucleotídeos
    • >gi|188497753|ref|NM_000188.2| Homo sapiens hexokinase 1 (HK1), nucleargene encoding mitochondrial protein, transcript variant 1, mRNAGAGGAGGAGCCGCCGAGCAGCCGCCGGAGGACCACGGCTCGCCAGGGCTGCGGAGGACCGACCGTCCCCACGCCTGCCGCCCCGCGACCCCGACCGCCAGCATGATCGCCGCGCAGCTCCTGGCCTATTACTTCACGGAGCTGAAGGATGACCAGGTCAAAAAGATTGACAAGTATCTCTATGCCATGCGGCTCTCCGATGAAACTCTCATAGATATCATGACTCGCTTCAGGAAGGAGATGAAGAATGGCCTCTCCCGGGATTTTAATCCAACAGCCACAGTCAAGATGTTGCCAACATTCGTAAGGTCCATTCCTGATGGCTCTGAAAAGGGAGATTTCATTGCCCTGGATCTTGGTGGGTCTTCCTTTCGAATTCTGCGGGTGCAAGTGAATCATGAGAAAAACCAGAATGTTCACA >gi|188497754|ref|NP_000179.2| hexokinase 1 isoform HKI [Homo sapiens]TGGAGTCCGAGGTTTATGACACCCCAGAGAACATCGTGCACGGCAGTGGAAGCCAGCTTTTTGATCATGT MIAAQLLAYYFTELKDDQVKKIDKYLYAMRLSDETLIDIMTRFRKEMKNGLSRDFNPTATVKMLPTFVRSTGCTGAGTGCCTGGGAGATTTCATGGAGAAAAGGAAGATCAAGGACAAGAAGTTACCTGTGGGATTCACG IPDGSEKGDFIALDLGGSSFRILRVQVNHEKNQNVHMESEVYDTPENIVHGSGSQLFDHVAECLGDFMEKTTTTCTTTTCCTTGCCAACAATCCAAAATAGATGAGGCCATCCTGATCACCTGGACAAAGCGATTTAAAG RKIKDKKLPVGFTFSFPCQQSKIDEAILITWTKRFKASGVEGADVVKLLNKAIKKRGDYDANIVAVVNDTCGAGCGGAGTGGAAGGAGCAGATGTGGTCAAACTGCTTAACAAAGCCATCAAAAAGCGAGGGGACTATGA VGTMMTCGYDDQHCEVGLIIGTGTNACYMEELRHIDLVEGDEGRMCINTEWGAFGDDGSLEDIRTEFDRETGCCAACATCGTAGCTGTGGTGAATGACACAGTGGGCACCATGATGACCTGTGGCTATGACGACCAGCAC IDRGSLNPGKQLFEKMVSGMYLGELVRLILVKMAKEGLLFEGRITPELLTRGKFNTSDVSAIEKNKEGLHTGTGAAGTCGGCCTGATCATCGGCACTGGCACCAATGCTTGCTACATGGAGGAACTGAGGCACATTGATC NAKEILTRLGVEPSDDDCVSVQHVCTIVSFRSANLVAATLGAILNRLRDNKGTPRLRTTVGVDGSLYKTHTGGTGGAAGGAGACGAGGGGAGGATGTGTATCAATACAGAATGGGGAGCCTTTGGAGACGATGGATCATT PQYSRRFHKTLRRLVPDSDVRFLLSESGSGKGAAMVTAVAYRLAEQHRQIEETLAHFHLTKDMLLEVKKRAGAAGACATCCGGACAGAGTTTGACAGGGAGATAGACCGGGGATCCCTCAACCCTGGAAAACAGCTGTTT MRAEMELGLRKQTHNNAVVKMLPSFVRRTPDGTENGDFLALDLGGTNFRVLLVKIRSGKKRTVEMHNKIYGAGAAGATGGTCAGTGGCATGTACTTGGGAGAGCTGGTTCGACTGATCCTAGTCAAGATGGCCAAGGAGG AIPIEIMQGTGEELFDHIVSCISDFLDYMGIKGPRMPLGFTFSFPCQQTSLDAGILITWTKGFKATDCVGGCCTCTTATTTGAAGGGCGGATCACCCCGGAGCTGCTCACCCGAGGGAAGTTTAACACCAGTGATGTGTC HDVVTLLRDAIKRREEFDLDVVAVVNDTVGTMMTCAYEEPTCEVGLIVGTGSNACYMEEMKNVEMVEGDQAGCCATCGAAAAGAATAAGGAAGGCCTCCACAATGCCAAAGAAATCCTGACCCGCCTGGGAGTGGAGCCG GQMCINMEWGAFGDNGCLDDIRTHYDRLVDEYSLNAGKQRYEKMISGMYLGEIVRNILIDFTKKGFLFRGTCCGATGATGACTGTGTCTCAGTCCAGCACGTTTGCACCATTGTCTCATTTCGCTCAGCCAACTTGGTGG QISETLKTRGIFETKFLSQIESDRLALLQVRAILQQLGLNSTCDDSILVKTVCGVVSRRAAQLCGAGMAACTGCCACACTGGGCGCCATCTTGAACCGCCTGCGTGATAACAAGGGCACACCCAGGCTGCGGACCACGGT VVDKIRENRGLDRLNVTVGVDGTLYKLHPHFSRIMHQTVKELSPKCNVSFLLSEDGSGKGAALITAVGVRTGGTGTCGACGGATCTCTTTACAAGACGCACCCACAGTATTCCCGGCGTTTCCACAAGACTCTAAGGCGC LRTEASSTTGGTGCCAGACTCCGATGTGCGCTTCCTCCTCTCGGAGAGTGGCAGCGGCAAGGGGGCTGCCATGGTGACGGCGGTGGCCTACCGCTTGGCCGAGCAGCACCGGCAGATAGAGGAGACCCTGGCTCATTTCCACCTCACCAAGGACATGCTGCTGGAGGTGAAGAAGAGGATGCGGGCCGAGATGGAGCTGGGGCTGAGGAAGCAGACGCACAACAATGCCGTGGTTAAGATGCTGCCCTCCTTCGTCCGGAGAACTCCCGACGGGACCGAGAATGGTGACTTCTTGGCCCTGGATCTTGGAGGAACCAATTTCCGTGTGCTGCTGGTGAAAATCCGTAGTGGGAAAAA 917GAGAACGGTGGAAATGCACAACAAGATCTACGCCATTCCTATTGAAATCATGCAGGGCACTGGGGAAGAGCTGTTTGATCACATTGTCTCCTGCATCTCTGACTTCTTGGACTACATGGGGATCAAAGGCCCCAGGATGC aminoácidosCTCTGGGCTTCACGTTCTCATTTCCCTGCCAGCAGACGAGTCTGGACGCGGGAATCTTGATCACGTGGACAAAGGGTTTTAAGGCAACAGACTGCGTGGGCCACGATGTAGTCACCTTACTAAGGGATGCGATAAAAAGGAGAGAGGAATTTGACCTGGACGTGGTGGCTGTGGTCAACGACACAGTGGGCACCATGATGACCTGTGCTTATGAGGAGCCCACCTGTGAGGTTGGACTCATTGTTGGGACCGGCAGCAATGCCTGCTACATGGAGGAGATGAAGAACGTGGAGATGGTGGAGGGGGACCAGGGGCAGATGTGCATCAACATGGAGTGGGGGGCCTTTGGGGACAACGGGTGTCTGGATGATATCAGGACACACTACGACAGACTGGTGGACGAATATTCCCTAAATGCTGGGAAACAAAGGTATGAGAAGATGATCAGTGGTATGTACCTGGGTGAAATCGTCCGCAACATCTTAATCGACTTCACCAAGAAGGGATTCCTCTTCCGAGGGCAGATCTCTGAGACGCTGAAGACCCGGGGCATCTTTGAGACCAAGTTTCTCTCTCAGATCGAGAGTGACCGATTAGCACTGCTCCAGGTCCGGGCTATCCTCCAGCAGCTAGGTCTGAATAGCACCTGCGATGACAGTATCCTCGTCAAGACAGTGTGCGGGGTGGTGTCCAGGAGGGC 917 x 3 = 2751CGCACAGCTGTGTGGCGCAGGCATGGCTGCGGTTGTGGATAAGATCCGCGAGAACAGAGGACTGGACCGTCTGAATGTGACTGTGGGAGTGGACGGGACACTCTACAAGCTTCATCCACACTTCTCCAGAATCATGCACCAGACGGTGAAGGAACTGTCACCAAAATGTAACGTGTCCTTCCTCCTGTCTGAGGATGGCAGCGGCAAGGGGGCCGCCCTCATCACGGCCGTGGGCGTGCGGTTACGCACAGAGGCAAGCAGCTAAGAGTCCGGGATCCCC 3617-2751 = 866AGCCTACTGCCTCTCCAGCACTTCTCTCTTCAAGCGGCGACCCCCTACCCTCCCAGCGAGTTGCGCTGGGAGACGCTGGCGCCAGGGCCTGCCGGCGCGGGGAGGAAAGCAAAATCCAACTAATGGTATATATTGTAGGGTACAGAATAGAGCGTGTGCTGTTGATAATATCTCTCACCCGGATCCCTCCTCACTTGCCCTGCCACTTTGCATGGTTTGATTTTGACCTGGTCCCCCACGTGTGAAGTGTAGTGGCATCCATTTCTAATGTATGCATTCATCCAACAGAGTTATTTATTGGCTGGAGATGGAAAATCACACCACCTGACAGGCCTTCTGGGCCTCCAAAGCCCATCCTTGGGGTTCCCCCTCCCTGTGTGAAATGTATTATCACCAGCAGACACTGCCGGGCCTCCCTCCCGGGGGCACTGCCTGAAGGCGAGTGTGGGCATAGCATTAGCTGCTTCCTCCCCTCCTGGCACCCACTGTG 3617 bpGCCTGGCATCGCATCGTGGTGTGTCAATGCCACAAAATCGTGTGTCCGTGGAACCAGTCCTAGCCGCGTGTGACAGTCTTGCATTCTGTTTGTCTCGTGGGGGGAGGTGGACAGTCCTGCGGAAATGTGTCTTGTCTCCA 3,6 kbTTTGGATAAAAGGAACCAACCAACAAACAATGCCATCACTGGAATTTCCCACCGCTTTGTGAGCCGTGTCGTATGACCTAGTAAACTTTGTACCAATTCAAAAAAAAAAAAAAAAAA
    • Sequenciamento de proteínas• Degradação de Edman – Quebra-se o aminoácido N-terminal – Identifica-se o aminoácido quebrado – Sequenciamento de 50 a 70 aa’s• Espectometria de massa – Quebra-se a proteína em diversos pontos e verifica-se a massa dos fragmentos – Comparações com massas conhecidas dos aa’s identifica a sequência dos mesmos• Técnicas com limite de automação – Não permitem produzir dados em larga- escala – Para saber-se a sequência de um proteína, muitas vezes sequencia-se o DNA do organismo de interesse
    • O Sequenciamento de moléculas de DNA Prof. Dr. Francisco Prosdocimi>gi|33869444|gb|BC008730.2| Homo sapiens hexokinase 1, mRNA (cDNA clone MGC:1724IMAGE:3163058), complete cdsGGCTGCGGAGGACCGACCGTCCCCACGCCTGCCGCCCCGCGACCCCGACCGCCAGCATGATCGCCGCGCAGCTCCTGGCCTATTACTTCACGGAGCTGAAGGATGACCAGGTCAAAAAGATTGACAAGTATCTGTATGCCATGCGGCTCTCCGATGAAACTCTCATAGATATCATGACTCGCTTCAGGAAGGAGATGAAGAATGGCCTCTCCCGGGATTTTAATCCAACAGCCACAGTCAAGATGTTGCCAACATTCGTAAGGTCCATTCCTGATGGCTCTGAAAAGGGAGATTTCATTGCCCTGGATCTTGGTGGGTCTTCCTTTCGAATTCTGCGGGTGCAAGTGAATCATGAGAAAAACCAGAATGTTCACATGGAGTCCGAGGTTTATGACACCCCAGAGAACATCGTGCACGGCAGTGGAAGCCAGCTTTTTGATCATGTTGCTGAGTGCCTGGGAGATTTCATGGAGAAAAGGAAGATCAAGGACAAGAAGTTACCTGTGGGATTCACGTTTTCTTTTCCTTGCCAACAATCCAAAATAGATGAGGCCATCCTGATCACCTGGACAAAGCGATTTAAAGCGAGCGGAGTGGAAGGAGCAGATGTGGTCAAACTGCTTAACAAAG(...)TGACAGGCCTTCTGGGCCTCCAAAGCCCATCCTTGGGGTTCCCCCTCCCTGTGTGAAATGTATTATCACCAGCAGACACTGCCGGGCCTCCCTCCCGGGGGCACTGCCTGAAGGCGAGTGTGGGCATAGCATTAGCTGCTTCCTCCCCTCCTGGCACCCACTGTGGCCTGGCATCGCATCGTGGTGTGTCAATGCCACAAAATCGTGTGTCCGTGGAACCAGTCCTAGCCGCGTGTGACAGTCTTGCATTCTGTTTGTCTCGTGGGGGGAGGTGGACAGTCCTGCGGAAATGTGTCTTGTCTCCATTTGGATAAAAGGAACCAACCAACAAACAATGCCATCACTGGAATTTCCCACCGCTTTGTGAGCCGTGTCGTATGACCTAGTAAACTTTGTACCAATTCAAAAAAAAAAAAAAAAAA
    • Frederick Sanger• Único vivo dentre os 4 indivíduos que já venceram dois prêmios Nobel• ~1955: publicou a primeira sequência de aminoácidos da insulina – Ganhou o Nobel de química em 1958• 1964: descobriu que as proteínas de bactéria iniciavam-se com o aminoácido formil-metionina• 1967: desvendou a sequência do RNA ribossomal 5S• 1975: inventou o método dideóxi para o sequenciamento do DNA• 1977: sequencia, pela primeira vez, o genoma inteiro de um organismo, o bacteriófago phi X 174 – 11 genes in 5386 bases sequenciadas “à mão“ – Ganha o segundo Nobel de química em 1980
    • O método de Sanger, 1975 Polimerização do DNA a ser sequenciado (molde) na presença de: DNA polimerase primer tampão dNTPs (desóxinucleotídeo) ddNTPs (didesóxinucleotídeo) O que faria um nucleotídeo que, ao invés da extremidade 3’OH, tem uma extremidade 3’H? Como acontece a síntese de moléculas de DNA?http://www.youtube.com/watch?v=Mz-4LSfecM4&feature=related(dideóxi)
    • Amplificação interrompida com didesoxinucleotídeosDesoxinucleotídeos dNTP O didesóxinucleotídeo não tem a extremidade 3’OH livre (...) e, portanto, não permite a incorporação de novas bases a 3’ quando é adicionado, (...) interrompendo a formação da nova cadeia definitivamente ddNTP Didesoxinucleotídeos
    • G C T T T A C C T G C A A G T T C A AC T T C A G T C A TG G G A C C C A G5’ 3’ T A G ATGCTTC ||||||| TACGAAGACCGTCTAGACTTGTCACAATGACTATAACGAA3’ 5’
    • C T T T T C G C A C A A T A G T C A AC T G T G T C C AG TG G A C C C T A G5’ 3’ G ATGCTTC A ||||||||| TACGAAGACCGTCTAGACTTGTCACAATGACTATAACGAA3’ 5’
    • T C T C C T G T C A A G T T A C CA AC T T G T A G C A TG G G A C C C A G5’ 3’ T A G ATGCTTCTG |||||||||| TACGAAGACCGTCTAGACTTGTCACAATGACTATAACGAA3’
    • C AT G C TA T T A T TT C T G C G C CA A G T G C C A G T G A A T A G C GC A C5’ 3’ ATGCTTCTGGCAGATCT ||||||||||||||||| TACGAAGACCGTCTAGACTTGTCACAATGACTATAACGAA3’ 5’
    • A T GAA G A G T T T T GA G C T TA C T GT G C A T C C AC C G CA GA T C CC5’ 3’ ATGCTTCTGGCAGAT ||||||||||||||| TACGAAGACCGTCTAGACTTGTCACAATGACTATAACGAA3’ 5’
    • CC A T T T T T GAA G A TA CG A C G GT T C A G T GA GA T T C G C C C C AC5’ 3’ ATGCTTCTGGCAGAT ||||||||||||||| TACGAAGACCGTCTAGACTTGTCACAATGACTATAACGAA3’ 5’
    • A T T GA CC A G A G T T T C A G C T TA GT G T C T G C AC G T C CA GA C AC5’ 3’ ATGCTTCTGGCAGAT ||||||||||||||| TACGAAGACCGTCTAGACTTGTCACAATGACTATAACGAA3’ 5’
    • 5’ 3’ ATGCTTCTGGCAGATCTGAACAGTGTTACTGAT ATGCTTCTGGCAGATCTGAACAGTGT ATGCTTCTGGCAGATCTGAACAGTGTTACTGATATTGCTT ATGCTTCTGGCAGATCTGAACAGTGTTACTGATAT População de ATGCTTCTGGCAGATCTGAACAGTGTTACT moléculas ATGCTTCTGGCAGATCTGAACAGT ATGCTTCTGGCAGATCTGAACAGTGTTACTGATATTGCT Incorporação aleatória do ATGCTTCTGGCAGATCTGAACAGTGTTACTGATATT didesóxi ATGCTTCT ATGCTTCTGGCAGATCT Quantidade ATGCTTCTGGCAGATCTGAACAGTGTTACTGATATTGCTT precisa entre didesóxi e ATGCTTCTGGCAGATCTGAACAGTGTT desóxi ATGCTTCTGGCAGAT |||||||||||||||||||||||||||||||||||||||| TACGAAGACCGTCTAGACTTGTCACAATGACTATAACGAA3’ 5’
    • ATGCTTCTATGCTTCTGGCAGATATGCTTCTGGCAGATCTATGCTTCTGGCAGATCTGAACAGTATGCTTCTGGCAGATCTGAACAGTGTATGCTTCTGGCAGATCTGAACAGTGTTATGCTTCTGGCAGATCTGAACAGTGTTACTATGCTTCTGGCAGATCTGAACAGTGTTACTGATATGCTTCTGGCAGATCTGAACAGTGTTACTGATATATGCTTCTGGCAGATCTGAACAGTGTTACTGATATTATGCTTCTGGCAGATCTGAACAGTGTTACTGATATTGCTATGCTTCTGGCAGATCTGAACAGTGTTACTGATATTGCTTATGCTTCTGGCAGATCTGAACAGTGTTACTGATATTGCTT
    • • molde • polimerase • dN TPs•ddG TPs •ddA TPs •ddT TPs •ddC TPs G A T C
    • ATGCTTCTATGCTTCTGATGCTTCTGGATGCTTCTGGCATGCTTCTGGCAATGCTTCTGGCAGATGCTTCTGGCAGAATGCTTCTGGCAGATATGCTTCTGGCAGATCATGCTTCTGGCAGATCTATGCTTCTGGCAGATCTGATGCTTCTGGCAGATCTGAATGCTTCTGGCAGATCTGAAATGCTTCTGGCAGATCTGAACATGCTTCTGGCAGATCTGAACAATGCTTCTGGCAGATCTGAACAGATGCTTCTGGCAGATCTGAACAGTATGCTTCTGGCAGATCTGAACAGTGATGCTTCTGGCAGATCTGAACAGTGTATGCTTCTGGCAGATCTGAACAGTGTTATGCTTCTGGCAGATCTGAACAGTGTTAATGCTTCTGGCAGATCTGAACAGTGTTACATGCTTCTGGCAGATCTGAACAGTGTTACTATGCTTCTGGCAGATCTGAACAGTGTTACTGATGCTTCTGGCAGATCTGAACAGTGTTACTGAATGCTTCTGGCAGATCTGAACAGTGTTACTGATATGCTTCTGGCAGATCTGAACAGTGTTACTGATAATGCTTCTGGCAGATCTGAACAGTGTTACTGATATATGCTTCTGGCAGATCTGAACAGTGTTACTGATATTATGCTTCTGGCAGATCTGAACAGTGTTACTGATATTGATGCTTCTGGCAGATCTGAACAGTGTTACTGATATTGCATGCTTCTGGCAGATCTGAACAGTGTTACTGATATTGCTATGCTTCTGGCAGATCTGAACAGTGTTACTGATATTGCTT G A T CATGCTTCTGGCAGATCTGAACAGTGTTACTGATATTGCTT
    • ATGCTTCTATGCTTCTGATGCTTCTGGATGCTTCTGGCATGCTTCTGGCAATGCTTCTGGCAGATGCTTCTGGCAGAATGCTTCTGGCAGATATGCTTCTGGCAGATCATGCTTCTGGCAGATCTATGCTTCTGGCAGATCTGATGCTTCTGGCAGATCTGAATGCTTCTGGCAGATCTGAAATGCTTCTGGCAGATCTGAACATGCTTCTGGCAGATCTGAACAATGCTTCTGGCAGATCTGAACAGATGCTTCTGGCAGATCTGAACAGTATGCTTCTGGCAGATCTGAACAGTGATGCTTCTGGCAGATCTGAACAGTGTATGCTTCTGGCAGATCTGAACAGTGTTATGCTTCTGGCAGATCTGAACAGTGTTAATGCTTCTGGCAGATCTGAACAGTGTTACATGCTTCTGGCAGATCTGAACAGTGTTACTATGCTTCTGGCAGATCTGAACAGTGTTACTGATGCTTCTGGCAGATCTGAACAGTGTTACTGAATGCTTCTGGCAGATCTGAACAGTGTTACTGATATGCTTCTGGCAGATCTGAACAGTGTTACTGATAATGCTTCTGGCAGATCTGAACAGTGTTACTGATATATGCTTCTGGCAGATCTGAACAGTGTTACTGATATTATGCTTCTGGCAGATCTGAACAGTGTTACTGATATTGATGCTTCTGGCAGATCTGAACAGTGTTACTGATATTGCATGCTTCTGGCAGATCTGAACAGTGTTACTGATATTGCTATGCTTCTGGCAGATCTGAACAGTGTTACTGATATTGCTTATGCTTCTGGCAGATCTGAACAGTGTTACTGATATTGCTT
    • Modelo originalEtapa 1 Marcação do primerAmplificaçãoTipo-PCr 4 reações necessárias, uma para cada base Eletroforese separa fragmentos deEtapa 2 diferentes tamanhosEletroforese Leitura manual da sequência de baixo pra cima
    • Sanger e o fago Phi 174 De fato, esse tipo de sequenciamento manual continuou acontecendo por décadas...
    • Modelo moderno Applied Byosystems, 1986 Marcação fluorescente do ddNTP Leroy Hood, 1938- 1 reação necessária, todas as bases lidas ao mesmo tempo Eletroforese separa fragmentos de diferentes tamanhos Leitura da automática sequência, de baixo pra cima, por um laser http://www.youtube.com/watc h?v=ezAefHhvecM
    • Cromatograma
    • As máquinas necessárias para o sequenciamento• Primeira etapa: junta-se os reagentes em poços de placas e coloca-se na máquina de PCR para a reação de amplificação interrompida• Diferenças com relação ao PCR – Utilização de um só primer – Utilização dos ddNTPs• Uma vez prontas, as sequências de diferentes tamanhos contendo os didesóxi amplificados devem ser enviadas ao sequenciador de DNA mais próximo
    • O que faz um sequenciador de DNA?• Segunda etapa: realiza a eletroforese capilar – O sequenciador executa a eletroforese em géis capilares ultra-finos – Um sensor é responsável por emitir um laser e verificar qual o comprimento de onda emitido pelo didesóxi
    • ExercícioDê a sequência de DNA da canaleta apontadaazul = Guaninaamarelo = Timinavermelha = Adeninaverde = Citosinahttp://www.youtube.com/watch?v=dUjMf2ZezIw&feature=related